data_5XF0 # _entry.id 5XF0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XF0 pdb_00005xf0 10.2210/pdb5xf0/pdb WWPDB D_1300003403 ? ? BMRB 27064 ? 10.13018/BMR27064 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-11 2 'Structure model' 1 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' pdbx_nmr_software 7 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5XF0 _pdbx_database_status.recvd_initial_deposition_date 2017-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27064 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jin, S.J.' 1 ? 'Xia, B.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CN _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Cell' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1674-8018 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 310 _citation.page_last 315 _citation.title 'Zn(II) can mediate self-association of the extracellular C-terminal domain of CD147' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s13238-017-0443-1 _citation.pdbx_database_id_PubMed 28822092 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jin, S.' 1 ? primary 'Ding, P.' 2 ? primary 'Chu, P.' 3 ? primary 'Li, H.' 4 ? primary 'Sun, J.' 5 ? primary 'Liang, D.' 6 ? primary 'Song, F.' 7 ? primary 'Xia, B.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Basigin _entity.formula_weight 12008.415 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 215-321' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;CD147, 5F7,Collagenase stimulatory factor,Extracellular matrix metalloproteinase inducer,EMMPRIN,Leukocyte activation antigen M6,OK blood group antigen,Tumor cell-derived collagenase stimulatory factor,TCSF ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNME ADPGQYRCNGTSSKGSDQAIITLRVRSH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNME ADPGQYRCNGTSSKGSDQAIITLRVRSH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLN n 1 4 LEU n 1 5 HIS n 1 6 GLY n 1 7 PRO n 1 8 PRO n 1 9 ARG n 1 10 VAL n 1 11 LYS n 1 12 ALA n 1 13 VAL n 1 14 LYS n 1 15 SER n 1 16 SER n 1 17 GLU n 1 18 HIS n 1 19 ILE n 1 20 ASN n 1 21 GLU n 1 22 GLY n 1 23 GLU n 1 24 THR n 1 25 ALA n 1 26 MET n 1 27 LEU n 1 28 VAL n 1 29 CYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 SER n 1 34 VAL n 1 35 PRO n 1 36 PRO n 1 37 VAL n 1 38 THR n 1 39 ASP n 1 40 TRP n 1 41 ALA n 1 42 TRP n 1 43 TYR n 1 44 LYS n 1 45 ILE n 1 46 THR n 1 47 ASP n 1 48 SER n 1 49 GLU n 1 50 ASP n 1 51 LYS n 1 52 ALA n 1 53 LEU n 1 54 MET n 1 55 ASN n 1 56 GLY n 1 57 SER n 1 58 GLU n 1 59 SER n 1 60 ARG n 1 61 PHE n 1 62 PHE n 1 63 VAL n 1 64 SER n 1 65 SER n 1 66 SER n 1 67 GLN n 1 68 GLY n 1 69 ARG n 1 70 SER n 1 71 GLU n 1 72 LEU n 1 73 HIS n 1 74 ILE n 1 75 GLU n 1 76 ASN n 1 77 LEU n 1 78 ASN n 1 79 MET n 1 80 GLU n 1 81 ALA n 1 82 ASP n 1 83 PRO n 1 84 GLY n 1 85 GLN n 1 86 TYR n 1 87 ARG n 1 88 CYS n 1 89 ASN n 1 90 GLY n 1 91 THR n 1 92 SER n 1 93 SER n 1 94 LYS n 1 95 GLY n 1 96 SER n 1 97 ASP n 1 98 GLN n 1 99 ALA n 1 100 ILE n 1 101 ILE n 1 102 THR n 1 103 LEU n 1 104 ARG n 1 105 VAL n 1 106 ARG n 1 107 SER n 1 108 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BSG, UNQ6505/PRO21383' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'origami B(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 98 98 MET MET A . n A 1 2 ILE 2 99 99 ILE ILE A . n A 1 3 GLN 3 100 100 GLN GLN A . n A 1 4 LEU 4 101 101 LEU LEU A . n A 1 5 HIS 5 102 102 HIS HIS A . n A 1 6 GLY 6 103 103 GLY GLY A . n A 1 7 PRO 7 104 104 PRO PRO A . n A 1 8 PRO 8 105 105 PRO PRO A . n A 1 9 ARG 9 106 106 ARG ARG A . n A 1 10 VAL 10 107 107 VAL VAL A . n A 1 11 LYS 11 108 108 LYS LYS A . n A 1 12 ALA 12 109 109 ALA ALA A . n A 1 13 VAL 13 110 110 VAL VAL A . n A 1 14 LYS 14 111 111 LYS LYS A . n A 1 15 SER 15 112 112 SER SER A . n A 1 16 SER 16 113 113 SER SER A . n A 1 17 GLU 17 114 114 GLU GLU A . n A 1 18 HIS 18 115 115 HIS HIS A . n A 1 19 ILE 19 116 116 ILE ILE A . n A 1 20 ASN 20 117 117 ASN ASN A . n A 1 21 GLU 21 118 118 GLU GLU A . n A 1 22 GLY 22 119 119 GLY GLY A . n A 1 23 GLU 23 120 120 GLU GLU A . n A 1 24 THR 24 121 121 THR THR A . n A 1 25 ALA 25 122 122 ALA ALA A . n A 1 26 MET 26 123 123 MET MET A . n A 1 27 LEU 27 124 124 LEU LEU A . n A 1 28 VAL 28 125 125 VAL VAL A . n A 1 29 CYS 29 126 126 CYS CYS A . n A 1 30 LYS 30 127 127 LYS LYS A . n A 1 31 SER 31 128 128 SER SER A . n A 1 32 GLU 32 129 129 GLU GLU A . n A 1 33 SER 33 130 130 SER SER A . n A 1 34 VAL 34 131 131 VAL VAL A . n A 1 35 PRO 35 132 132 PRO PRO A . n A 1 36 PRO 36 133 133 PRO PRO A . n A 1 37 VAL 37 134 134 VAL VAL A . n A 1 38 THR 38 135 135 THR THR A . n A 1 39 ASP 39 136 136 ASP ASP A . n A 1 40 TRP 40 137 137 TRP TRP A . n A 1 41 ALA 41 138 138 ALA ALA A . n A 1 42 TRP 42 139 139 TRP TRP A . n A 1 43 TYR 43 140 140 TYR TYR A . n A 1 44 LYS 44 141 141 LYS LYS A . n A 1 45 ILE 45 142 142 ILE ILE A . n A 1 46 THR 46 143 143 THR THR A . n A 1 47 ASP 47 144 144 ASP ASP A . n A 1 48 SER 48 145 145 SER SER A . n A 1 49 GLU 49 146 146 GLU GLU A . n A 1 50 ASP 50 147 147 ASP ASP A . n A 1 51 LYS 51 148 148 LYS LYS A . n A 1 52 ALA 52 149 149 ALA ALA A . n A 1 53 LEU 53 150 150 LEU LEU A . n A 1 54 MET 54 151 151 MET MET A . n A 1 55 ASN 55 152 152 ASN ASN A . n A 1 56 GLY 56 153 153 GLY GLY A . n A 1 57 SER 57 154 154 SER SER A . n A 1 58 GLU 58 155 155 GLU GLU A . n A 1 59 SER 59 156 156 SER SER A . n A 1 60 ARG 60 157 157 ARG ARG A . n A 1 61 PHE 61 158 158 PHE PHE A . n A 1 62 PHE 62 159 159 PHE PHE A . n A 1 63 VAL 63 160 160 VAL VAL A . n A 1 64 SER 64 161 161 SER SER A . n A 1 65 SER 65 162 162 SER SER A . n A 1 66 SER 66 163 163 SER SER A . n A 1 67 GLN 67 164 164 GLN GLN A . n A 1 68 GLY 68 165 165 GLY GLY A . n A 1 69 ARG 69 166 166 ARG ARG A . n A 1 70 SER 70 167 167 SER SER A . n A 1 71 GLU 71 168 168 GLU GLU A . n A 1 72 LEU 72 169 169 LEU LEU A . n A 1 73 HIS 73 170 170 HIS HIS A . n A 1 74 ILE 74 171 171 ILE ILE A . n A 1 75 GLU 75 172 172 GLU GLU A . n A 1 76 ASN 76 173 173 ASN ASN A . n A 1 77 LEU 77 174 174 LEU LEU A . n A 1 78 ASN 78 175 175 ASN ASN A . n A 1 79 MET 79 176 176 MET MET A . n A 1 80 GLU 80 177 177 GLU GLU A . n A 1 81 ALA 81 178 178 ALA ALA A . n A 1 82 ASP 82 179 179 ASP ASP A . n A 1 83 PRO 83 180 180 PRO PRO A . n A 1 84 GLY 84 181 181 GLY GLY A . n A 1 85 GLN 85 182 182 GLN GLN A . n A 1 86 TYR 86 183 183 TYR TYR A . n A 1 87 ARG 87 184 184 ARG ARG A . n A 1 88 CYS 88 185 185 CYS CYS A . n A 1 89 ASN 89 186 186 ASN ASN A . n A 1 90 GLY 90 187 187 GLY GLY A . n A 1 91 THR 91 188 188 THR THR A . n A 1 92 SER 92 189 189 SER SER A . n A 1 93 SER 93 190 190 SER SER A . n A 1 94 LYS 94 191 191 LYS LYS A . n A 1 95 GLY 95 192 192 GLY GLY A . n A 1 96 SER 96 193 193 SER SER A . n A 1 97 ASP 97 194 194 ASP ASP A . n A 1 98 GLN 98 195 195 GLN GLN A . n A 1 99 ALA 99 196 196 ALA ALA A . n A 1 100 ILE 100 197 197 ILE ILE A . n A 1 101 ILE 101 198 198 ILE ILE A . n A 1 102 THR 102 199 199 THR THR A . n A 1 103 LEU 103 200 200 LEU LEU A . n A 1 104 ARG 104 201 201 ARG ARG A . n A 1 105 VAL 105 202 202 VAL VAL A . n A 1 106 ARG 106 203 203 ARG ARG A . n A 1 107 SER 107 204 204 SER SER A . n A 1 108 HIS 108 205 205 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XF0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5XF0 _struct.title 'Solution structure of the IgI domain of CD147' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XF0 _struct_keywords.text 'IG-like Domain, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BASI_HUMAN _struct_ref.pdbx_db_accession P35613 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEA DPGQYRCNGTSSKGSDQAIITLRVRSH ; _struct_ref.pdbx_align_begin 215 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XF0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35613 _struct_ref_seq.db_align_beg 215 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 99 _struct_ref_seq.pdbx_auth_seq_align_end 205 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5XF0 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P35613 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 98 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6760 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'native gel electrophoresis' ? 2 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 153 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 156 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 29 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 88 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 126 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 185 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.010 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 29 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 88 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 126 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 185 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 1 -1.78 2 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 2 -2.99 3 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 3 -2.92 4 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 4 -6.00 5 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 5 -1.64 6 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 6 -4.88 7 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 7 8.24 8 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 8 3.00 9 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 9 -3.46 10 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 10 -4.08 11 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 11 -7.16 12 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 12 -4.44 13 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 13 2.23 14 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 14 7.65 15 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 15 -4.35 16 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 16 8.14 17 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 17 -4.96 18 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 18 3.28 19 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 19 9.32 20 VAL 34 A . ? VAL 131 A PRO 35 A ? PRO 132 A 20 -2.61 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 10 ? ALA A 12 ? VAL A 107 ALA A 109 AA1 2 ALA A 25 ? SER A 31 ? ALA A 122 SER A 128 AA1 3 ARG A 69 ? ILE A 74 ? ARG A 166 ILE A 171 AA1 4 PHE A 61 ? SER A 66 ? PHE A 158 SER A 163 AA2 1 SER A 16 ? ASN A 20 ? SER A 113 ASN A 117 AA2 2 GLY A 95 ? ARG A 106 ? GLY A 192 ARG A 203 AA2 3 GLY A 84 ? SER A 92 ? GLY A 181 SER A 189 AA2 4 VAL A 37 ? ILE A 45 ? VAL A 134 ILE A 142 AA2 5 ASP A 50 ? LEU A 53 ? ASP A 147 LEU A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 11 ? N LYS A 108 O LYS A 30 ? O LYS A 127 AA1 2 3 N CYS A 29 ? N CYS A 126 O SER A 70 ? O SER A 167 AA1 3 4 O HIS A 73 ? O HIS A 170 N PHE A 62 ? N PHE A 159 AA2 1 2 N ILE A 19 ? N ILE A 116 O ARG A 104 ? O ARG A 201 AA2 2 3 O ASP A 97 ? O ASP A 194 N GLY A 90 ? N GLY A 187 AA2 3 4 O ARG A 87 ? O ARG A 184 N TYR A 43 ? N TYR A 140 AA2 4 5 N LYS A 44 ? N LYS A 141 O LYS A 51 ? O LYS A 148 # _pdbx_entry_details.entry_id 5XF0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 17 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 161 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 168 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.46 120.30 3.16 0.50 N 2 2 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 125.64 120.30 5.34 0.50 N 3 2 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH2 A ARG 157 ? ? 117.22 120.30 -3.08 0.50 N 4 2 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.77 120.30 3.47 0.50 N 5 3 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.52 120.30 3.22 0.50 N 6 3 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.52 120.30 3.22 0.50 N 7 4 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.46 120.30 3.16 0.50 N 8 4 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.79 120.30 3.49 0.50 N 9 5 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.43 120.30 3.13 0.50 N 10 6 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.55 120.30 3.25 0.50 N 11 7 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.45 120.30 3.15 0.50 N 12 7 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.57 120.30 3.27 0.50 N 13 8 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.37 120.30 3.07 0.50 N 14 8 NE A ARG 166 ? ? CZ A ARG 166 ? ? NH1 A ARG 166 ? ? 123.45 120.30 3.15 0.50 N 15 8 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.84 120.30 3.54 0.50 N 16 9 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.62 120.30 3.32 0.50 N 17 10 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.51 120.30 3.21 0.50 N 18 10 NE A ARG 166 ? ? CZ A ARG 166 ? ? NH1 A ARG 166 ? ? 123.91 120.30 3.61 0.50 N 19 10 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.52 120.30 3.22 0.50 N 20 11 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 123.39 120.30 3.09 0.50 N 21 11 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.81 120.30 3.51 0.50 N 22 12 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 125.82 120.30 5.52 0.50 N 23 12 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH2 A ARG 157 ? ? 116.94 120.30 -3.36 0.50 N 24 13 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.36 120.30 3.06 0.50 N 25 13 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 123.56 120.30 3.26 0.50 N 26 14 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.51 120.30 3.21 0.50 N 27 14 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.41 120.30 3.11 0.50 N 28 15 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.30 120.30 3.00 0.50 N 29 15 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.74 120.30 3.44 0.50 N 30 16 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.68 120.30 3.38 0.50 N 31 17 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.54 120.30 3.24 0.50 N 32 17 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 124.11 120.30 3.81 0.50 N 33 18 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 124.92 120.30 4.62 0.50 N 34 19 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.30 120.30 3.00 0.50 N 35 19 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 125.74 120.30 5.44 0.50 N 36 19 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH2 A ARG 157 ? ? 117.05 120.30 -3.25 0.50 N 37 19 NE A ARG 166 ? ? CZ A ARG 166 ? ? NH1 A ARG 166 ? ? 123.43 120.30 3.13 0.50 N 38 19 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.87 120.30 3.57 0.50 N 39 20 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 123.32 120.30 3.02 0.50 N 40 20 NE A ARG 184 ? ? CZ A ARG 184 ? ? NH1 A ARG 184 ? ? 123.77 120.30 3.47 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 145 ? ? -148.68 -8.56 2 1 ASP A 147 ? ? -102.07 74.17 3 1 LYS A 148 ? ? -65.28 95.21 4 1 ASN A 152 ? ? -49.76 102.86 5 1 SER A 156 ? ? 54.47 15.81 6 1 ARG A 157 ? ? -141.77 -20.40 7 2 SER A 145 ? ? -151.86 -4.31 8 2 ASP A 147 ? ? -118.47 72.77 9 3 SER A 145 ? ? -150.16 -5.08 10 3 ASP A 147 ? ? -115.13 72.36 11 4 SER A 145 ? ? -148.23 -1.90 12 4 ASP A 147 ? ? -116.62 67.07 13 4 ASN A 152 ? ? -63.84 80.31 14 5 SER A 145 ? ? -150.65 -5.75 15 5 ASP A 147 ? ? -118.88 73.78 16 6 ASP A 147 ? ? -110.57 72.70 17 6 GLU A 155 ? ? 54.23 -167.80 18 6 ARG A 157 ? ? -132.84 -33.65 19 7 SER A 145 ? ? -150.58 -6.06 20 7 ASP A 147 ? ? -119.07 73.35 21 8 SER A 145 ? ? -142.91 -28.28 22 8 SER A 156 ? ? -75.56 48.28 23 8 ARG A 157 ? ? -160.50 -36.61 24 9 SER A 145 ? ? -146.71 -6.32 25 9 ASP A 147 ? ? -107.21 74.84 26 9 LYS A 148 ? ? -65.34 99.34 27 9 ASN A 152 ? ? -63.65 76.12 28 10 SER A 145 ? ? -145.35 -19.99 29 11 ILE A 99 ? ? 65.46 137.25 30 11 SER A 145 ? ? -148.68 -11.68 31 11 ASP A 147 ? ? -105.60 75.51 32 11 LYS A 148 ? ? -66.01 94.88 33 11 SER A 154 ? ? -78.73 -149.16 34 12 SER A 145 ? ? -147.62 -12.72 35 12 ASP A 147 ? ? -100.42 76.94 36 12 ASN A 152 ? ? -62.65 77.84 37 13 SER A 145 ? ? -149.66 -19.10 38 14 SER A 145 ? ? -147.48 -21.68 39 14 ASP A 147 ? ? -111.87 75.21 40 14 LYS A 148 ? ? -65.31 99.49 41 15 SER A 145 ? ? -152.56 -5.34 42 15 ASP A 147 ? ? -118.77 72.61 43 16 SER A 145 ? ? -149.83 -9.41 44 16 ASP A 147 ? ? -101.90 75.98 45 16 LYS A 148 ? ? -64.79 97.52 46 17 LYS A 111 ? ? -109.49 79.30 47 17 SER A 145 ? ? -152.35 -2.87 48 17 ASP A 147 ? ? -119.49 73.28 49 17 ASN A 152 ? ? -65.86 76.80 50 18 SER A 145 ? ? -148.50 -9.39 51 18 ASP A 147 ? ? -102.87 73.94 52 18 LYS A 148 ? ? -63.49 99.12 53 18 GLU A 155 ? ? -68.13 33.55 54 18 ARG A 157 ? ? -139.52 -30.78 55 19 SER A 145 ? ? -150.05 -22.24 56 19 ASP A 147 ? ? -116.18 72.33 57 20 SER A 145 ? ? -149.23 -4.24 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 9 HIS A 115 ? ? 0.088 'SIDE CHAIN' 2 17 ARG A 166 ? ? 0.090 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 5XF0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5XF0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5mM [U-13C; U-15N] CD147, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component CD147 _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ;50mM PBS 50mM NaCl 5mM EDTA ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D HCCH-COSY' 1 isotropic 6 1 1 '3D HBHA(CO)NH' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 2 isotropic 11 1 1 '3D 1H-13C NOESY' 2 isotropic 10 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic # _pdbx_nmr_refine.entry_id 5XF0 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are b5059 are NOE-derived distance constraints, 143 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' DYANA ? 'Guntert, Braun and Wuthrich' 3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 4 'peak picking' NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 500 ? 2 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 5XF0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_