data_5XYK # _entry.id 5XYK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5XYK pdb_00005xyk 10.2210/pdb5xyk/pdb WWPDB D_1300004387 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5XYK _pdbx_database_status.recvd_initial_deposition_date 2017-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Park, J.B.' 1 ? 'Yoo, Y.' 2 ? 'Kim, J.' 3 ? 'Cho, H.S.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of Transferase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, J.B.' 1 ? primary 'Yoo, Y.' 2 ? primary 'Kim, J.' 3 ? primary 'Cho, H.S.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5XYK _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.059 _cell.length_a_esd ? _cell.length_b 50.059 _cell.length_b_esd ? _cell.length_c 201.242 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5XYK _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative cytoplasmic protein' 39616.930 1 ? ? ? ? 2 non-polymer syn ARGININE 175.209 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 4 non-polymer syn "URIDINE-5'-DIPHOSPHATE" 404.161 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MARFNAAFTRIKIMFSRIRGLISCQSNTQTIAPTLSPPSSGHVSFAGIDYPLLPLNHQTPLVFQWFERNPDRFGQNEIPI INTQKNPYLNNIINAAIIEKERIIGIFVDGDFSKGQRKALGKLEQNYRNIKVIYNSDLNYSMYDKKLTTIYLENITKLEA QSASERDEVLLNGVKKSLEDVLKNNPEETLISSHNKDKGHLWFDFYRNLFLLKGSDAFLEAGKPGCHHLQPGGGCIYLDA DMLLTDKLGTLYLPDGIAIHVSRKDNHVSLENGIIAVNRSEHPALIKGLEIMHSKPYGDPYNDWLSKGLRHYFDGSHIQD YDAFCDFIEFKHENIIMNTSSLTASSWR ; _entity_poly.pdbx_seq_one_letter_code_can ;MARFNAAFTRIKIMFSRIRGLISCQSNTQTIAPTLSPPSSGHVSFAGIDYPLLPLNHQTPLVFQWFERNPDRFGQNEIPI INTQKNPYLNNIINAAIIEKERIIGIFVDGDFSKGQRKALGKLEQNYRNIKVIYNSDLNYSMYDKKLTTIYLENITKLEA QSASERDEVLLNGVKKSLEDVLKNNPEETLISSHNKDKGHLWFDFYRNLFLLKGSDAFLEAGKPGCHHLQPGGGCIYLDA DMLLTDKLGTLYLPDGIAIHVSRKDNHVSLENGIIAVNRSEHPALIKGLEIMHSKPYGDPYNDWLSKGLRHYFDGSHIQD YDAFCDFIEFKHENIIMNTSSLTASSWR ; _entity_poly.pdbx_strand_id E _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ARG n 1 4 PHE n 1 5 ASN n 1 6 ALA n 1 7 ALA n 1 8 PHE n 1 9 THR n 1 10 ARG n 1 11 ILE n 1 12 LYS n 1 13 ILE n 1 14 MET n 1 15 PHE n 1 16 SER n 1 17 ARG n 1 18 ILE n 1 19 ARG n 1 20 GLY n 1 21 LEU n 1 22 ILE n 1 23 SER n 1 24 CYS n 1 25 GLN n 1 26 SER n 1 27 ASN n 1 28 THR n 1 29 GLN n 1 30 THR n 1 31 ILE n 1 32 ALA n 1 33 PRO n 1 34 THR n 1 35 LEU n 1 36 SER n 1 37 PRO n 1 38 PRO n 1 39 SER n 1 40 SER n 1 41 GLY n 1 42 HIS n 1 43 VAL n 1 44 SER n 1 45 PHE n 1 46 ALA n 1 47 GLY n 1 48 ILE n 1 49 ASP n 1 50 TYR n 1 51 PRO n 1 52 LEU n 1 53 LEU n 1 54 PRO n 1 55 LEU n 1 56 ASN n 1 57 HIS n 1 58 GLN n 1 59 THR n 1 60 PRO n 1 61 LEU n 1 62 VAL n 1 63 PHE n 1 64 GLN n 1 65 TRP n 1 66 PHE n 1 67 GLU n 1 68 ARG n 1 69 ASN n 1 70 PRO n 1 71 ASP n 1 72 ARG n 1 73 PHE n 1 74 GLY n 1 75 GLN n 1 76 ASN n 1 77 GLU n 1 78 ILE n 1 79 PRO n 1 80 ILE n 1 81 ILE n 1 82 ASN n 1 83 THR n 1 84 GLN n 1 85 LYS n 1 86 ASN n 1 87 PRO n 1 88 TYR n 1 89 LEU n 1 90 ASN n 1 91 ASN n 1 92 ILE n 1 93 ILE n 1 94 ASN n 1 95 ALA n 1 96 ALA n 1 97 ILE n 1 98 ILE n 1 99 GLU n 1 100 LYS n 1 101 GLU n 1 102 ARG n 1 103 ILE n 1 104 ILE n 1 105 GLY n 1 106 ILE n 1 107 PHE n 1 108 VAL n 1 109 ASP n 1 110 GLY n 1 111 ASP n 1 112 PHE n 1 113 SER n 1 114 LYS n 1 115 GLY n 1 116 GLN n 1 117 ARG n 1 118 LYS n 1 119 ALA n 1 120 LEU n 1 121 GLY n 1 122 LYS n 1 123 LEU n 1 124 GLU n 1 125 GLN n 1 126 ASN n 1 127 TYR n 1 128 ARG n 1 129 ASN n 1 130 ILE n 1 131 LYS n 1 132 VAL n 1 133 ILE n 1 134 TYR n 1 135 ASN n 1 136 SER n 1 137 ASP n 1 138 LEU n 1 139 ASN n 1 140 TYR n 1 141 SER n 1 142 MET n 1 143 TYR n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 LEU n 1 148 THR n 1 149 THR n 1 150 ILE n 1 151 TYR n 1 152 LEU n 1 153 GLU n 1 154 ASN n 1 155 ILE n 1 156 THR n 1 157 LYS n 1 158 LEU n 1 159 GLU n 1 160 ALA n 1 161 GLN n 1 162 SER n 1 163 ALA n 1 164 SER n 1 165 GLU n 1 166 ARG n 1 167 ASP n 1 168 GLU n 1 169 VAL n 1 170 LEU n 1 171 LEU n 1 172 ASN n 1 173 GLY n 1 174 VAL n 1 175 LYS n 1 176 LYS n 1 177 SER n 1 178 LEU n 1 179 GLU n 1 180 ASP n 1 181 VAL n 1 182 LEU n 1 183 LYS n 1 184 ASN n 1 185 ASN n 1 186 PRO n 1 187 GLU n 1 188 GLU n 1 189 THR n 1 190 LEU n 1 191 ILE n 1 192 SER n 1 193 SER n 1 194 HIS n 1 195 ASN n 1 196 LYS n 1 197 ASP n 1 198 LYS n 1 199 GLY n 1 200 HIS n 1 201 LEU n 1 202 TRP n 1 203 PHE n 1 204 ASP n 1 205 PHE n 1 206 TYR n 1 207 ARG n 1 208 ASN n 1 209 LEU n 1 210 PHE n 1 211 LEU n 1 212 LEU n 1 213 LYS n 1 214 GLY n 1 215 SER n 1 216 ASP n 1 217 ALA n 1 218 PHE n 1 219 LEU n 1 220 GLU n 1 221 ALA n 1 222 GLY n 1 223 LYS n 1 224 PRO n 1 225 GLY n 1 226 CYS n 1 227 HIS n 1 228 HIS n 1 229 LEU n 1 230 GLN n 1 231 PRO n 1 232 GLY n 1 233 GLY n 1 234 GLY n 1 235 CYS n 1 236 ILE n 1 237 TYR n 1 238 LEU n 1 239 ASP n 1 240 ALA n 1 241 ASP n 1 242 MET n 1 243 LEU n 1 244 LEU n 1 245 THR n 1 246 ASP n 1 247 LYS n 1 248 LEU n 1 249 GLY n 1 250 THR n 1 251 LEU n 1 252 TYR n 1 253 LEU n 1 254 PRO n 1 255 ASP n 1 256 GLY n 1 257 ILE n 1 258 ALA n 1 259 ILE n 1 260 HIS n 1 261 VAL n 1 262 SER n 1 263 ARG n 1 264 LYS n 1 265 ASP n 1 266 ASN n 1 267 HIS n 1 268 VAL n 1 269 SER n 1 270 LEU n 1 271 GLU n 1 272 ASN n 1 273 GLY n 1 274 ILE n 1 275 ILE n 1 276 ALA n 1 277 VAL n 1 278 ASN n 1 279 ARG n 1 280 SER n 1 281 GLU n 1 282 HIS n 1 283 PRO n 1 284 ALA n 1 285 LEU n 1 286 ILE n 1 287 LYS n 1 288 GLY n 1 289 LEU n 1 290 GLU n 1 291 ILE n 1 292 MET n 1 293 HIS n 1 294 SER n 1 295 LYS n 1 296 PRO n 1 297 TYR n 1 298 GLY n 1 299 ASP n 1 300 PRO n 1 301 TYR n 1 302 ASN n 1 303 ASP n 1 304 TRP n 1 305 LEU n 1 306 SER n 1 307 LYS n 1 308 GLY n 1 309 LEU n 1 310 ARG n 1 311 HIS n 1 312 TYR n 1 313 PHE n 1 314 ASP n 1 315 GLY n 1 316 SER n 1 317 HIS n 1 318 ILE n 1 319 GLN n 1 320 ASP n 1 321 TYR n 1 322 ASP n 1 323 ALA n 1 324 PHE n 1 325 CYS n 1 326 ASP n 1 327 PHE n 1 328 ILE n 1 329 GLU n 1 330 PHE n 1 331 LYS n 1 332 HIS n 1 333 GLU n 1 334 ASN n 1 335 ILE n 1 336 ILE n 1 337 MET n 1 338 ASN n 1 339 THR n 1 340 SER n 1 341 SER n 1 342 LEU n 1 343 THR n 1 344 ALA n 1 345 SER n 1 346 SER n 1 347 TRP n 1 348 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 348 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene STM474_2223 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 4/74 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella typhimurium (strain 4/74)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 909946 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E8XCX6_SALT4 _struct_ref.pdbx_db_accession E8XCX6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MARFNAAFTRIKIMFSRIRGLISCQSNTQTIAPTLSPPSSGHVSFAGIDYPLLPLNHQTPLVFQWFERNPDRFGQNEIPI INTQKNPYLNNIINAAIIEKERIIGIFVDGDFSKGQRKALGKLEQNYRNIKVIYNSDLNYSMYDKKLTTIYLENITKLEA QSASERDEVLLNGVKKSLEDVLKNNPEETLISSHNKDKGHLWFDFYRNLFLLKGSDAFLEAGKPGCHHLQPGGGCIYLDA DMLLTDKLGTLYLPDGIAIHVSRKDNHVSLENGIIAVNRSEHPALIKGLEIMHSKPYGDPYNDWLSKGLRHYFDGSHIQD YDAFCDFIEFKHENIIMNTSSLTASSWR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5XYK _struct_ref_seq.pdbx_strand_id E _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 348 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E8XCX6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 348 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 348 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UDP 'RNA linking' . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5XYK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'EVAPORATION, RECRYSTALLIZATION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2M ammonium acetate 0.1M Bis-Tris pH5.5 25% PEG2250 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5XYK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.57 _reflns.d_resolution_low 67.08 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9052 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.01 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.01 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.03 _refine.B_iso_max ? _refine.B_iso_mean 31.524 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.862 _refine.correlation_coeff_Fo_to_Fc_free 0.822 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5XYK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.57 _refine.ls_d_res_low 67.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9052 _refine.ls_number_reflns_R_free 457 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.87 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.26242 _refine.ls_R_factor_R_free 0.28586 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.26120 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5H5Y _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.398 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.817 _refine.overall_SU_ML 0.321 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2442 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2480 _refine_hist.d_res_high 2.57 _refine_hist.d_res_low 67.08 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 2538 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2295 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.653 1.968 3436 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.097 3.000 5352 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.850 5.000 302 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.036 24.844 128 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.962 15.000 440 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.609 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.107 0.200 366 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 2805 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 506 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.015 3.147 1214 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.015 3.147 1213 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.228 4.712 1514 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.227 4.713 1515 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.040 3.299 1324 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.040 3.299 1325 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.284 4.877 1923 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.591 58.960 10701 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.591 58.958 10701 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.569 _refine_ls_shell.d_res_low 2.635 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.number_reflns_R_work 475 _refine_ls_shell.percent_reflns_obs 66.26 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.340 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.315 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5XYK _struct.title 'Structure of Transferase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5XYK _struct_keywords.text Transferase _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 69 ? PHE A 73 ? ASN E 69 PHE E 73 5 ? 5 HELX_P HELX_P2 AA2 PRO A 87 ? GLU A 99 ? PRO E 87 GLU E 99 1 ? 13 HELX_P HELX_P3 AA3 SER A 113 ? TYR A 127 ? SER E 113 TYR E 127 1 ? 15 HELX_P HELX_P4 AA4 SER A 136 ? LEU A 138 ? SER E 136 LEU E 138 5 ? 3 HELX_P HELX_P5 AA5 TYR A 140 ? ASP A 144 ? TYR E 140 ASP E 144 5 ? 5 HELX_P HELX_P6 AA6 LYS A 146 ? ALA A 160 ? LYS E 146 ALA E 160 1 ? 15 HELX_P HELX_P7 AA7 ASP A 167 ? ASN A 185 ? ASP E 167 ASN E 185 1 ? 19 HELX_P HELX_P8 AA8 THR A 189 ? HIS A 194 ? THR E 189 HIS E 194 1 ? 6 HELX_P HELX_P9 AA9 ASN A 195 ? LYS A 198 ? ASN E 195 LYS E 198 5 ? 4 HELX_P HELX_P10 AB1 GLY A 199 ? GLY A 214 ? GLY E 199 GLY E 214 1 ? 16 HELX_P HELX_P11 AB2 SER A 215 ? GLY A 222 ? SER E 215 GLY E 222 1 ? 8 HELX_P HELX_P12 AB3 HIS A 282 ? SER A 294 ? HIS E 282 SER E 294 1 ? 13 HELX_P HELX_P13 AB4 LEU A 305 ? ASP A 314 ? LEU E 305 ASP E 314 1 ? 10 HELX_P HELX_P14 AB5 ASP A 320 ? ILE A 328 ? ASP E 320 ILE E 328 1 ? 9 HELX_P HELX_P15 AB6 ASN A 338 ? LEU A 342 ? ASN E 338 LEU E 342 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 241 OD2 ? ? ? 1_555 C MN . MN ? ? E ASP 241 E MN 402 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc2 metalc ? ? A ASN 338 OD1 ? ? ? 1_555 C MN . MN ? ? E ASN 338 E MN 402 1_555 ? ? ? ? ? ? ? 2.370 ? ? metalc3 metalc ? ? C MN . MN ? ? ? 1_555 D UDP . O2B ? ? E MN 402 E UDP 403 1_555 ? ? ? ? ? ? ? 2.263 ? ? metalc4 metalc ? ? C MN . MN ? ? ? 1_555 D UDP . O2A ? ? E MN 402 E UDP 403 1_555 ? ? ? ? ? ? ? 1.956 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 264 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 264 _struct_mon_prot_cis.auth_asym_id E _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 265 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 265 _struct_mon_prot_cis.pdbx_auth_asym_id_2 E _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -16.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 42 ? PHE A 45 ? HIS E 42 PHE E 45 AA1 2 ILE A 48 ? LEU A 55 ? ILE E 48 LEU E 55 AA1 3 LEU A 251 ? PRO A 254 ? LEU E 251 PRO E 254 AA2 1 ILE A 130 ? TYR A 134 ? ILE E 130 TYR E 134 AA2 2 ILE A 104 ? ASP A 109 ? ILE E 104 ASP E 109 AA2 3 LEU A 61 ? PHE A 66 ? LEU E 61 PHE E 66 AA2 4 GLY A 233 ? LEU A 238 ? GLY E 233 LEU E 238 AA2 5 VAL A 268 ? ARG A 279 ? VAL E 268 ARG E 279 AA2 6 ILE A 257 ? ARG A 263 ? ILE E 257 ARG E 263 AA3 1 LEU A 243 ? LEU A 244 ? LEU E 243 LEU E 244 AA3 2 ILE A 335 ? ILE A 336 ? ILE E 335 ILE E 336 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 45 ? N PHE E 45 O ILE A 48 ? O ILE E 48 AA1 2 3 N LEU A 55 ? N LEU E 55 O LEU A 251 ? O LEU E 251 AA2 1 2 O LYS A 131 ? O LYS E 131 N ILE A 106 ? N ILE E 106 AA2 2 3 O GLY A 105 ? O GLY E 105 N LEU A 61 ? N LEU E 61 AA2 3 4 N VAL A 62 ? N VAL E 62 O LEU A 238 ? O LEU E 238 AA2 4 5 N TYR A 237 ? N TYR E 237 O ILE A 275 ? O ILE E 275 AA2 5 6 O GLU A 271 ? O GLU E 271 N HIS A 260 ? N HIS E 260 AA3 1 2 N LEU A 243 ? N LEU E 243 O ILE A 336 ? O ILE E 336 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software E ARG 401 ? 8 'binding site for residue ARG E 401' AC2 Software E MN 402 ? 5 'binding site for residue MN E 402' AC3 Software E UDP 403 ? 14 'binding site for residue UDP E 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 HIS A 260 ? HIS E 260 . ? 1_555 ? 2 AC1 8 GLU A 271 ? GLU E 271 . ? 1_555 ? 3 AC1 8 ASN A 272 ? ASN E 272 . ? 1_555 ? 4 AC1 8 GLY A 273 ? GLY E 273 . ? 1_555 ? 5 AC1 8 ASN A 338 ? ASN E 338 . ? 1_555 ? 6 AC1 8 SER A 340 ? SER E 340 . ? 1_555 ? 7 AC1 8 SER A 341 ? SER E 341 . ? 1_555 ? 8 AC1 8 UDP D . ? UDP E 403 . ? 1_555 ? 9 AC2 5 ASP A 239 ? ASP E 239 . ? 1_555 ? 10 AC2 5 ASP A 241 ? ASP E 241 . ? 1_555 ? 11 AC2 5 ASN A 338 ? ASN E 338 . ? 1_555 ? 12 AC2 5 SER A 340 ? SER E 340 . ? 1_555 ? 13 AC2 5 UDP D . ? UDP E 403 . ? 1_555 ? 14 AC3 14 GLN A 64 ? GLN E 64 . ? 1_555 ? 15 AC3 14 TRP A 65 ? TRP E 65 . ? 1_555 ? 16 AC3 14 PHE A 66 ? PHE E 66 . ? 1_555 ? 17 AC3 14 TYR A 88 ? TYR E 88 . ? 1_555 ? 18 AC3 14 PHE A 203 ? PHE E 203 . ? 1_555 ? 19 AC3 14 ARG A 207 ? ARG E 207 . ? 1_555 ? 20 AC3 14 TYR A 237 ? TYR E 237 . ? 1_555 ? 21 AC3 14 ASP A 239 ? ASP E 239 . ? 1_555 ? 22 AC3 14 ALA A 240 ? ALA E 240 . ? 1_555 ? 23 AC3 14 ASP A 241 ? ASP E 241 . ? 1_555 ? 24 AC3 14 ASN A 338 ? ASN E 338 . ? 1_555 ? 25 AC3 14 SER A 340 ? SER E 340 . ? 1_555 ? 26 AC3 14 ARG B . ? ARG E 401 . ? 1_555 ? 27 AC3 14 MN C . ? MN E 402 . ? 1_555 ? # _atom_sites.entry_id 5XYK _atom_sites.fract_transf_matrix[1][1] 0.019976 _atom_sites.fract_transf_matrix[1][2] 0.011533 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023067 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004969 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? E . n A 1 2 ALA 2 2 ? ? ? E . n A 1 3 ARG 3 3 ? ? ? E . n A 1 4 PHE 4 4 ? ? ? E . n A 1 5 ASN 5 5 ? ? ? E . n A 1 6 ALA 6 6 ? ? ? E . n A 1 7 ALA 7 7 ? ? ? E . n A 1 8 PHE 8 8 ? ? ? E . n A 1 9 THR 9 9 ? ? ? E . n A 1 10 ARG 10 10 ? ? ? E . n A 1 11 ILE 11 11 ? ? ? E . n A 1 12 LYS 12 12 ? ? ? E . n A 1 13 ILE 13 13 ? ? ? E . n A 1 14 MET 14 14 ? ? ? E . n A 1 15 PHE 15 15 ? ? ? E . n A 1 16 SER 16 16 ? ? ? E . n A 1 17 ARG 17 17 ? ? ? E . n A 1 18 ILE 18 18 ? ? ? E . n A 1 19 ARG 19 19 ? ? ? E . n A 1 20 GLY 20 20 ? ? ? E . n A 1 21 LEU 21 21 ? ? ? E . n A 1 22 ILE 22 22 ? ? ? E . n A 1 23 SER 23 23 ? ? ? E . n A 1 24 CYS 24 24 ? ? ? E . n A 1 25 GLN 25 25 ? ? ? E . n A 1 26 SER 26 26 ? ? ? E . n A 1 27 ASN 27 27 ? ? ? E . n A 1 28 THR 28 28 ? ? ? E . n A 1 29 GLN 29 29 ? ? ? E . n A 1 30 THR 30 30 ? ? ? E . n A 1 31 ILE 31 31 ? ? ? E . n A 1 32 ALA 32 32 ? ? ? E . n A 1 33 PRO 33 33 ? ? ? E . n A 1 34 THR 34 34 ? ? ? E . n A 1 35 LEU 35 35 ? ? ? E . n A 1 36 SER 36 36 ? ? ? E . n A 1 37 PRO 37 37 ? ? ? E . n A 1 38 PRO 38 38 ? ? ? E . n A 1 39 SER 39 39 ? ? ? E . n A 1 40 SER 40 40 40 SER SER E . n A 1 41 GLY 41 41 41 GLY GLY E . n A 1 42 HIS 42 42 42 HIS HIS E . n A 1 43 VAL 43 43 43 VAL VAL E . n A 1 44 SER 44 44 44 SER SER E . n A 1 45 PHE 45 45 45 PHE PHE E . n A 1 46 ALA 46 46 46 ALA ALA E . n A 1 47 GLY 47 47 47 GLY GLY E . n A 1 48 ILE 48 48 48 ILE ILE E . n A 1 49 ASP 49 49 49 ASP ASP E . n A 1 50 TYR 50 50 50 TYR TYR E . n A 1 51 PRO 51 51 51 PRO PRO E . n A 1 52 LEU 52 52 52 LEU LEU E . n A 1 53 LEU 53 53 53 LEU LEU E . n A 1 54 PRO 54 54 54 PRO PRO E . n A 1 55 LEU 55 55 55 LEU LEU E . n A 1 56 ASN 56 56 56 ASN ASN E . n A 1 57 HIS 57 57 57 HIS HIS E . n A 1 58 GLN 58 58 58 GLN GLN E . n A 1 59 THR 59 59 59 THR THR E . n A 1 60 PRO 60 60 60 PRO PRO E . n A 1 61 LEU 61 61 61 LEU LEU E . n A 1 62 VAL 62 62 62 VAL VAL E . n A 1 63 PHE 63 63 63 PHE PHE E . n A 1 64 GLN 64 64 64 GLN GLN E . n A 1 65 TRP 65 65 65 TRP TRP E . n A 1 66 PHE 66 66 66 PHE PHE E . n A 1 67 GLU 67 67 67 GLU GLU E . n A 1 68 ARG 68 68 68 ARG ARG E . n A 1 69 ASN 69 69 69 ASN ASN E . n A 1 70 PRO 70 70 70 PRO PRO E . n A 1 71 ASP 71 71 71 ASP ASP E . n A 1 72 ARG 72 72 72 ARG ARG E . n A 1 73 PHE 73 73 73 PHE PHE E . n A 1 74 GLY 74 74 74 GLY GLY E . n A 1 75 GLN 75 75 75 GLN GLN E . n A 1 76 ASN 76 76 76 ASN ASN E . n A 1 77 GLU 77 77 77 GLU GLU E . n A 1 78 ILE 78 78 78 ILE ILE E . n A 1 79 PRO 79 79 79 PRO PRO E . n A 1 80 ILE 80 80 80 ILE ILE E . n A 1 81 ILE 81 81 81 ILE ILE E . n A 1 82 ASN 82 82 82 ASN ASN E . n A 1 83 THR 83 83 83 THR THR E . n A 1 84 GLN 84 84 84 GLN GLN E . n A 1 85 LYS 85 85 85 LYS LYS E . n A 1 86 ASN 86 86 86 ASN ASN E . n A 1 87 PRO 87 87 87 PRO PRO E . n A 1 88 TYR 88 88 88 TYR TYR E . n A 1 89 LEU 89 89 89 LEU LEU E . n A 1 90 ASN 90 90 90 ASN ASN E . n A 1 91 ASN 91 91 91 ASN ASN E . n A 1 92 ILE 92 92 92 ILE ILE E . n A 1 93 ILE 93 93 93 ILE ILE E . n A 1 94 ASN 94 94 94 ASN ASN E . n A 1 95 ALA 95 95 95 ALA ALA E . n A 1 96 ALA 96 96 96 ALA ALA E . n A 1 97 ILE 97 97 97 ILE ILE E . n A 1 98 ILE 98 98 98 ILE ILE E . n A 1 99 GLU 99 99 99 GLU GLU E . n A 1 100 LYS 100 100 100 LYS LYS E . n A 1 101 GLU 101 101 101 GLU GLU E . n A 1 102 ARG 102 102 102 ARG ARG E . n A 1 103 ILE 103 103 103 ILE ILE E . n A 1 104 ILE 104 104 104 ILE ILE E . n A 1 105 GLY 105 105 105 GLY GLY E . n A 1 106 ILE 106 106 106 ILE ILE E . n A 1 107 PHE 107 107 107 PHE PHE E . n A 1 108 VAL 108 108 108 VAL VAL E . n A 1 109 ASP 109 109 109 ASP ASP E . n A 1 110 GLY 110 110 110 GLY GLY E . n A 1 111 ASP 111 111 111 ASP ASP E . n A 1 112 PHE 112 112 112 PHE PHE E . n A 1 113 SER 113 113 113 SER SER E . n A 1 114 LYS 114 114 114 LYS LYS E . n A 1 115 GLY 115 115 115 GLY GLY E . n A 1 116 GLN 116 116 116 GLN GLN E . n A 1 117 ARG 117 117 117 ARG ARG E . n A 1 118 LYS 118 118 118 LYS LYS E . n A 1 119 ALA 119 119 119 ALA ALA E . n A 1 120 LEU 120 120 120 LEU LEU E . n A 1 121 GLY 121 121 121 GLY GLY E . n A 1 122 LYS 122 122 122 LYS LYS E . n A 1 123 LEU 123 123 123 LEU LEU E . n A 1 124 GLU 124 124 124 GLU GLU E . n A 1 125 GLN 125 125 125 GLN GLN E . n A 1 126 ASN 126 126 126 ASN ASN E . n A 1 127 TYR 127 127 127 TYR TYR E . n A 1 128 ARG 128 128 128 ARG ARG E . n A 1 129 ASN 129 129 129 ASN ASN E . n A 1 130 ILE 130 130 130 ILE ILE E . n A 1 131 LYS 131 131 131 LYS LYS E . n A 1 132 VAL 132 132 132 VAL VAL E . n A 1 133 ILE 133 133 133 ILE ILE E . n A 1 134 TYR 134 134 134 TYR TYR E . n A 1 135 ASN 135 135 135 ASN ASN E . n A 1 136 SER 136 136 136 SER SER E . n A 1 137 ASP 137 137 137 ASP ASP E . n A 1 138 LEU 138 138 138 LEU LEU E . n A 1 139 ASN 139 139 139 ASN ASN E . n A 1 140 TYR 140 140 140 TYR TYR E . n A 1 141 SER 141 141 141 SER SER E . n A 1 142 MET 142 142 142 MET MET E . n A 1 143 TYR 143 143 143 TYR TYR E . n A 1 144 ASP 144 144 144 ASP ASP E . n A 1 145 LYS 145 145 145 LYS LYS E . n A 1 146 LYS 146 146 146 LYS LYS E . n A 1 147 LEU 147 147 147 LEU LEU E . n A 1 148 THR 148 148 148 THR THR E . n A 1 149 THR 149 149 149 THR THR E . n A 1 150 ILE 150 150 150 ILE ILE E . n A 1 151 TYR 151 151 151 TYR TYR E . n A 1 152 LEU 152 152 152 LEU LEU E . n A 1 153 GLU 153 153 153 GLU GLU E . n A 1 154 ASN 154 154 154 ASN ASN E . n A 1 155 ILE 155 155 155 ILE ILE E . n A 1 156 THR 156 156 156 THR THR E . n A 1 157 LYS 157 157 157 LYS LYS E . n A 1 158 LEU 158 158 158 LEU LEU E . n A 1 159 GLU 159 159 159 GLU GLU E . n A 1 160 ALA 160 160 160 ALA ALA E . n A 1 161 GLN 161 161 161 GLN GLN E . n A 1 162 SER 162 162 162 SER SER E . n A 1 163 ALA 163 163 163 ALA ALA E . n A 1 164 SER 164 164 164 SER SER E . n A 1 165 GLU 165 165 165 GLU GLU E . n A 1 166 ARG 166 166 166 ARG ARG E . n A 1 167 ASP 167 167 167 ASP ASP E . n A 1 168 GLU 168 168 168 GLU GLU E . n A 1 169 VAL 169 169 169 VAL VAL E . n A 1 170 LEU 170 170 170 LEU LEU E . n A 1 171 LEU 171 171 171 LEU LEU E . n A 1 172 ASN 172 172 172 ASN ASN E . n A 1 173 GLY 173 173 173 GLY GLY E . n A 1 174 VAL 174 174 174 VAL VAL E . n A 1 175 LYS 175 175 175 LYS LYS E . n A 1 176 LYS 176 176 176 LYS LYS E . n A 1 177 SER 177 177 177 SER SER E . n A 1 178 LEU 178 178 178 LEU LEU E . n A 1 179 GLU 179 179 179 GLU GLU E . n A 1 180 ASP 180 180 180 ASP ASP E . n A 1 181 VAL 181 181 181 VAL VAL E . n A 1 182 LEU 182 182 182 LEU LEU E . n A 1 183 LYS 183 183 183 LYS LYS E . n A 1 184 ASN 184 184 184 ASN ASN E . n A 1 185 ASN 185 185 185 ASN ASN E . n A 1 186 PRO 186 186 186 PRO PRO E . n A 1 187 GLU 187 187 187 GLU GLU E . n A 1 188 GLU 188 188 188 GLU GLU E . n A 1 189 THR 189 189 189 THR THR E . n A 1 190 LEU 190 190 190 LEU LEU E . n A 1 191 ILE 191 191 191 ILE ILE E . n A 1 192 SER 192 192 192 SER SER E . n A 1 193 SER 193 193 193 SER SER E . n A 1 194 HIS 194 194 194 HIS HIS E . n A 1 195 ASN 195 195 195 ASN ASN E . n A 1 196 LYS 196 196 196 LYS LYS E . n A 1 197 ASP 197 197 197 ASP ASP E . n A 1 198 LYS 198 198 198 LYS LYS E . n A 1 199 GLY 199 199 199 GLY GLY E . n A 1 200 HIS 200 200 200 HIS HIS E . n A 1 201 LEU 201 201 201 LEU LEU E . n A 1 202 TRP 202 202 202 TRP TRP E . n A 1 203 PHE 203 203 203 PHE PHE E . n A 1 204 ASP 204 204 204 ASP ASP E . n A 1 205 PHE 205 205 205 PHE PHE E . n A 1 206 TYR 206 206 206 TYR TYR E . n A 1 207 ARG 207 207 207 ARG ARG E . n A 1 208 ASN 208 208 208 ASN ASN E . n A 1 209 LEU 209 209 209 LEU LEU E . n A 1 210 PHE 210 210 210 PHE PHE E . n A 1 211 LEU 211 211 211 LEU LEU E . n A 1 212 LEU 212 212 212 LEU LEU E . n A 1 213 LYS 213 213 213 LYS LYS E . n A 1 214 GLY 214 214 214 GLY GLY E . n A 1 215 SER 215 215 215 SER SER E . n A 1 216 ASP 216 216 216 ASP ASP E . n A 1 217 ALA 217 217 217 ALA ALA E . n A 1 218 PHE 218 218 218 PHE PHE E . n A 1 219 LEU 219 219 219 LEU LEU E . n A 1 220 GLU 220 220 220 GLU GLU E . n A 1 221 ALA 221 221 221 ALA ALA E . n A 1 222 GLY 222 222 222 GLY GLY E . n A 1 223 LYS 223 223 223 LYS LYS E . n A 1 224 PRO 224 224 224 PRO PRO E . n A 1 225 GLY 225 225 225 GLY GLY E . n A 1 226 CYS 226 226 226 CYS CYS E . n A 1 227 HIS 227 227 227 HIS HIS E . n A 1 228 HIS 228 228 228 HIS HIS E . n A 1 229 LEU 229 229 229 LEU LEU E . n A 1 230 GLN 230 230 230 GLN GLN E . n A 1 231 PRO 231 231 231 PRO PRO E . n A 1 232 GLY 232 232 232 GLY GLY E . n A 1 233 GLY 233 233 233 GLY GLY E . n A 1 234 GLY 234 234 234 GLY GLY E . n A 1 235 CYS 235 235 235 CYS CYS E . n A 1 236 ILE 236 236 236 ILE ILE E . n A 1 237 TYR 237 237 237 TYR TYR E . n A 1 238 LEU 238 238 238 LEU LEU E . n A 1 239 ASP 239 239 239 ASP ASP E . n A 1 240 ALA 240 240 240 ALA ALA E . n A 1 241 ASP 241 241 241 ASP ASP E . n A 1 242 MET 242 242 242 MET MET E . n A 1 243 LEU 243 243 243 LEU LEU E . n A 1 244 LEU 244 244 244 LEU LEU E . n A 1 245 THR 245 245 245 THR THR E . n A 1 246 ASP 246 246 246 ASP ASP E . n A 1 247 LYS 247 247 247 LYS LYS E . n A 1 248 LEU 248 248 248 LEU LEU E . n A 1 249 GLY 249 249 249 GLY GLY E . n A 1 250 THR 250 250 250 THR THR E . n A 1 251 LEU 251 251 251 LEU LEU E . n A 1 252 TYR 252 252 252 TYR TYR E . n A 1 253 LEU 253 253 253 LEU LEU E . n A 1 254 PRO 254 254 254 PRO PRO E . n A 1 255 ASP 255 255 255 ASP ASP E . n A 1 256 GLY 256 256 256 GLY GLY E . n A 1 257 ILE 257 257 257 ILE ILE E . n A 1 258 ALA 258 258 258 ALA ALA E . n A 1 259 ILE 259 259 259 ILE ILE E . n A 1 260 HIS 260 260 260 HIS HIS E . n A 1 261 VAL 261 261 261 VAL VAL E . n A 1 262 SER 262 262 262 SER SER E . n A 1 263 ARG 263 263 263 ARG ARG E . n A 1 264 LYS 264 264 264 LYS LYS E . n A 1 265 ASP 265 265 265 ASP ASP E . n A 1 266 ASN 266 266 266 ASN ASN E . n A 1 267 HIS 267 267 267 HIS HIS E . n A 1 268 VAL 268 268 268 VAL VAL E . n A 1 269 SER 269 269 269 SER SER E . n A 1 270 LEU 270 270 270 LEU LEU E . n A 1 271 GLU 271 271 271 GLU GLU E . n A 1 272 ASN 272 272 272 ASN ASN E . n A 1 273 GLY 273 273 273 GLY GLY E . n A 1 274 ILE 274 274 274 ILE ILE E . n A 1 275 ILE 275 275 275 ILE ILE E . n A 1 276 ALA 276 276 276 ALA ALA E . n A 1 277 VAL 277 277 277 VAL VAL E . n A 1 278 ASN 278 278 278 ASN ASN E . n A 1 279 ARG 279 279 279 ARG ARG E . n A 1 280 SER 280 280 280 SER SER E . n A 1 281 GLU 281 281 281 GLU GLU E . n A 1 282 HIS 282 282 282 HIS HIS E . n A 1 283 PRO 283 283 283 PRO PRO E . n A 1 284 ALA 284 284 284 ALA ALA E . n A 1 285 LEU 285 285 285 LEU LEU E . n A 1 286 ILE 286 286 286 ILE ILE E . n A 1 287 LYS 287 287 287 LYS LYS E . n A 1 288 GLY 288 288 288 GLY GLY E . n A 1 289 LEU 289 289 289 LEU LEU E . n A 1 290 GLU 290 290 290 GLU GLU E . n A 1 291 ILE 291 291 291 ILE ILE E . n A 1 292 MET 292 292 292 MET MET E . n A 1 293 HIS 293 293 293 HIS HIS E . n A 1 294 SER 294 294 294 SER SER E . n A 1 295 LYS 295 295 295 LYS LYS E . n A 1 296 PRO 296 296 296 PRO PRO E . n A 1 297 TYR 297 297 297 TYR TYR E . n A 1 298 GLY 298 298 298 GLY GLY E . n A 1 299 ASP 299 299 299 ASP ASP E . n A 1 300 PRO 300 300 300 PRO PRO E . n A 1 301 TYR 301 301 301 TYR TYR E . n A 1 302 ASN 302 302 302 ASN ASN E . n A 1 303 ASP 303 303 303 ASP ASP E . n A 1 304 TRP 304 304 304 TRP TRP E . n A 1 305 LEU 305 305 305 LEU LEU E . n A 1 306 SER 306 306 306 SER SER E . n A 1 307 LYS 307 307 307 LYS LYS E . n A 1 308 GLY 308 308 308 GLY GLY E . n A 1 309 LEU 309 309 309 LEU LEU E . n A 1 310 ARG 310 310 310 ARG ARG E . n A 1 311 HIS 311 311 311 HIS HIS E . n A 1 312 TYR 312 312 312 TYR TYR E . n A 1 313 PHE 313 313 313 PHE PHE E . n A 1 314 ASP 314 314 314 ASP ASP E . n A 1 315 GLY 315 315 315 GLY GLY E . n A 1 316 SER 316 316 316 SER SER E . n A 1 317 HIS 317 317 317 HIS HIS E . n A 1 318 ILE 318 318 318 ILE ILE E . n A 1 319 GLN 319 319 319 GLN GLN E . n A 1 320 ASP 320 320 320 ASP ASP E . n A 1 321 TYR 321 321 321 TYR TYR E . n A 1 322 ASP 322 322 322 ASP ASP E . n A 1 323 ALA 323 323 323 ALA ALA E . n A 1 324 PHE 324 324 324 PHE PHE E . n A 1 325 CYS 325 325 325 CYS CYS E . n A 1 326 ASP 326 326 326 ASP ASP E . n A 1 327 PHE 327 327 327 PHE PHE E . n A 1 328 ILE 328 328 328 ILE ILE E . n A 1 329 GLU 329 329 329 GLU GLU E . n A 1 330 PHE 330 330 330 PHE PHE E . n A 1 331 LYS 331 331 331 LYS LYS E . n A 1 332 HIS 332 332 332 HIS HIS E . n A 1 333 GLU 333 333 333 GLU GLU E . n A 1 334 ASN 334 334 334 ASN ASN E . n A 1 335 ILE 335 335 335 ILE ILE E . n A 1 336 ILE 336 336 336 ILE ILE E . n A 1 337 MET 337 337 337 MET MET E . n A 1 338 ASN 338 338 338 ASN ASN E . n A 1 339 THR 339 339 339 THR THR E . n A 1 340 SER 340 340 340 SER SER E . n A 1 341 SER 341 341 341 SER SER E . n A 1 342 LEU 342 342 342 LEU LEU E . n A 1 343 THR 343 343 ? ? ? E . n A 1 344 ALA 344 344 ? ? ? E . n A 1 345 SER 345 345 ? ? ? E . n A 1 346 SER 346 346 ? ? ? E . n A 1 347 TRP 347 347 ? ? ? E . n A 1 348 ARG 348 348 ? ? ? E . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ARG 1 401 1 ARG ARG E . C 3 MN 1 402 1 MN MN E . D 4 UDP 1 403 2 UDP UDP E . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 800 ? 1 MORE -13 ? 1 'SSA (A^2)' 14270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 241 ? E ASP 241 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 OD1 ? A ASN 338 ? E ASN 338 ? 1_555 91.3 ? 2 OD2 ? A ASP 241 ? E ASP 241 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 O2B ? D UDP . ? E UDP 403 ? 1_555 165.1 ? 3 OD1 ? A ASN 338 ? E ASN 338 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 O2B ? D UDP . ? E UDP 403 ? 1_555 99.7 ? 4 OD2 ? A ASP 241 ? E ASP 241 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 O2A ? D UDP . ? E UDP 403 ? 1_555 94.6 ? 5 OD1 ? A ASN 338 ? E ASN 338 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 O2A ? D UDP . ? E UDP 403 ? 1_555 172.9 ? 6 O2B ? D UDP . ? E UDP 403 ? 1_555 MN ? C MN . ? E MN 402 ? 1_555 O2A ? D UDP . ? E UDP 403 ? 1_555 75.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-11 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG E SER 340 ? ? MN E MN 402 ? ? 1.64 2 1 OD2 E ASP 299 ? ? N E ASN 302 ? ? 2.03 3 1 O E PRO 87 ? ? OD1 E ASN 91 ? ? 2.09 4 1 OH E TYR 143 ? ? OE1 E GLU 281 ? ? 2.09 5 1 O E LEU 190 ? ? OG E SER 193 ? ? 2.11 6 1 NH2 E ARG 263 ? ? OD1 E ASP 326 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS E 57 ? ? -55.26 -8.67 2 1 ASN E 76 ? ? -119.92 68.01 3 1 PRO E 79 ? ? -69.87 49.78 4 1 ASP E 109 ? ? -171.00 133.09 5 1 ALA E 284 ? ? -39.22 -38.17 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 E _pdbx_validate_peptide_omega.auth_seq_id_1 165 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 E _pdbx_validate_peptide_omega.auth_seq_id_2 166 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 E MET 1 ? A MET 1 2 1 Y 1 E ALA 2 ? A ALA 2 3 1 Y 1 E ARG 3 ? A ARG 3 4 1 Y 1 E PHE 4 ? A PHE 4 5 1 Y 1 E ASN 5 ? A ASN 5 6 1 Y 1 E ALA 6 ? A ALA 6 7 1 Y 1 E ALA 7 ? A ALA 7 8 1 Y 1 E PHE 8 ? A PHE 8 9 1 Y 1 E THR 9 ? A THR 9 10 1 Y 1 E ARG 10 ? A ARG 10 11 1 Y 1 E ILE 11 ? A ILE 11 12 1 Y 1 E LYS 12 ? A LYS 12 13 1 Y 1 E ILE 13 ? A ILE 13 14 1 Y 1 E MET 14 ? A MET 14 15 1 Y 1 E PHE 15 ? A PHE 15 16 1 Y 1 E SER 16 ? A SER 16 17 1 Y 1 E ARG 17 ? A ARG 17 18 1 Y 1 E ILE 18 ? A ILE 18 19 1 Y 1 E ARG 19 ? A ARG 19 20 1 Y 1 E GLY 20 ? A GLY 20 21 1 Y 1 E LEU 21 ? A LEU 21 22 1 Y 1 E ILE 22 ? A ILE 22 23 1 Y 1 E SER 23 ? A SER 23 24 1 Y 1 E CYS 24 ? A CYS 24 25 1 Y 1 E GLN 25 ? A GLN 25 26 1 Y 1 E SER 26 ? A SER 26 27 1 Y 1 E ASN 27 ? A ASN 27 28 1 Y 1 E THR 28 ? A THR 28 29 1 Y 1 E GLN 29 ? A GLN 29 30 1 Y 1 E THR 30 ? A THR 30 31 1 Y 1 E ILE 31 ? A ILE 31 32 1 Y 1 E ALA 32 ? A ALA 32 33 1 Y 1 E PRO 33 ? A PRO 33 34 1 Y 1 E THR 34 ? A THR 34 35 1 Y 1 E LEU 35 ? A LEU 35 36 1 Y 1 E SER 36 ? A SER 36 37 1 Y 1 E PRO 37 ? A PRO 37 38 1 Y 1 E PRO 38 ? A PRO 38 39 1 Y 1 E SER 39 ? A SER 39 40 1 Y 1 E THR 343 ? A THR 343 41 1 Y 1 E ALA 344 ? A ALA 344 42 1 Y 1 E SER 345 ? A SER 345 43 1 Y 1 E SER 346 ? A SER 346 44 1 Y 1 E TRP 347 ? A TRP 347 45 1 Y 1 E ARG 348 ? A ARG 348 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MN MN MN N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 UDP N1 N N N 370 UDP C2 C N N 371 UDP N3 N N N 372 UDP C4 C N N 373 UDP C5 C N N 374 UDP C6 C N N 375 UDP O2 O N N 376 UDP O4 O N N 377 UDP "C1'" C N R 378 UDP "C2'" C N R 379 UDP "O2'" O N N 380 UDP "C3'" C N S 381 UDP "C4'" C N R 382 UDP "O4'" O N N 383 UDP "O3'" O N N 384 UDP "C5'" C N N 385 UDP "O5'" O N N 386 UDP PA P N N 387 UDP O1A O N N 388 UDP O2A O N N 389 UDP O3A O N N 390 UDP PB P N N 391 UDP O1B O N N 392 UDP O2B O N N 393 UDP O3B O N N 394 UDP HN3 H N N 395 UDP H5 H N N 396 UDP H6 H N N 397 UDP "H1'" H N N 398 UDP "H2'" H N N 399 UDP "HO2'" H N N 400 UDP "H3'" H N N 401 UDP "H4'" H N N 402 UDP "HO3'" H N N 403 UDP "H5'1" H N N 404 UDP "H5'2" H N N 405 UDP HOA2 H N N 406 UDP HOB2 H N N 407 UDP HOB3 H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 UDP N1 C2 sing N N 356 UDP N1 C6 sing N N 357 UDP N1 "C1'" sing N N 358 UDP C2 N3 sing N N 359 UDP C2 O2 doub N N 360 UDP N3 C4 sing N N 361 UDP N3 HN3 sing N N 362 UDP C4 C5 sing N N 363 UDP C4 O4 doub N N 364 UDP C5 C6 doub N N 365 UDP C5 H5 sing N N 366 UDP C6 H6 sing N N 367 UDP "C1'" "C2'" sing N N 368 UDP "C1'" "O4'" sing N N 369 UDP "C1'" "H1'" sing N N 370 UDP "C2'" "O2'" sing N N 371 UDP "C2'" "C3'" sing N N 372 UDP "C2'" "H2'" sing N N 373 UDP "O2'" "HO2'" sing N N 374 UDP "C3'" "C4'" sing N N 375 UDP "C3'" "O3'" sing N N 376 UDP "C3'" "H3'" sing N N 377 UDP "C4'" "O4'" sing N N 378 UDP "C4'" "C5'" sing N N 379 UDP "C4'" "H4'" sing N N 380 UDP "O3'" "HO3'" sing N N 381 UDP "C5'" "O5'" sing N N 382 UDP "C5'" "H5'1" sing N N 383 UDP "C5'" "H5'2" sing N N 384 UDP "O5'" PA sing N N 385 UDP PA O1A doub N N 386 UDP PA O2A sing N N 387 UDP PA O3A sing N N 388 UDP O2A HOA2 sing N N 389 UDP O3A PB sing N N 390 UDP PB O1B doub N N 391 UDP PB O2B sing N N 392 UDP PB O3B sing N N 393 UDP O2B HOB2 sing N N 394 UDP O3B HOB3 sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ARG ? ? ARG ? ? 'SUBJECT OF INVESTIGATION' ? 2 MN ? ? MN ? ? 'SUBJECT OF INVESTIGATION' ? 3 UDP ? ? UDP ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ARGININE ARG 3 'MANGANESE (II) ION' MN 4 "URIDINE-5'-DIPHOSPHATE" UDP # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5H5Y _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #