data_5Y10 # _entry.id 5Y10 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Y10 pdb_00005y10 10.2210/pdb5y10/pdb WWPDB D_1300004485 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2024-11-06 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' atom_site_anisotrop 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' pdbx_branch_scheme 7 3 'Structure model' pdbx_chem_comp_identifier 8 3 'Structure model' pdbx_entity_branch 9 3 'Structure model' pdbx_entity_branch_descriptor 10 3 'Structure model' pdbx_entity_branch_link 11 3 'Structure model' pdbx_entity_branch_list 12 3 'Structure model' pdbx_entity_nonpoly 13 3 'Structure model' pdbx_nonpoly_scheme 14 3 'Structure model' pdbx_struct_assembly_gen 15 3 'Structure model' pdbx_validate_close_contact 16 3 'Structure model' struct_asym 17 3 'Structure model' struct_conn 18 3 'Structure model' struct_site 19 3 'Structure model' struct_site_gen 20 4 'Structure model' chem_comp 21 4 'Structure model' chem_comp_atom 22 4 'Structure model' chem_comp_bond 23 4 'Structure model' database_2 24 4 'Structure model' pdbx_entry_details 25 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_atom_site.auth_asym_id' 5 3 'Structure model' '_atom_site.auth_seq_id' 6 3 'Structure model' '_atom_site.label_asym_id' 7 3 'Structure model' '_atom_site.label_entity_id' 8 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 9 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 10 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 11 3 'Structure model' '_chem_comp.name' 12 3 'Structure model' '_chem_comp.type' 13 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 14 3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 15 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 3 'Structure model' '_struct_conn.pdbx_role' 19 3 'Structure model' '_struct_conn.pdbx_value_order' 20 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 21 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 4 'Structure model' '_chem_comp.pdbx_synonyms' 35 4 'Structure model' '_database_2.pdbx_DOI' 36 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5Y10 _pdbx_database_status.recvd_initial_deposition_date 2017-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, Y.' 1 ? 'Gao, F.' 2 ? 'Qi, J.X.' 3 ? 'Chai, Y.' 4 ? 'Gao, G.F.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first E7564 _citation.page_last E7573 _citation.title 'Structures of phlebovirus glycoprotein Gn and identification of a neutralizing antibody epitope' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1705176114 _citation.pdbx_database_id_PubMed 28827346 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.' 1 ? primary 'Zhu, Y.H.' 2 ? primary 'Gao, F.' 3 ? primary 'Jiao, Y.J.' 4 ? primary 'Oladejo, B.O.' 5 ? primary 'Chai, Y.' 6 ? primary 'Bi, Y.H.' 7 ? primary 'Lu, S.' 8 ? primary 'Dong, M.Q.' 9 ? primary 'Zhang, C.' 10 ? primary 'Huang, G.M.' 11 ? primary 'Wong, G.' 12 ? primary 'Li, N.' 13 ? primary 'Zhang, Y.F.' 14 ? primary 'Li, Y.' 15 ? primary 'Feng, W.H.' 16 ? primary 'Shi, Y.' 17 ? primary 'Liang, M.F.' 18 ? primary 'Zhang, R.G.' 19 ? primary 'Qi, J.X.' 20 ? primary 'Gao, G.F.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane glycoprotein polyprotein' 35367.039 1 ? ? 'UNP residues 20-340' ? 2 branched man 'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DSGPIICAGPIHSNKSADIPHLLGYSEKICQIDRLIHVSSWLRNHSQFQGYVGQRGGRSQVSYYPAENSYSRWSGLLSPC DADWLGMLVVKKAKGSDMIVPGPSYKGKVFFERPTFDGYVGWGCGSGKSRTESGELCSSDSGTSSGLLPSDRVLWIGDVA CQPMTPIPEETFLELKSFSQSEFPDICKIDGIVFNQCEGESLPQPFDVAWMDVGHSHKIIMREHKTKWVQESSSKDFVCY KEGTGPCSESEEKTCKTSGSCRGDMQFCKVAGCEHGEEASEAKCRCSLVHKPGEVVVSYGGMRVRPKCYGFSRMMATLEV N ; _entity_poly.pdbx_seq_one_letter_code_can ;DSGPIICAGPIHSNKSADIPHLLGYSEKICQIDRLIHVSSWLRNHSQFQGYVGQRGGRSQVSYYPAENSYSRWSGLLSPC DADWLGMLVVKKAKGSDMIVPGPSYKGKVFFERPTFDGYVGWGCGSGKSRTESGELCSSDSGTSSGLLPSDRVLWIGDVA CQPMTPIPEETFLELKSFSQSEFPDICKIDGIVFNQCEGESLPQPFDVAWMDVGHSHKIIMREHKTKWVQESSSKDFVCY KEGTGPCSESEEKTCKTSGSCRGDMQFCKVAGCEHGEEASEAKCRCSLVHKPGEVVVSYGGMRVRPKCYGFSRMMATLEV N ; _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 SER n 1 3 GLY n 1 4 PRO n 1 5 ILE n 1 6 ILE n 1 7 CYS n 1 8 ALA n 1 9 GLY n 1 10 PRO n 1 11 ILE n 1 12 HIS n 1 13 SER n 1 14 ASN n 1 15 LYS n 1 16 SER n 1 17 ALA n 1 18 ASP n 1 19 ILE n 1 20 PRO n 1 21 HIS n 1 22 LEU n 1 23 LEU n 1 24 GLY n 1 25 TYR n 1 26 SER n 1 27 GLU n 1 28 LYS n 1 29 ILE n 1 30 CYS n 1 31 GLN n 1 32 ILE n 1 33 ASP n 1 34 ARG n 1 35 LEU n 1 36 ILE n 1 37 HIS n 1 38 VAL n 1 39 SER n 1 40 SER n 1 41 TRP n 1 42 LEU n 1 43 ARG n 1 44 ASN n 1 45 HIS n 1 46 SER n 1 47 GLN n 1 48 PHE n 1 49 GLN n 1 50 GLY n 1 51 TYR n 1 52 VAL n 1 53 GLY n 1 54 GLN n 1 55 ARG n 1 56 GLY n 1 57 GLY n 1 58 ARG n 1 59 SER n 1 60 GLN n 1 61 VAL n 1 62 SER n 1 63 TYR n 1 64 TYR n 1 65 PRO n 1 66 ALA n 1 67 GLU n 1 68 ASN n 1 69 SER n 1 70 TYR n 1 71 SER n 1 72 ARG n 1 73 TRP n 1 74 SER n 1 75 GLY n 1 76 LEU n 1 77 LEU n 1 78 SER n 1 79 PRO n 1 80 CYS n 1 81 ASP n 1 82 ALA n 1 83 ASP n 1 84 TRP n 1 85 LEU n 1 86 GLY n 1 87 MET n 1 88 LEU n 1 89 VAL n 1 90 VAL n 1 91 LYS n 1 92 LYS n 1 93 ALA n 1 94 LYS n 1 95 GLY n 1 96 SER n 1 97 ASP n 1 98 MET n 1 99 ILE n 1 100 VAL n 1 101 PRO n 1 102 GLY n 1 103 PRO n 1 104 SER n 1 105 TYR n 1 106 LYS n 1 107 GLY n 1 108 LYS n 1 109 VAL n 1 110 PHE n 1 111 PHE n 1 112 GLU n 1 113 ARG n 1 114 PRO n 1 115 THR n 1 116 PHE n 1 117 ASP n 1 118 GLY n 1 119 TYR n 1 120 VAL n 1 121 GLY n 1 122 TRP n 1 123 GLY n 1 124 CYS n 1 125 GLY n 1 126 SER n 1 127 GLY n 1 128 LYS n 1 129 SER n 1 130 ARG n 1 131 THR n 1 132 GLU n 1 133 SER n 1 134 GLY n 1 135 GLU n 1 136 LEU n 1 137 CYS n 1 138 SER n 1 139 SER n 1 140 ASP n 1 141 SER n 1 142 GLY n 1 143 THR n 1 144 SER n 1 145 SER n 1 146 GLY n 1 147 LEU n 1 148 LEU n 1 149 PRO n 1 150 SER n 1 151 ASP n 1 152 ARG n 1 153 VAL n 1 154 LEU n 1 155 TRP n 1 156 ILE n 1 157 GLY n 1 158 ASP n 1 159 VAL n 1 160 ALA n 1 161 CYS n 1 162 GLN n 1 163 PRO n 1 164 MET n 1 165 THR n 1 166 PRO n 1 167 ILE n 1 168 PRO n 1 169 GLU n 1 170 GLU n 1 171 THR n 1 172 PHE n 1 173 LEU n 1 174 GLU n 1 175 LEU n 1 176 LYS n 1 177 SER n 1 178 PHE n 1 179 SER n 1 180 GLN n 1 181 SER n 1 182 GLU n 1 183 PHE n 1 184 PRO n 1 185 ASP n 1 186 ILE n 1 187 CYS n 1 188 LYS n 1 189 ILE n 1 190 ASP n 1 191 GLY n 1 192 ILE n 1 193 VAL n 1 194 PHE n 1 195 ASN n 1 196 GLN n 1 197 CYS n 1 198 GLU n 1 199 GLY n 1 200 GLU n 1 201 SER n 1 202 LEU n 1 203 PRO n 1 204 GLN n 1 205 PRO n 1 206 PHE n 1 207 ASP n 1 208 VAL n 1 209 ALA n 1 210 TRP n 1 211 MET n 1 212 ASP n 1 213 VAL n 1 214 GLY n 1 215 HIS n 1 216 SER n 1 217 HIS n 1 218 LYS n 1 219 ILE n 1 220 ILE n 1 221 MET n 1 222 ARG n 1 223 GLU n 1 224 HIS n 1 225 LYS n 1 226 THR n 1 227 LYS n 1 228 TRP n 1 229 VAL n 1 230 GLN n 1 231 GLU n 1 232 SER n 1 233 SER n 1 234 SER n 1 235 LYS n 1 236 ASP n 1 237 PHE n 1 238 VAL n 1 239 CYS n 1 240 TYR n 1 241 LYS n 1 242 GLU n 1 243 GLY n 1 244 THR n 1 245 GLY n 1 246 PRO n 1 247 CYS n 1 248 SER n 1 249 GLU n 1 250 SER n 1 251 GLU n 1 252 GLU n 1 253 LYS n 1 254 THR n 1 255 CYS n 1 256 LYS n 1 257 THR n 1 258 SER n 1 259 GLY n 1 260 SER n 1 261 CYS n 1 262 ARG n 1 263 GLY n 1 264 ASP n 1 265 MET n 1 266 GLN n 1 267 PHE n 1 268 CYS n 1 269 LYS n 1 270 VAL n 1 271 ALA n 1 272 GLY n 1 273 CYS n 1 274 GLU n 1 275 HIS n 1 276 GLY n 1 277 GLU n 1 278 GLU n 1 279 ALA n 1 280 SER n 1 281 GLU n 1 282 ALA n 1 283 LYS n 1 284 CYS n 1 285 ARG n 1 286 CYS n 1 287 SER n 1 288 LEU n 1 289 VAL n 1 290 HIS n 1 291 LYS n 1 292 PRO n 1 293 GLY n 1 294 GLU n 1 295 VAL n 1 296 VAL n 1 297 VAL n 1 298 SER n 1 299 TYR n 1 300 GLY n 1 301 GLY n 1 302 MET n 1 303 ARG n 1 304 VAL n 1 305 ARG n 1 306 PRO n 1 307 LYS n 1 308 CYS n 1 309 TYR n 1 310 GLY n 1 311 PHE n 1 312 SER n 1 313 ARG n 1 314 MET n 1 315 MET n 1 316 ALA n 1 317 THR n 1 318 LEU n 1 319 GLU n 1 320 VAL n 1 321 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 321 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe fever with thrombocytopenia virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1003835 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Baculovirus expression vector pFastBac1-HM' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 274590 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 MAN C1 O1 2 NAG O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 20 ? ? ? C . n A 1 2 SER 2 21 ? ? ? C . n A 1 3 GLY 3 22 ? ? ? C . n A 1 4 PRO 4 23 23 PRO PRO C . n A 1 5 ILE 5 24 24 ILE ILE C . n A 1 6 ILE 6 25 25 ILE ILE C . n A 1 7 CYS 7 26 26 CYS CYS C . n A 1 8 ALA 8 27 27 ALA ALA C . n A 1 9 GLY 9 28 28 GLY GLY C . n A 1 10 PRO 10 29 29 PRO PRO C . n A 1 11 ILE 11 30 30 ILE ILE C . n A 1 12 HIS 12 31 31 HIS HIS C . n A 1 13 SER 13 32 32 SER SER C . n A 1 14 ASN 14 33 33 ASN ASN C . n A 1 15 LYS 15 34 34 LYS LYS C . n A 1 16 SER 16 35 35 SER SER C . n A 1 17 ALA 17 36 36 ALA ALA C . n A 1 18 ASP 18 37 37 ASP ASP C . n A 1 19 ILE 19 38 38 ILE ILE C . n A 1 20 PRO 20 39 39 PRO PRO C . n A 1 21 HIS 21 40 40 HIS HIS C . n A 1 22 LEU 22 41 41 LEU LEU C . n A 1 23 LEU 23 42 42 LEU LEU C . n A 1 24 GLY 24 43 43 GLY GLY C . n A 1 25 TYR 25 44 44 TYR TYR C . n A 1 26 SER 26 45 45 SER SER C . n A 1 27 GLU 27 46 46 GLU GLU C . n A 1 28 LYS 28 47 47 LYS LYS C . n A 1 29 ILE 29 48 48 ILE ILE C . n A 1 30 CYS 30 49 49 CYS CYS C . n A 1 31 GLN 31 50 50 GLN GLN C . n A 1 32 ILE 32 51 51 ILE ILE C . n A 1 33 ASP 33 52 52 ASP ASP C . n A 1 34 ARG 34 53 53 ARG ARG C . n A 1 35 LEU 35 54 54 LEU LEU C . n A 1 36 ILE 36 55 55 ILE ILE C . n A 1 37 HIS 37 56 56 HIS HIS C . n A 1 38 VAL 38 57 57 VAL VAL C . n A 1 39 SER 39 58 58 SER SER C . n A 1 40 SER 40 59 59 SER SER C . n A 1 41 TRP 41 60 60 TRP TRP C . n A 1 42 LEU 42 61 61 LEU LEU C . n A 1 43 ARG 43 62 62 ARG ARG C . n A 1 44 ASN 44 63 63 ASN ASN C . n A 1 45 HIS 45 64 64 HIS HIS C . n A 1 46 SER 46 65 65 SER SER C . n A 1 47 GLN 47 66 66 GLN GLN C . n A 1 48 PHE 48 67 67 PHE PHE C . n A 1 49 GLN 49 68 68 GLN GLN C . n A 1 50 GLY 50 69 69 GLY GLY C . n A 1 51 TYR 51 70 70 TYR TYR C . n A 1 52 VAL 52 71 71 VAL VAL C . n A 1 53 GLY 53 72 72 GLY GLY C . n A 1 54 GLN 54 73 73 GLN GLN C . n A 1 55 ARG 55 74 74 ARG ARG C . n A 1 56 GLY 56 75 75 GLY GLY C . n A 1 57 GLY 57 76 76 GLY GLY C . n A 1 58 ARG 58 77 77 ARG ARG C . n A 1 59 SER 59 78 78 SER SER C . n A 1 60 GLN 60 79 79 GLN GLN C . n A 1 61 VAL 61 80 80 VAL VAL C . n A 1 62 SER 62 81 81 SER SER C . n A 1 63 TYR 63 82 82 TYR TYR C . n A 1 64 TYR 64 83 83 TYR TYR C . n A 1 65 PRO 65 84 84 PRO PRO C . n A 1 66 ALA 66 85 85 ALA ALA C . n A 1 67 GLU 67 86 86 GLU GLU C . n A 1 68 ASN 68 87 87 ASN ASN C . n A 1 69 SER 69 88 88 SER SER C . n A 1 70 TYR 70 89 89 TYR TYR C . n A 1 71 SER 71 90 90 SER SER C . n A 1 72 ARG 72 91 91 ARG ARG C . n A 1 73 TRP 73 92 92 TRP TRP C . n A 1 74 SER 74 93 93 SER SER C . n A 1 75 GLY 75 94 94 GLY GLY C . n A 1 76 LEU 76 95 95 LEU LEU C . n A 1 77 LEU 77 96 96 LEU LEU C . n A 1 78 SER 78 97 97 SER SER C . n A 1 79 PRO 79 98 98 PRO PRO C . n A 1 80 CYS 80 99 99 CYS CYS C . n A 1 81 ASP 81 100 100 ASP ASP C . n A 1 82 ALA 82 101 101 ALA ALA C . n A 1 83 ASP 83 102 102 ASP ASP C . n A 1 84 TRP 84 103 103 TRP TRP C . n A 1 85 LEU 85 104 104 LEU LEU C . n A 1 86 GLY 86 105 105 GLY GLY C . n A 1 87 MET 87 106 106 MET MET C . n A 1 88 LEU 88 107 107 LEU LEU C . n A 1 89 VAL 89 108 108 VAL VAL C . n A 1 90 VAL 90 109 109 VAL VAL C . n A 1 91 LYS 91 110 110 LYS LYS C . n A 1 92 LYS 92 111 111 LYS LYS C . n A 1 93 ALA 93 112 112 ALA ALA C . n A 1 94 LYS 94 113 113 LYS LYS C . n A 1 95 GLY 95 114 114 GLY GLY C . n A 1 96 SER 96 115 115 SER SER C . n A 1 97 ASP 97 116 116 ASP ASP C . n A 1 98 MET 98 117 117 MET MET C . n A 1 99 ILE 99 118 118 ILE ILE C . n A 1 100 VAL 100 119 119 VAL VAL C . n A 1 101 PRO 101 120 120 PRO PRO C . n A 1 102 GLY 102 121 121 GLY GLY C . n A 1 103 PRO 103 122 122 PRO PRO C . n A 1 104 SER 104 123 123 SER SER C . n A 1 105 TYR 105 124 124 TYR TYR C . n A 1 106 LYS 106 125 125 LYS LYS C . n A 1 107 GLY 107 126 126 GLY GLY C . n A 1 108 LYS 108 127 127 LYS LYS C . n A 1 109 VAL 109 128 128 VAL VAL C . n A 1 110 PHE 110 129 129 PHE PHE C . n A 1 111 PHE 111 130 130 PHE PHE C . n A 1 112 GLU 112 131 131 GLU GLU C . n A 1 113 ARG 113 132 132 ARG ARG C . n A 1 114 PRO 114 133 133 PRO PRO C . n A 1 115 THR 115 134 134 THR THR C . n A 1 116 PHE 116 135 135 PHE PHE C . n A 1 117 ASP 117 136 136 ASP ASP C . n A 1 118 GLY 118 137 137 GLY GLY C . n A 1 119 TYR 119 138 138 TYR TYR C . n A 1 120 VAL 120 139 139 VAL VAL C . n A 1 121 GLY 121 140 140 GLY GLY C . n A 1 122 TRP 122 141 141 TRP TRP C . n A 1 123 GLY 123 142 142 GLY GLY C . n A 1 124 CYS 124 143 143 CYS CYS C . n A 1 125 GLY 125 144 144 GLY GLY C . n A 1 126 SER 126 145 145 SER SER C . n A 1 127 GLY 127 146 146 GLY GLY C . n A 1 128 LYS 128 147 147 LYS LYS C . n A 1 129 SER 129 148 148 SER SER C . n A 1 130 ARG 130 149 149 ARG ARG C . n A 1 131 THR 131 150 150 THR THR C . n A 1 132 GLU 132 151 151 GLU GLU C . n A 1 133 SER 133 152 152 SER SER C . n A 1 134 GLY 134 153 153 GLY GLY C . n A 1 135 GLU 135 154 154 GLU GLU C . n A 1 136 LEU 136 155 155 LEU LEU C . n A 1 137 CYS 137 156 156 CYS CYS C . n A 1 138 SER 138 157 157 SER SER C . n A 1 139 SER 139 158 158 SER SER C . n A 1 140 ASP 140 159 159 ASP ASP C . n A 1 141 SER 141 160 160 SER SER C . n A 1 142 GLY 142 161 161 GLY GLY C . n A 1 143 THR 143 162 162 THR THR C . n A 1 144 SER 144 163 163 SER SER C . n A 1 145 SER 145 164 164 SER SER C . n A 1 146 GLY 146 165 165 GLY GLY C . n A 1 147 LEU 147 166 166 LEU LEU C . n A 1 148 LEU 148 167 167 LEU LEU C . n A 1 149 PRO 149 168 168 PRO PRO C . n A 1 150 SER 150 169 169 SER SER C . n A 1 151 ASP 151 170 170 ASP ASP C . n A 1 152 ARG 152 171 171 ARG ARG C . n A 1 153 VAL 153 172 172 VAL VAL C . n A 1 154 LEU 154 173 173 LEU LEU C . n A 1 155 TRP 155 174 174 TRP TRP C . n A 1 156 ILE 156 175 175 ILE ILE C . n A 1 157 GLY 157 176 176 GLY GLY C . n A 1 158 ASP 158 177 177 ASP ASP C . n A 1 159 VAL 159 178 178 VAL VAL C . n A 1 160 ALA 160 179 179 ALA ALA C . n A 1 161 CYS 161 180 180 CYS CYS C . n A 1 162 GLN 162 181 181 GLN GLN C . n A 1 163 PRO 163 182 182 PRO PRO C . n A 1 164 MET 164 183 183 MET MET C . n A 1 165 THR 165 184 184 THR THR C . n A 1 166 PRO 166 185 185 PRO PRO C . n A 1 167 ILE 167 186 186 ILE ILE C . n A 1 168 PRO 168 187 187 PRO PRO C . n A 1 169 GLU 169 188 188 GLU GLU C . n A 1 170 GLU 170 189 189 GLU GLU C . n A 1 171 THR 171 190 190 THR THR C . n A 1 172 PHE 172 191 191 PHE PHE C . n A 1 173 LEU 173 192 192 LEU LEU C . n A 1 174 GLU 174 193 193 GLU GLU C . n A 1 175 LEU 175 194 194 LEU LEU C . n A 1 176 LYS 176 195 195 LYS LYS C . n A 1 177 SER 177 196 196 SER SER C . n A 1 178 PHE 178 197 197 PHE PHE C . n A 1 179 SER 179 198 198 SER SER C . n A 1 180 GLN 180 199 199 GLN GLN C . n A 1 181 SER 181 200 200 SER SER C . n A 1 182 GLU 182 201 201 GLU GLU C . n A 1 183 PHE 183 202 202 PHE PHE C . n A 1 184 PRO 184 203 203 PRO PRO C . n A 1 185 ASP 185 204 204 ASP ASP C . n A 1 186 ILE 186 205 205 ILE ILE C . n A 1 187 CYS 187 206 206 CYS CYS C . n A 1 188 LYS 188 207 207 LYS LYS C . n A 1 189 ILE 189 208 208 ILE ILE C . n A 1 190 ASP 190 209 209 ASP ASP C . n A 1 191 GLY 191 210 210 GLY GLY C . n A 1 192 ILE 192 211 211 ILE ILE C . n A 1 193 VAL 193 212 212 VAL VAL C . n A 1 194 PHE 194 213 213 PHE PHE C . n A 1 195 ASN 195 214 214 ASN ASN C . n A 1 196 GLN 196 215 215 GLN GLN C . n A 1 197 CYS 197 216 216 CYS CYS C . n A 1 198 GLU 198 217 217 GLU GLU C . n A 1 199 GLY 199 218 218 GLY GLY C . n A 1 200 GLU 200 219 219 GLU GLU C . n A 1 201 SER 201 220 220 SER SER C . n A 1 202 LEU 202 221 221 LEU LEU C . n A 1 203 PRO 203 222 222 PRO PRO C . n A 1 204 GLN 204 223 223 GLN GLN C . n A 1 205 PRO 205 224 224 PRO PRO C . n A 1 206 PHE 206 225 225 PHE PHE C . n A 1 207 ASP 207 226 226 ASP ASP C . n A 1 208 VAL 208 227 227 VAL VAL C . n A 1 209 ALA 209 228 228 ALA ALA C . n A 1 210 TRP 210 229 229 TRP TRP C . n A 1 211 MET 211 230 230 MET MET C . n A 1 212 ASP 212 231 231 ASP ASP C . n A 1 213 VAL 213 232 232 VAL VAL C . n A 1 214 GLY 214 233 233 GLY GLY C . n A 1 215 HIS 215 234 234 HIS HIS C . n A 1 216 SER 216 235 235 SER SER C . n A 1 217 HIS 217 236 236 HIS HIS C . n A 1 218 LYS 218 237 237 LYS LYS C . n A 1 219 ILE 219 238 238 ILE ILE C . n A 1 220 ILE 220 239 239 ILE ILE C . n A 1 221 MET 221 240 240 MET MET C . n A 1 222 ARG 222 241 241 ARG ARG C . n A 1 223 GLU 223 242 242 GLU GLU C . n A 1 224 HIS 224 243 243 HIS HIS C . n A 1 225 LYS 225 244 244 LYS LYS C . n A 1 226 THR 226 245 245 THR THR C . n A 1 227 LYS 227 246 246 LYS LYS C . n A 1 228 TRP 228 247 247 TRP TRP C . n A 1 229 VAL 229 248 248 VAL VAL C . n A 1 230 GLN 230 249 249 GLN GLN C . n A 1 231 GLU 231 250 250 GLU GLU C . n A 1 232 SER 232 251 251 SER SER C . n A 1 233 SER 233 252 252 SER SER C . n A 1 234 SER 234 253 253 SER SER C . n A 1 235 LYS 235 254 254 LYS LYS C . n A 1 236 ASP 236 255 255 ASP ASP C . n A 1 237 PHE 237 256 256 PHE PHE C . n A 1 238 VAL 238 257 257 VAL VAL C . n A 1 239 CYS 239 258 258 CYS CYS C . n A 1 240 TYR 240 259 259 TYR TYR C . n A 1 241 LYS 241 260 260 LYS LYS C . n A 1 242 GLU 242 261 261 GLU GLU C . n A 1 243 GLY 243 262 262 GLY GLY C . n A 1 244 THR 244 263 263 THR THR C . n A 1 245 GLY 245 264 264 GLY GLY C . n A 1 246 PRO 246 265 265 PRO PRO C . n A 1 247 CYS 247 266 266 CYS CYS C . n A 1 248 SER 248 267 267 SER SER C . n A 1 249 GLU 249 268 268 GLU GLU C . n A 1 250 SER 250 269 269 SER SER C . n A 1 251 GLU 251 270 270 GLU GLU C . n A 1 252 GLU 252 271 271 GLU GLU C . n A 1 253 LYS 253 272 272 LYS LYS C . n A 1 254 THR 254 273 273 THR THR C . n A 1 255 CYS 255 274 274 CYS CYS C . n A 1 256 LYS 256 275 275 LYS LYS C . n A 1 257 THR 257 276 276 THR THR C . n A 1 258 SER 258 277 277 SER SER C . n A 1 259 GLY 259 278 278 GLY GLY C . n A 1 260 SER 260 279 279 SER SER C . n A 1 261 CYS 261 280 280 CYS CYS C . n A 1 262 ARG 262 281 281 ARG ARG C . n A 1 263 GLY 263 282 282 GLY GLY C . n A 1 264 ASP 264 283 283 ASP ASP C . n A 1 265 MET 265 284 284 MET MET C . n A 1 266 GLN 266 285 285 GLN GLN C . n A 1 267 PHE 267 286 286 PHE PHE C . n A 1 268 CYS 268 287 287 CYS CYS C . n A 1 269 LYS 269 288 288 LYS LYS C . n A 1 270 VAL 270 289 289 VAL VAL C . n A 1 271 ALA 271 290 290 ALA ALA C . n A 1 272 GLY 272 291 291 GLY GLY C . n A 1 273 CYS 273 292 292 CYS CYS C . n A 1 274 GLU 274 293 293 GLU GLU C . n A 1 275 HIS 275 294 294 HIS HIS C . n A 1 276 GLY 276 295 295 GLY GLY C . n A 1 277 GLU 277 296 296 GLU GLU C . n A 1 278 GLU 278 297 297 GLU GLU C . n A 1 279 ALA 279 298 298 ALA ALA C . n A 1 280 SER 280 299 299 SER SER C . n A 1 281 GLU 281 300 300 GLU GLU C . n A 1 282 ALA 282 301 301 ALA ALA C . n A 1 283 LYS 283 302 302 LYS LYS C . n A 1 284 CYS 284 303 303 CYS CYS C . n A 1 285 ARG 285 304 304 ARG ARG C . n A 1 286 CYS 286 305 305 CYS CYS C . n A 1 287 SER 287 306 306 SER SER C . n A 1 288 LEU 288 307 307 LEU LEU C . n A 1 289 VAL 289 308 308 VAL VAL C . n A 1 290 HIS 290 309 309 HIS HIS C . n A 1 291 LYS 291 310 310 LYS LYS C . n A 1 292 PRO 292 311 311 PRO PRO C . n A 1 293 GLY 293 312 312 GLY GLY C . n A 1 294 GLU 294 313 313 GLU GLU C . n A 1 295 VAL 295 314 314 VAL VAL C . n A 1 296 VAL 296 315 315 VAL VAL C . n A 1 297 VAL 297 316 316 VAL VAL C . n A 1 298 SER 298 317 317 SER SER C . n A 1 299 TYR 299 318 318 TYR TYR C . n A 1 300 GLY 300 319 319 GLY GLY C . n A 1 301 GLY 301 320 320 GLY GLY C . n A 1 302 MET 302 321 321 MET MET C . n A 1 303 ARG 303 322 322 ARG ARG C . n A 1 304 VAL 304 323 323 VAL VAL C . n A 1 305 ARG 305 324 324 ARG ARG C . n A 1 306 PRO 306 325 325 PRO PRO C . n A 1 307 LYS 307 326 326 LYS LYS C . n A 1 308 CYS 308 327 327 CYS CYS C . n A 1 309 TYR 309 328 328 TYR TYR C . n A 1 310 GLY 310 329 329 GLY GLY C . n A 1 311 PHE 311 330 330 PHE PHE C . n A 1 312 SER 312 331 331 SER SER C . n A 1 313 ARG 313 332 332 ARG ARG C . n A 1 314 MET 314 333 333 MET MET C . n A 1 315 MET 315 334 334 MET MET C . n A 1 316 ALA 316 335 335 ALA ALA C . n A 1 317 THR 317 336 336 THR THR C . n A 1 318 LEU 318 337 337 LEU LEU C . n A 1 319 GLU 319 338 338 GLU GLU C . n A 1 320 VAL 320 339 339 VAL VAL C . n A 1 321 ASN 321 340 340 ASN ASN C . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 A NAG 1 C NAG 605 n B 2 NAG 2 A NAG 2 C NAG 606 n B 2 MAN 3 A MAN 3 C MAN 607 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MAN ? ? MAN ? ? 'SUBJECT OF INVESTIGATION' ? 2 NAG ? ? NAG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5Y10 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.410 _cell.length_a_esd ? _cell.length_b 87.410 _cell.length_b_esd ? _cell.length_c 91.003 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5Y10 _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Y10 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) PEG 4000, 20% (v/v) 2-propanol, 0.1M sodium citrate pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5Y10 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10777 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1108 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.848 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5Y10 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6 _refine.ls_d_res_low 36.643 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10773 _refine.ls_number_reflns_R_free 504 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.30 _refine.ls_percent_reflns_R_free 4.68 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2237 _refine.ls_R_factor_R_free 0.2851 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2206 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.70 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.46 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2450 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2489 _refine_hist.d_res_high 2.6 _refine_hist.d_res_low 36.643 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 2562 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.528 ? 3465 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.262 ? 1524 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 364 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 443 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5174 2.7706 . . 113 2305 83.00 . . . 0.3925 . 0.3057 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7706 3.1713 . . 116 2785 100.00 . . . 0.3801 . 0.2769 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1713 3.9948 . . 155 2731 99.00 . . . 0.2499 . 0.2274 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9948 36.6468 . . 120 2448 87.00 . . . 0.2823 . 0.1966 . . . . . . . . . . # _struct.entry_id 5Y10 _struct.title 'SFTSV Gn head domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Y10 _struct_keywords.text 'SFTSV, GN, Phlebovirus, bunyavirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1L2DAC8_9VIRU _struct_ref.pdbx_db_accession A0A1L2DAC8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DSGPIICAGPIHSNKSADIPHLLGYSEKICQIDRLIHVSSWLRNHSQFQGYVGQRGGRSQVSYYPAENSYSRWSGLLSPC DADWLGMLVVKKAKGSDMIVPGPSYKGKVFFERPTFDGYVGWGCGSGKSRTESGELCSSDSGTSSGLLPSDRVLWIGDVA CQPMTPIPEETFLELKSFSQSEFPDICKIDGIVFNQCEGESLPQPFDVAWMDVGHSHKIIMREHKTKWVQESSSKDFVCY KEGTGPCSESEEKTCKTSGSCRGDMQFCKVAGCEHGEEASEAKCRCSLVHKPGEVVVSYGGMRVRPKCYGFSRMMATLEV N ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5Y10 _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 321 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1L2DAC8 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 340 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 810 ? 1 MORE 8 ? 1 'SSA (A^2)' 14620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 24 ? ARG A 34 ? GLY C 43 ARG C 53 1 ? 11 HELX_P HELX_P2 AA2 LEU A 35 ? GLN A 47 ? LEU C 54 GLN C 66 1 ? 13 HELX_P HELX_P3 AA3 GLY A 57 ? VAL A 61 ? GLY C 76 VAL C 80 5 ? 5 HELX_P HELX_P4 AA4 SER A 69 ? TRP A 73 ? SER C 88 TRP C 92 5 ? 5 HELX_P HELX_P5 AA5 SER A 78 ? LEU A 85 ? SER C 97 LEU C 104 1 ? 8 HELX_P HELX_P6 AA6 SER A 141 ? SER A 144 ? SER C 160 SER C 163 5 ? 4 HELX_P HELX_P7 AA7 PRO A 168 ? PHE A 183 ? PRO C 187 PHE C 202 1 ? 16 HELX_P HELX_P8 AA8 SER A 233 ? LYS A 235 ? SER C 252 LYS C 254 5 ? 3 HELX_P HELX_P9 AA9 SER A 248 ? SER A 258 ? SER C 267 SER C 277 1 ? 11 HELX_P HELX_P10 AB1 ASP A 264 ? GLY A 272 ? ASP C 283 GLY C 291 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 30 SG ? ? C CYS 26 C CYS 49 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf2 disulf ? ? A CYS 124 SG ? ? ? 1_555 A CYS 137 SG ? ? C CYS 143 C CYS 156 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf3 disulf ? ? A CYS 161 SG ? ? ? 1_555 A CYS 308 SG ? ? C CYS 180 C CYS 327 1_555 ? ? ? ? ? ? ? 2.080 ? ? disulf4 disulf ? ? A CYS 187 SG ? ? ? 1_555 A CYS 197 SG ? ? C CYS 206 C CYS 216 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf5 disulf ? ? A CYS 239 SG ? ? ? 1_555 A CYS 286 SG ? ? C CYS 258 C CYS 305 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf6 disulf ? ? A CYS 247 SG ? ? ? 1_555 A CYS 284 SG ? ? C CYS 266 C CYS 303 1_555 ? ? ? ? ? ? ? 2.086 ? ? disulf7 disulf ? ? A CYS 255 SG ? ? ? 1_555 A CYS 261 SG ? ? C CYS 274 C CYS 280 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf8 disulf ? ? A CYS 268 SG ? ? ? 1_555 A CYS 273 SG ? ? C CYS 287 C CYS 292 1_555 ? ? ? ? ? ? ? 2.078 ? ? covale1 covale one ? A ASN 44 ND2 ? ? ? 1_555 B NAG . C1 ? ? C ASN 63 A NAG 1 1_555 ? ? ? ? ? ? ? 1.777 sing N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? A NAG 1 A NAG 2 1_555 ? ? ? ? ? ? ? 1.412 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B MAN . C1 ? ? A NAG 2 A MAN 3 1_555 ? ? ? ? ? ? ? 1.460 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 44 ? NAG A 1 ? 1_555 ASN C 63 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 CYS A 7 ? CYS A 30 ? CYS C 26 ? 1_555 CYS C 49 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 124 ? CYS A 137 ? CYS C 143 ? 1_555 CYS C 156 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 161 ? CYS A 308 ? CYS C 180 ? 1_555 CYS C 327 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 187 ? CYS A 197 ? CYS C 206 ? 1_555 CYS C 216 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 239 ? CYS A 286 ? CYS C 258 ? 1_555 CYS C 305 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS A 247 ? CYS A 284 ? CYS C 266 ? 1_555 CYS C 303 ? 1_555 SG SG . . . None 'Disulfide bridge' 8 CYS A 255 ? CYS A 261 ? CYS C 274 ? 1_555 CYS C 280 ? 1_555 SG SG . . . None 'Disulfide bridge' 9 CYS A 268 ? CYS A 273 ? CYS C 287 ? 1_555 CYS C 292 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 64 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 83 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 65 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 84 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.95 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 3 ? AA7 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 51 ? GLN A 54 ? TYR C 70 GLN C 73 AA1 2 LEU A 147 ? PRO A 149 ? LEU C 166 PRO C 168 AA2 1 SER A 62 ? TYR A 64 ? SER C 81 TYR C 83 AA2 2 VAL A 153 ? ILE A 156 ? VAL C 172 ILE C 175 AA2 3 PHE A 110 ? PRO A 114 ? PHE C 129 PRO C 133 AA2 4 TYR A 119 ? GLY A 123 ? TYR C 138 GLY C 142 AA2 5 VAL A 90 ? LYS A 92 ? VAL C 109 LYS C 111 AA3 1 LYS A 128 ? ARG A 130 ? LYS C 147 ARG C 149 AA3 2 CYS A 137 ? SER A 139 ? CYS C 156 SER C 158 AA4 1 ASP A 158 ? CYS A 161 ? ASP C 177 CYS C 180 AA4 2 CYS A 308 ? LEU A 318 ? CYS C 327 LEU C 337 AA4 3 ILE A 186 ? ILE A 189 ? ILE C 205 ILE C 208 AA4 4 ILE A 192 ? VAL A 193 ? ILE C 211 VAL C 212 AA5 1 ASP A 158 ? CYS A 161 ? ASP C 177 CYS C 180 AA5 2 CYS A 308 ? LEU A 318 ? CYS C 327 LEU C 337 AA5 3 GLN A 204 ? ASP A 212 ? GLN C 223 ASP C 231 AA5 4 LYS A 218 ? MET A 221 ? LYS C 237 MET C 240 AA6 1 LYS A 225 ? VAL A 229 ? LYS C 244 VAL C 248 AA6 2 GLU A 294 ? TYR A 299 ? GLU C 313 TYR C 318 AA6 3 MET A 302 ? VAL A 304 ? MET C 321 VAL C 323 AA7 1 GLY A 245 ? PRO A 246 ? GLY C 264 PRO C 265 AA7 2 PHE A 237 ? LYS A 241 ? PHE C 256 LYS C 260 AA7 3 CYS A 284 ? LEU A 288 ? CYS C 303 LEU C 307 AA7 4 ARG A 262 ? GLY A 263 ? ARG C 281 GLY C 282 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 54 ? N GLN C 73 O LEU A 148 ? O LEU C 167 AA2 1 2 N SER A 62 ? N SER C 81 O TRP A 155 ? O TRP C 174 AA2 2 3 O LEU A 154 ? O LEU C 173 N PHE A 110 ? N PHE C 129 AA2 3 4 N ARG A 113 ? N ARG C 132 O VAL A 120 ? O VAL C 139 AA2 4 5 O TYR A 119 ? O TYR C 138 N LYS A 91 ? N LYS C 110 AA3 1 2 N SER A 129 ? N SER C 148 O SER A 138 ? O SER C 157 AA4 1 2 N ALA A 160 ? N ALA C 179 O TYR A 309 ? O TYR C 328 AA4 2 3 O THR A 317 ? O THR C 336 N LYS A 188 ? N LYS C 207 AA4 3 4 N ILE A 189 ? N ILE C 208 O ILE A 192 ? O ILE C 211 AA5 1 2 N ALA A 160 ? N ALA C 179 O TYR A 309 ? O TYR C 328 AA5 2 3 O ALA A 316 ? O ALA C 335 N GLN A 204 ? N GLN C 223 AA5 3 4 N MET A 211 ? N MET C 230 O ILE A 219 ? O ILE C 238 AA6 1 2 N LYS A 225 ? N LYS C 244 O SER A 298 ? O SER C 317 AA6 2 3 N VAL A 297 ? N VAL C 316 O VAL A 304 ? O VAL C 323 AA7 1 2 O GLY A 245 ? O GLY C 264 N LYS A 241 ? N LYS C 260 AA7 2 3 N VAL A 238 ? N VAL C 257 O SER A 287 ? O SER C 306 AA7 3 4 O CYS A 284 ? O CYS C 303 N ARG A 262 ? N ARG C 281 # _pdbx_entry_details.entry_id 5Y10 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O C GLY 142 ? ? NH2 C ARG 149 ? ? 1.56 2 1 NH2 C ARG 281 ? ? CE C LYS 302 ? ? 1.77 3 1 NE C ARG 281 ? ? CE C LYS 302 ? ? 1.89 4 1 ND2 C ASN 63 ? ? O5 A NAG 1 ? ? 1.93 5 1 NH2 C ARG 281 ? ? NZ C LYS 302 ? ? 1.95 6 1 CZ C ARG 281 ? ? NZ C LYS 302 ? ? 1.99 7 1 CZ C ARG 281 ? ? CE C LYS 302 ? ? 2.06 8 1 O C GLU 201 ? ? NH1 C ARG 241 ? ? 2.15 9 1 OD1 C ASN 63 ? ? C1 A NAG 1 ? ? 2.17 10 1 C C GLY 142 ? ? NH2 C ARG 149 ? ? 2.18 11 1 NE C ARG 281 ? ? NZ C LYS 302 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG1 _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 ILE _pdbx_validate_rmsd_angle.auth_seq_id_1 175 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 ILE _pdbx_validate_rmsd_angle.auth_seq_id_2 175 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG2 _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 ILE _pdbx_validate_rmsd_angle.auth_seq_id_3 175 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.95 _pdbx_validate_rmsd_angle.angle_target_value 111.40 _pdbx_validate_rmsd_angle.angle_deviation -13.45 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE C 25 ? ? -128.58 -62.17 2 1 LEU C 54 ? ? 53.35 19.99 3 1 ARG C 74 ? ? 72.45 -28.30 4 1 GLU C 86 ? ? -69.60 99.05 5 1 CYS C 216 ? ? -140.88 -30.97 6 1 GLU C 217 ? ? 59.68 -50.16 7 1 PHE C 225 ? ? -165.37 105.46 8 1 ARG C 241 ? ? -81.51 -86.47 9 1 HIS C 243 ? ? -172.20 144.70 10 1 GLU C 296 ? ? -82.11 -96.18 11 1 GLU C 297 ? ? 50.53 -177.92 12 1 ALA C 298 ? ? -178.11 -35.08 13 1 SER C 299 ? ? -173.43 -176.61 14 1 GLU C 300 ? ? 36.88 106.79 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -19.1970 _pdbx_refine_tls.origin_y 31.4017 _pdbx_refine_tls.origin_z -7.4899 _pdbx_refine_tls.T[1][1] 0.4754 _pdbx_refine_tls.T[2][2] 0.5819 _pdbx_refine_tls.T[3][3] 0.5872 _pdbx_refine_tls.T[1][2] 0.0078 _pdbx_refine_tls.T[1][3] 0.0652 _pdbx_refine_tls.T[2][3] 0.1150 _pdbx_refine_tls.L[1][1] 2.8594 _pdbx_refine_tls.L[2][2] 3.5588 _pdbx_refine_tls.L[3][3] 3.2754 _pdbx_refine_tls.L[1][2] 1.4710 _pdbx_refine_tls.L[1][3] 1.1299 _pdbx_refine_tls.L[2][3] 1.0354 _pdbx_refine_tls.S[1][1] 0.3089 _pdbx_refine_tls.S[1][2] -0.3227 _pdbx_refine_tls.S[1][3] -0.4155 _pdbx_refine_tls.S[2][1] 0.1767 _pdbx_refine_tls.S[2][2] -0.0457 _pdbx_refine_tls.S[2][3] -0.2761 _pdbx_refine_tls.S[3][1] 0.2200 _pdbx_refine_tls.S[3][2] -0.0682 _pdbx_refine_tls.S[3][3] -0.2550 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C ASP 20 ? A ASP 1 2 1 Y 1 C SER 21 ? A SER 2 3 1 Y 1 C GLY 22 ? A GLY 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MAN C1 C N S 227 MAN C2 C N S 228 MAN C3 C N S 229 MAN C4 C N S 230 MAN C5 C N R 231 MAN C6 C N N 232 MAN O1 O N N 233 MAN O2 O N N 234 MAN O3 O N N 235 MAN O4 O N N 236 MAN O5 O N N 237 MAN O6 O N N 238 MAN H1 H N N 239 MAN H2 H N N 240 MAN H3 H N N 241 MAN H4 H N N 242 MAN H5 H N N 243 MAN H61 H N N 244 MAN H62 H N N 245 MAN HO1 H N N 246 MAN HO2 H N N 247 MAN HO3 H N N 248 MAN HO4 H N N 249 MAN HO6 H N N 250 MET N N N N 251 MET CA C N S 252 MET C C N N 253 MET O O N N 254 MET CB C N N 255 MET CG C N N 256 MET SD S N N 257 MET CE C N N 258 MET OXT O N N 259 MET H H N N 260 MET H2 H N N 261 MET HA H N N 262 MET HB2 H N N 263 MET HB3 H N N 264 MET HG2 H N N 265 MET HG3 H N N 266 MET HE1 H N N 267 MET HE2 H N N 268 MET HE3 H N N 269 MET HXT H N N 270 NAG C1 C N R 271 NAG C2 C N R 272 NAG C3 C N R 273 NAG C4 C N S 274 NAG C5 C N R 275 NAG C6 C N N 276 NAG C7 C N N 277 NAG C8 C N N 278 NAG N2 N N N 279 NAG O1 O N N 280 NAG O3 O N N 281 NAG O4 O N N 282 NAG O5 O N N 283 NAG O6 O N N 284 NAG O7 O N N 285 NAG H1 H N N 286 NAG H2 H N N 287 NAG H3 H N N 288 NAG H4 H N N 289 NAG H5 H N N 290 NAG H61 H N N 291 NAG H62 H N N 292 NAG H81 H N N 293 NAG H82 H N N 294 NAG H83 H N N 295 NAG HN2 H N N 296 NAG HO1 H N N 297 NAG HO3 H N N 298 NAG HO4 H N N 299 NAG HO6 H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MAN C1 C2 sing N N 216 MAN C1 O1 sing N N 217 MAN C1 O5 sing N N 218 MAN C1 H1 sing N N 219 MAN C2 C3 sing N N 220 MAN C2 O2 sing N N 221 MAN C2 H2 sing N N 222 MAN C3 C4 sing N N 223 MAN C3 O3 sing N N 224 MAN C3 H3 sing N N 225 MAN C4 C5 sing N N 226 MAN C4 O4 sing N N 227 MAN C4 H4 sing N N 228 MAN C5 C6 sing N N 229 MAN C5 O5 sing N N 230 MAN C5 H5 sing N N 231 MAN C6 O6 sing N N 232 MAN C6 H61 sing N N 233 MAN C6 H62 sing N N 234 MAN O1 HO1 sing N N 235 MAN O2 HO2 sing N N 236 MAN O3 HO3 sing N N 237 MAN O4 HO4 sing N N 238 MAN O6 HO6 sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 NAG C1 C2 sing N N 259 NAG C1 O1 sing N N 260 NAG C1 O5 sing N N 261 NAG C1 H1 sing N N 262 NAG C2 C3 sing N N 263 NAG C2 N2 sing N N 264 NAG C2 H2 sing N N 265 NAG C3 C4 sing N N 266 NAG C3 O3 sing N N 267 NAG C3 H3 sing N N 268 NAG C4 C5 sing N N 269 NAG C4 O4 sing N N 270 NAG C4 H4 sing N N 271 NAG C5 C6 sing N N 272 NAG C5 O5 sing N N 273 NAG C5 H5 sing N N 274 NAG C6 O6 sing N N 275 NAG C6 H61 sing N N 276 NAG C6 H62 sing N N 277 NAG C7 C8 sing N N 278 NAG C7 N2 sing N N 279 NAG C7 O7 doub N N 280 NAG C8 H81 sing N N 281 NAG C8 H82 sing N N 282 NAG C8 H83 sing N N 283 NAG N2 HN2 sing N N 284 NAG O1 HO1 sing N N 285 NAG O3 HO3 sing N N 286 NAG O4 HO4 sing N N 287 NAG O6 HO6 sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 MAN 3 n # _atom_sites.entry_id 5Y10 _atom_sites.fract_transf_matrix[1][1] 0.011440 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011440 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010989 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_