data_5YC3 # _entry.id 5YC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YC3 pdb_00005yc3 10.2210/pdb5yc3/pdb WWPDB D_1300005019 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YC3 _pdbx_database_status.recvd_initial_deposition_date 2017-09-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, S.' 1 ? 'Zhang, B.' 2 ? 'Li, H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 1090 _citation.page_last 1102 _citation.title 'Systematic Profiling of Histone Readers in Arabidopsis thaliana.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2017.12.099 _citation.pdbx_database_id_PubMed 29386129 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, S.' 1 ? primary 'Zhang, B.' 2 ? primary 'Yang, M.' 3 ? primary 'Zhu, J.' 4 ? primary 'Li, H.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5YC3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.921 _cell.length_a_esd ? _cell.length_b 30.921 _cell.length_b_esd ? _cell.length_c 157.029 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YC3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHD finger protein ALFIN-LIKE 3' 6528.371 1 ? ? 'PHD finger, UNP residues 191-245' ? 2 polymer syn H3K4me2 1090.300 1 ? 'K4 dimethylation' 'H3 peptide 1-15' ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein AL3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GPLGSDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSN GPLGSDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSN A ? 2 'polypeptide(L)' no yes 'ART(MLY)QTARK' ARTKQTARK P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ASP n 1 7 HIS n 1 8 GLY n 1 9 GLU n 1 10 THR n 1 11 LEU n 1 12 CYS n 1 13 GLY n 1 14 ALA n 1 15 CYS n 1 16 GLY n 1 17 ASP n 1 18 SER n 1 19 ASP n 1 20 GLY n 1 21 ALA n 1 22 ASP n 1 23 GLU n 1 24 PHE n 1 25 TRP n 1 26 ILE n 1 27 CYS n 1 28 CYS n 1 29 ASP n 1 30 LEU n 1 31 CYS n 1 32 GLU n 1 33 LYS n 1 34 TRP n 1 35 PHE n 1 36 HIS n 1 37 GLY n 1 38 LYS n 1 39 CYS n 1 40 VAL n 1 41 LYS n 1 42 ILE n 1 43 THR n 1 44 PRO n 1 45 ALA n 1 46 ARG n 1 47 ALA n 1 48 GLU n 1 49 HIS n 1 50 ILE n 1 51 LYS n 1 52 GLN n 1 53 TYR n 1 54 LYS n 1 55 CYS n 1 56 PRO n 1 57 SER n 1 58 CYS n 1 59 SER n 1 60 ASN n 2 1 ALA n 2 2 ARG n 2 3 THR n 2 4 MLY n 2 5 GLN n 2 6 THR n 2 7 ALA n 2 8 ARG n 2 9 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 60 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AL3, At3g42790, T21C14_10' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6p _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'Arabidopsis thaliana' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 3702 _pdbx_entity_src_syn.details 'chemically synthesized H3K4me2 peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ALFL3_ARATH Q9M2B4 ? 1 DHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSN 191 2 PDB 5YC3 5YC3 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5YC3 A 6 ? 60 ? Q9M2B4 191 ? 245 ? 1 55 2 2 5YC3 P 1 ? 9 ? 5YC3 1 ? 9 ? 1 9 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5YC3 GLY A 1 ? UNP Q9M2B4 ? ? 'expression tag' -4 1 1 5YC3 PRO A 2 ? UNP Q9M2B4 ? ? 'expression tag' -3 2 1 5YC3 LEU A 3 ? UNP Q9M2B4 ? ? 'expression tag' -2 3 1 5YC3 GLY A 4 ? UNP Q9M2B4 ? ? 'expression tag' -1 4 1 5YC3 SER A 5 ? UNP Q9M2B4 ? ? 'expression tag' 0 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2' 174.241 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YC3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.8 M Ammonium citrate tribasic, pH 7.0.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details mirrors _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal, Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 34.310 _reflns.entry_id 5YC3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2763 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.400 _reflns.pdbx_Rmerge_I_obs 0.189 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.195 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.197 _reflns.pdbx_Rpim_I_all 0.053 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.600 2.640 ? ? ? ? ? ? 122 100.000 ? ? ? ? 0.902 ? ? ? ? ? ? ? ? 14.400 ? 0.838 ? ? 0.935 0.244 ? 1 1 0.884 ? 2.640 2.690 ? ? ? ? ? ? 125 100.000 ? ? ? ? 0.964 ? ? ? ? ? ? ? ? 14.400 ? 0.880 ? ? 1.000 0.260 ? 2 1 0.850 ? 2.690 2.740 ? ? ? ? ? ? 138 100.000 ? ? ? ? 0.679 ? ? ? ? ? ? ? ? 14.100 ? 0.849 ? ? 0.705 0.187 ? 3 1 0.963 ? 2.740 2.800 ? ? ? ? ? ? 137 100.000 ? ? ? ? 0.657 ? ? ? ? ? ? ? ? 14.400 ? 0.959 ? ? 0.681 0.177 ? 4 1 0.967 ? 2.800 2.860 ? ? ? ? ? ? 133 100.000 ? ? ? ? 0.583 ? ? ? ? ? ? ? ? 13.900 ? 0.947 ? ? 0.606 0.160 ? 5 1 0.997 ? 2.860 2.930 ? ? ? ? ? ? 114 99.100 ? ? ? ? 0.483 ? ? ? ? ? ? ? ? 14.600 ? 0.886 ? ? 0.500 0.130 ? 6 1 0.951 ? 2.930 3.000 ? ? ? ? ? ? 130 100.000 ? ? ? ? 0.451 ? ? ? ? ? ? ? ? 14.400 ? 0.940 ? ? 0.467 0.122 ? 7 1 0.981 ? 3.000 3.080 ? ? ? ? ? ? 143 100.000 ? ? ? ? 0.329 ? ? ? ? ? ? ? ? 14.200 ? 1.042 ? ? 0.341 0.090 ? 8 1 0.981 ? 3.080 3.170 ? ? ? ? ? ? 132 100.000 ? ? ? ? 0.327 ? ? ? ? ? ? ? ? 13.600 ? 0.976 ? ? 0.340 0.091 ? 9 1 0.976 ? 3.170 3.280 ? ? ? ? ? ? 131 100.000 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 14.300 ? 1.099 ? ? 0.245 0.064 ? 10 1 0.991 ? 3.280 3.390 ? ? ? ? ? ? 137 100.000 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 14.000 ? 1.059 ? ? 0.204 0.054 ? 11 1 0.993 ? 3.390 3.530 ? ? ? ? ? ? 127 100.000 ? ? ? ? 0.163 ? ? ? ? ? ? ? ? 13.600 ? 1.219 ? ? 0.170 0.045 ? 12 1 0.995 ? 3.530 3.690 ? ? ? ? ? ? 143 100.000 ? ? ? ? 0.151 ? ? ? ? ? ? ? ? 13.600 ? 1.432 ? ? 0.157 0.042 ? 13 1 0.997 ? 3.690 3.880 ? ? ? ? ? ? 142 100.000 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 13.500 ? 1.568 ? ? 0.145 0.039 ? 14 1 0.995 ? 3.880 4.130 ? ? ? ? ? ? 129 100.000 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 13.600 ? 1.703 ? ? 0.139 0.037 ? 15 1 0.991 ? 4.130 4.450 ? ? ? ? ? ? 154 100.000 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 12.600 ? 1.890 ? ? 0.120 0.034 ? 16 1 0.995 ? 4.450 4.890 ? ? ? ? ? ? 137 100.000 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 13.300 ? 1.719 ? ? 0.116 0.031 ? 17 1 0.997 ? 4.890 5.600 ? ? ? ? ? ? 145 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 12.100 ? 1.298 ? ? 0.101 0.028 ? 18 1 0.997 ? 5.600 7.050 ? ? ? ? ? ? 153 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 12.300 ? 1.291 ? ? 0.093 0.026 ? 19 1 0.997 ? 7.050 50.000 ? ? ? ? ? ? 191 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 10.100 ? 1.291 ? ? 0.058 0.017 ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 66.270 _refine.B_iso_mean 34.2109 _refine.B_iso_min 20.290 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YC3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6010 _refine.ls_d_res_low 39.2570 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2720 _refine.ls_number_reflns_R_free 396 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9300 _refine.ls_percent_reflns_R_free 14.5600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1983 _refine.ls_R_factor_R_free 0.2405 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1910 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2FSA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.7300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6010 _refine_hist.d_res_low 39.2570 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 560 _refine_hist.pdbx_number_residues_total 69 _refine_hist.pdbx_B_iso_mean_ligand 31.51 _refine_hist.pdbx_B_iso_mean_solvent 35.03 _refine_hist.pdbx_number_atoms_protein 526 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 537 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.670 ? 720 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.031 ? 73 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 93 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.928 ? 196 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6009 2.9772 853 . 105 748 100.0000 . . . 0.2938 0.0000 0.2192 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.9772 3.7504 890 . 142 748 100.0000 . . . 0.2721 0.0000 0.1890 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.7504 39.2617 977 . 149 828 100.0000 . . . 0.2099 0.0000 0.1818 . . . . . . 3 . . . # _struct.entry_id 5YC3 _struct.title 'Crystal structure of AL3 PHD finger bound to H3K4me2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YC3 _struct_keywords.text 'PHD finger, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 48 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 38 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 43 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B THR 3 C ? ? ? 1_555 B MLY 4 N ? ? P THR 3 P MLY 4 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? B MLY 4 C ? ? ? 1_555 B GLN 5 N ? ? P MLY 4 P GLN 5 1_555 ? ? ? ? ? ? ? 1.326 ? ? metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 7 A ZN 101 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc2 metalc ? ? A CYS 15 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 10 A ZN 101 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 23 A ZN 102 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 26 A ZN 102 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc5 metalc ? ? A HIS 36 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 31 A ZN 101 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc6 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 101 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 50 A ZN 102 1_555 ? ? ? ? ? ? ? 2.263 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 53 A ZN 102 1_555 ? ? ? ? ? ? ? 2.358 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 34 ? HIS A 36 ? TRP A 29 HIS A 31 AA1 2 PHE A 24 ? CYS A 27 ? PHE A 19 CYS A 22 AA1 3 ARG B 2 ? GLN B 5 ? ARG P 2 GLN P 5 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 35 ? O PHE A 30 N ILE A 26 ? N ILE A 21 AA1 2 3 N TRP A 25 ? N TRP A 20 O MLY B 4 ? O MLY P 4 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'binding site for residue ZN A 101' AC2 Software A ZN 102 ? 4 'binding site for residue ZN A 102' AC3 Software P MLY 4 ? 12 'binding site for Ligand residues MLY P 4 through GLN P 5 bound to THR P 3' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 12 ? CYS A 7 . ? 1_555 ? 2 AC1 4 CYS A 15 ? CYS A 10 . ? 1_555 ? 3 AC1 4 HIS A 36 ? HIS A 31 . ? 1_555 ? 4 AC1 4 CYS A 39 ? CYS A 34 . ? 1_555 ? 5 AC2 4 CYS A 28 ? CYS A 23 . ? 1_555 ? 6 AC2 4 CYS A 31 ? CYS A 26 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 50 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 53 . ? 1_555 ? 9 AC3 12 ASP A 19 ? ASP A 14 . ? 1_555 ? 10 AC3 12 ASP A 22 ? ASP A 17 . ? 1_555 ? 11 AC3 12 GLU A 23 ? GLU A 18 . ? 1_555 ? 12 AC3 12 PHE A 24 ? PHE A 19 . ? 1_555 ? 13 AC3 12 TRP A 25 ? TRP A 20 . ? 1_555 ? 14 AC3 12 TRP A 34 ? TRP A 29 . ? 1_555 ? 15 AC3 12 ALA B 1 ? ALA P 1 . ? 8_555 ? 16 AC3 12 ARG B 2 ? ARG P 2 . ? 8_555 ? 17 AC3 12 THR B 3 ? THR P 3 . ? 1_555 ? 18 AC3 12 THR B 3 ? THR P 3 . ? 8_555 ? 19 AC3 12 THR B 6 ? THR P 6 . ? 1_555 ? 20 AC3 12 HOH F . ? HOH P 101 . ? 1_555 ? # _atom_sites.entry_id 5YC3 _atom_sites.fract_transf_matrix[1][1] 0.032340 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032340 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006368 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 PRO 2 -3 -3 PRO PRO A . n A 1 3 LEU 3 -2 -2 LEU LEU A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 ASP 6 1 1 ASP ASP A . n A 1 7 HIS 7 2 2 HIS HIS A . n A 1 8 GLY 8 3 3 GLY GLY A . n A 1 9 GLU 9 4 4 GLU GLU A . n A 1 10 THR 10 5 5 THR THR A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 CYS 12 7 7 CYS CYS A . n A 1 13 GLY 13 8 8 GLY GLY A . n A 1 14 ALA 14 9 9 ALA ALA A . n A 1 15 CYS 15 10 10 CYS CYS A . n A 1 16 GLY 16 11 11 GLY GLY A . n A 1 17 ASP 17 12 12 ASP ASP A . n A 1 18 SER 18 13 13 SER SER A . n A 1 19 ASP 19 14 14 ASP ASP A . n A 1 20 GLY 20 15 15 GLY GLY A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 ASP 22 17 17 ASP ASP A . n A 1 23 GLU 23 18 18 GLU GLU A . n A 1 24 PHE 24 19 19 PHE PHE A . n A 1 25 TRP 25 20 20 TRP TRP A . n A 1 26 ILE 26 21 21 ILE ILE A . n A 1 27 CYS 27 22 22 CYS CYS A . n A 1 28 CYS 28 23 23 CYS CYS A . n A 1 29 ASP 29 24 24 ASP ASP A . n A 1 30 LEU 30 25 25 LEU LEU A . n A 1 31 CYS 31 26 26 CYS CYS A . n A 1 32 GLU 32 27 27 GLU GLU A . n A 1 33 LYS 33 28 28 LYS LYS A . n A 1 34 TRP 34 29 29 TRP TRP A . n A 1 35 PHE 35 30 30 PHE PHE A . n A 1 36 HIS 36 31 31 HIS HIS A . n A 1 37 GLY 37 32 32 GLY GLY A . n A 1 38 LYS 38 33 33 LYS LYS A . n A 1 39 CYS 39 34 34 CYS CYS A . n A 1 40 VAL 40 35 35 VAL VAL A . n A 1 41 LYS 41 36 36 LYS LYS A . n A 1 42 ILE 42 37 37 ILE ILE A . n A 1 43 THR 43 38 38 THR THR A . n A 1 44 PRO 44 39 39 PRO PRO A . n A 1 45 ALA 45 40 40 ALA ALA A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ALA 47 42 42 ALA ALA A . n A 1 48 GLU 48 43 43 GLU GLU A . n A 1 49 HIS 49 44 44 HIS HIS A . n A 1 50 ILE 50 45 45 ILE ILE A . n A 1 51 LYS 51 46 46 LYS LYS A . n A 1 52 GLN 52 47 47 GLN GLN A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 CYS 55 50 50 CYS CYS A . n A 1 56 PRO 56 51 51 PRO PRO A . n A 1 57 SER 57 52 52 SER SER A . n A 1 58 CYS 58 53 53 CYS CYS A . n A 1 59 SER 59 54 54 SER SER A . n A 1 60 ASN 60 55 55 ASN ASN A . n B 2 1 ALA 1 1 1 ALA ALA P . n B 2 2 ARG 2 2 2 ARG ARG P . n B 2 3 THR 3 3 3 THR THR P . n B 2 4 MLY 4 4 4 MLY MLY P . n B 2 5 GLN 5 5 5 GLN GLN P . n B 2 6 THR 6 6 6 THR THR P . n B 2 7 ALA 7 7 7 ALA ALA P . n B 2 8 ARG 8 8 8 ARG ARG P . n B 2 9 LYS 9 9 9 LYS LYS P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 101 1 ZN ZN A . D 3 ZN 1 102 2 ZN ZN A . E 4 HOH 1 201 31 HOH HOH A . E 4 HOH 2 202 20 HOH HOH A . E 4 HOH 3 203 22 HOH HOH A . E 4 HOH 4 204 12 HOH HOH A . E 4 HOH 5 205 9 HOH HOH A . E 4 HOH 6 206 13 HOH HOH A . E 4 HOH 7 207 25 HOH HOH A . E 4 HOH 8 208 14 HOH HOH A . E 4 HOH 9 209 1 HOH HOH A . E 4 HOH 10 210 2 HOH HOH A . E 4 HOH 11 211 7 HOH HOH A . E 4 HOH 12 212 5 HOH HOH A . E 4 HOH 13 213 23 HOH HOH A . E 4 HOH 14 214 3 HOH HOH A . E 4 HOH 15 215 32 HOH HOH A . E 4 HOH 16 216 4 HOH HOH A . E 4 HOH 17 217 8 HOH HOH A . E 4 HOH 18 218 29 HOH HOH A . E 4 HOH 19 219 19 HOH HOH A . E 4 HOH 20 220 28 HOH HOH A . E 4 HOH 21 221 30 HOH HOH A . E 4 HOH 22 222 26 HOH HOH A . E 4 HOH 23 223 27 HOH HOH A . F 4 HOH 1 101 6 HOH HOH P . F 4 HOH 2 102 21 HOH HOH P . F 4 HOH 3 103 15 HOH HOH P . F 4 HOH 4 104 10 HOH HOH P . F 4 HOH 5 105 11 HOH HOH P . F 4 HOH 6 106 17 HOH HOH P . F 4 HOH 7 107 18 HOH HOH P . F 4 HOH 8 108 24 HOH HOH P . F 4 HOH 9 109 16 HOH HOH P . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1190 ? 1 MORE -8 ? 1 'SSA (A^2)' 5370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 217 ? E HOH . 2 1 A HOH 222 ? E HOH . 3 1 A HOH 223 ? E HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 7 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 15 ? A CYS 10 ? 1_555 107.5 ? 2 SG ? A CYS 12 ? A CYS 7 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 36 ? A HIS 31 ? 1_555 102.7 ? 3 SG ? A CYS 15 ? A CYS 10 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 36 ? A HIS 31 ? 1_555 100.9 ? 4 SG ? A CYS 12 ? A CYS 7 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 34 ? 1_555 117.1 ? 5 SG ? A CYS 15 ? A CYS 10 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 34 ? 1_555 109.2 ? 6 ND1 ? A HIS 36 ? A HIS 31 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 34 ? 1_555 118.0 ? 7 SG ? A CYS 28 ? A CYS 23 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 31 ? A CYS 26 ? 1_555 108.3 ? 8 SG ? A CYS 28 ? A CYS 23 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 55 ? A CYS 50 ? 1_555 109.7 ? 9 SG ? A CYS 31 ? A CYS 26 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 55 ? A CYS 50 ? 1_555 113.3 ? 10 SG ? A CYS 28 ? A CYS 23 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 58 ? A CYS 53 ? 1_555 110.1 ? 11 SG ? A CYS 31 ? A CYS 26 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 58 ? A CYS 53 ? 1_555 110.8 ? 12 SG ? A CYS 55 ? A CYS 50 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 58 ? A CYS 53 ? 1_555 104.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-24 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_struct_conn.conn_type_id' 9 3 'Structure model' '_struct_conn.id' 10 3 'Structure model' '_struct_conn.pdbx_dist_value' 11 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 13 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 14 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 15 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 16 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 20 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 26 3 'Structure model' '_struct_conn_type.id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MLY N N N N 230 MLY CA C N S 231 MLY CB C N N 232 MLY CG C N N 233 MLY CD C N N 234 MLY CE C N N 235 MLY NZ N N N 236 MLY CH1 C N N 237 MLY CH2 C N N 238 MLY C C N N 239 MLY O O N N 240 MLY OXT O N N 241 MLY H H N N 242 MLY H2 H N N 243 MLY HA H N N 244 MLY HB2 H N N 245 MLY HB3 H N N 246 MLY HG2 H N N 247 MLY HG3 H N N 248 MLY HD2 H N N 249 MLY HD3 H N N 250 MLY HE2 H N N 251 MLY HE3 H N N 252 MLY HH11 H N N 253 MLY HH12 H N N 254 MLY HH13 H N N 255 MLY HH21 H N N 256 MLY HH22 H N N 257 MLY HH23 H N N 258 MLY HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 ZN ZN ZN N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MLY N CA sing N N 218 MLY N H sing N N 219 MLY N H2 sing N N 220 MLY CA CB sing N N 221 MLY CA C sing N N 222 MLY CA HA sing N N 223 MLY CB CG sing N N 224 MLY CB HB2 sing N N 225 MLY CB HB3 sing N N 226 MLY CG CD sing N N 227 MLY CG HG2 sing N N 228 MLY CG HG3 sing N N 229 MLY CD CE sing N N 230 MLY CD HD2 sing N N 231 MLY CD HD3 sing N N 232 MLY CE NZ sing N N 233 MLY CE HE2 sing N N 234 MLY CE HE3 sing N N 235 MLY NZ CH1 sing N N 236 MLY NZ CH2 sing N N 237 MLY CH1 HH11 sing N N 238 MLY CH1 HH12 sing N N 239 MLY CH1 HH13 sing N N 240 MLY CH2 HH21 sing N N 241 MLY CH2 HH22 sing N N 242 MLY CH2 HH23 sing N N 243 MLY C O doub N N 244 MLY C OXT sing N N 245 MLY OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TRP N CA sing N N 316 TRP N H sing N N 317 TRP N H2 sing N N 318 TRP CA C sing N N 319 TRP CA CB sing N N 320 TRP CA HA sing N N 321 TRP C O doub N N 322 TRP C OXT sing N N 323 TRP CB CG sing N N 324 TRP CB HB2 sing N N 325 TRP CB HB3 sing N N 326 TRP CG CD1 doub Y N 327 TRP CG CD2 sing Y N 328 TRP CD1 NE1 sing Y N 329 TRP CD1 HD1 sing N N 330 TRP CD2 CE2 doub Y N 331 TRP CD2 CE3 sing Y N 332 TRP NE1 CE2 sing Y N 333 TRP NE1 HE1 sing N N 334 TRP CE2 CZ2 sing Y N 335 TRP CE3 CZ3 doub Y N 336 TRP CE3 HE3 sing N N 337 TRP CZ2 CH2 doub Y N 338 TRP CZ2 HZ2 sing N N 339 TRP CZ3 CH2 sing Y N 340 TRP CZ3 HZ3 sing N N 341 TRP CH2 HH2 sing N N 342 TRP OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MLY ? ? MLY ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2FSA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #