data_5YHA # _entry.id 5YHA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5YHA pdb_00005yha 10.2210/pdb5yha/pdb WWPDB D_1300005262 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-29 2 'Structure model' 1 1 2018-02-14 3 'Structure model' 1 2 2023-11-22 4 'Structure model' 1 3 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' pdbx_struct_special_symmetry 8 3 'Structure model' struct_conn 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.value' 25 3 'Structure model' '_struct_conn.pdbx_dist_value' 26 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5YHA _pdbx_database_status.recvd_initial_deposition_date 2017-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Abe, S.' 1 ? 'Atsumi, K.' 2 ? 'Yamashita, K.' 3 ? 'Hirata, K.' 4 ? 'Mori, H.' 5 ? 'Ueno, T.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Phys Chem Chem Phys' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1463-9084 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 2986 _citation.page_last 2989 _citation.title 'Structure of in cell protein crystals containing organometallic complexes.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c7cp06651a _citation.pdbx_database_id_PubMed 29138769 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, S.' 1 ? primary 'Atsumi, K.' 2 ? primary 'Yamashita, K.' 3 ? primary 'Hirata, K.' 4 ? primary 'Mori, H.' 5 ? primary 'Ueno, T.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Polyhedrin 28387.316 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'Palladium(II) allyl complex' 147.492 3 ? ? ? ? 4 non-polymer syn 'PALLADIUM ION' 106.420 5 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 6 water nat water 18.015 111 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name C-polyhedrin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)ADVAGTSNRDFRGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYREGQH NDSYDEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRD GEIVGYSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDIN NHSYGVALSNRQ ; _entity_poly.pdbx_seq_one_letter_code_can ;XADVAGTSNRDFRGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYREGQHNDSY DEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIV GYSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY GVALSNRQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'Palladium(II) allyl complex' PLL 4 'PALLADIUM ION' PD 5 1,2-ETHANEDIOL EDO 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ALA n 1 3 ASP n 1 4 VAL n 1 5 ALA n 1 6 GLY n 1 7 THR n 1 8 SER n 1 9 ASN n 1 10 ARG n 1 11 ASP n 1 12 PHE n 1 13 ARG n 1 14 GLY n 1 15 ARG n 1 16 GLU n 1 17 GLN n 1 18 ARG n 1 19 LEU n 1 20 PHE n 1 21 ASN n 1 22 SER n 1 23 GLU n 1 24 GLN n 1 25 TYR n 1 26 ASN n 1 27 TYR n 1 28 ASN n 1 29 ASN n 1 30 SER n 1 31 LEU n 1 32 ASN n 1 33 GLY n 1 34 GLU n 1 35 VAL n 1 36 SER n 1 37 VAL n 1 38 TRP n 1 39 VAL n 1 40 TYR n 1 41 ALA n 1 42 TYR n 1 43 TYR n 1 44 SER n 1 45 ASP n 1 46 GLY n 1 47 SER n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 ILE n 1 52 ASN n 1 53 LYS n 1 54 ASN n 1 55 SER n 1 56 GLN n 1 57 TYR n 1 58 LYS n 1 59 VAL n 1 60 GLY n 1 61 ILE n 1 62 SER n 1 63 GLU n 1 64 THR n 1 65 PHE n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 LYS n 1 70 GLU n 1 71 TYR n 1 72 ARG n 1 73 GLU n 1 74 GLY n 1 75 GLN n 1 76 HIS n 1 77 ASN n 1 78 ASP n 1 79 SER n 1 80 TYR n 1 81 ASP n 1 82 GLU n 1 83 TYR n 1 84 GLU n 1 85 VAL n 1 86 ASN n 1 87 GLN n 1 88 SER n 1 89 ILE n 1 90 TYR n 1 91 TYR n 1 92 PRO n 1 93 ASN n 1 94 GLY n 1 95 GLY n 1 96 ASP n 1 97 ALA n 1 98 ARG n 1 99 LYS n 1 100 PHE n 1 101 HIS n 1 102 SER n 1 103 ASN n 1 104 ALA n 1 105 LYS n 1 106 PRO n 1 107 ARG n 1 108 ALA n 1 109 ILE n 1 110 GLN n 1 111 ILE n 1 112 ILE n 1 113 PHE n 1 114 SER n 1 115 PRO n 1 116 SER n 1 117 VAL n 1 118 ASN n 1 119 VAL n 1 120 ARG n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 MET n 1 125 ALA n 1 126 LYS n 1 127 GLY n 1 128 ASN n 1 129 ALA n 1 130 VAL n 1 131 SER n 1 132 VAL n 1 133 PRO n 1 134 ASP n 1 135 GLU n 1 136 TYR n 1 137 LEU n 1 138 GLN n 1 139 ARG n 1 140 SER n 1 141 HIS n 1 142 PRO n 1 143 TRP n 1 144 GLU n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 ILE n 1 149 LYS n 1 150 TYR n 1 151 ARG n 1 152 LYS n 1 153 ILE n 1 154 LYS n 1 155 ARG n 1 156 ASP n 1 157 GLY n 1 158 GLU n 1 159 ILE n 1 160 VAL n 1 161 GLY n 1 162 TYR n 1 163 SER n 1 164 HIS n 1 165 TYR n 1 166 PHE n 1 167 GLU n 1 168 LEU n 1 169 PRO n 1 170 HIS n 1 171 GLU n 1 172 TYR n 1 173 ASN n 1 174 SER n 1 175 ILE n 1 176 SER n 1 177 LEU n 1 178 ALA n 1 179 VAL n 1 180 SER n 1 181 GLY n 1 182 VAL n 1 183 HIS n 1 184 LYS n 1 185 ASN n 1 186 PRO n 1 187 SER n 1 188 SER n 1 189 TYR n 1 190 ASN n 1 191 VAL n 1 192 GLY n 1 193 SER n 1 194 ALA n 1 195 HIS n 1 196 ASN n 1 197 VAL n 1 198 MET n 1 199 ASP n 1 200 VAL n 1 201 PHE n 1 202 GLN n 1 203 SER n 1 204 CYS n 1 205 ASP n 1 206 LEU n 1 207 ALA n 1 208 LEU n 1 209 ARG n 1 210 PHE n 1 211 CYS n 1 212 ASN n 1 213 ARG n 1 214 TYR n 1 215 TRP n 1 216 ALA n 1 217 GLU n 1 218 LEU n 1 219 GLU n 1 220 LEU n 1 221 VAL n 1 222 ASN n 1 223 HIS n 1 224 TYR n 1 225 ILE n 1 226 SER n 1 227 PRO n 1 228 ASN n 1 229 ALA n 1 230 TYR n 1 231 PRO n 1 232 TYR n 1 233 LEU n 1 234 ASP n 1 235 ILE n 1 236 ASN n 1 237 ASN n 1 238 HIS n 1 239 SER n 1 240 TYR n 1 241 GLY n 1 242 VAL n 1 243 ALA n 1 244 LEU n 1 245 SER n 1 246 ASN n 1 247 ARG n 1 248 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 248 _entity_src_gen.gene_src_common_name BmCPV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bombyx mori cytoplasmic polyhedrosis virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 110829 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PD non-polymer . 'PALLADIUM ION' ? 'Pd 2' 106.420 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLL non-polymer . 'Palladium(II) allyl complex' ? 'C3 H5 Pd' 147.492 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 1 1 ACE ACE A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 CYS 211 211 211 CYS CYS A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 TRP 215 215 215 TRP TRP A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 TYR 224 224 224 TYR TYR A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 GLN 248 248 248 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 249 CL CL A . C 3 PLL 1 302 1 PLL PLL A . D 3 PLL 1 303 2 PLL PLL A . E 3 PLL 1 304 3 PLL PLL A . F 4 PD 1 305 1 PD PD A . G 4 PD 1 306 2 PD PD A . H 4 PD 1 307 3 PD PD A . I 4 PD 1 308 4 PD PD A . J 4 PD 1 309 5 PD PD A . K 5 EDO 1 310 1 EDO EDO A . L 6 HOH 1 401 400 HOH HOH A . L 6 HOH 2 402 348 HOH HOH A . L 6 HOH 3 403 380 HOH HOH A . L 6 HOH 4 404 360 HOH HOH A . L 6 HOH 5 405 301 HOH HOH A . L 6 HOH 6 406 365 HOH HOH A . L 6 HOH 7 407 362 HOH HOH A . L 6 HOH 8 408 296 HOH HOH A . L 6 HOH 9 409 345 HOH HOH A . L 6 HOH 10 410 314 HOH HOH A . L 6 HOH 11 411 398 HOH HOH A . L 6 HOH 12 412 387 HOH HOH A . L 6 HOH 13 413 309 HOH HOH A . L 6 HOH 14 414 384 HOH HOH A . L 6 HOH 15 415 363 HOH HOH A . L 6 HOH 16 416 383 HOH HOH A . L 6 HOH 17 417 355 HOH HOH A . L 6 HOH 18 418 320 HOH HOH A . L 6 HOH 19 419 307 HOH HOH A . L 6 HOH 20 420 388 HOH HOH A . L 6 HOH 21 421 392 HOH HOH A . L 6 HOH 22 422 375 HOH HOH A . L 6 HOH 23 423 292 HOH HOH A . L 6 HOH 24 424 343 HOH HOH A . L 6 HOH 25 425 401 HOH HOH A . L 6 HOH 26 426 270 HOH HOH A . L 6 HOH 27 427 282 HOH HOH A . L 6 HOH 28 428 389 HOH HOH A . L 6 HOH 29 429 318 HOH HOH A . L 6 HOH 30 430 312 HOH HOH A . L 6 HOH 31 431 284 HOH HOH A . L 6 HOH 32 432 346 HOH HOH A . L 6 HOH 33 433 342 HOH HOH A . L 6 HOH 34 434 256 HOH HOH A . L 6 HOH 35 435 305 HOH HOH A . L 6 HOH 36 436 341 HOH HOH A . L 6 HOH 37 437 385 HOH HOH A . L 6 HOH 38 438 255 HOH HOH A . L 6 HOH 39 439 322 HOH HOH A . L 6 HOH 40 440 396 HOH HOH A . L 6 HOH 41 441 376 HOH HOH A . L 6 HOH 42 442 279 HOH HOH A . L 6 HOH 43 443 354 HOH HOH A . L 6 HOH 44 444 382 HOH HOH A . L 6 HOH 45 445 374 HOH HOH A . L 6 HOH 46 446 369 HOH HOH A . L 6 HOH 47 447 370 HOH HOH A . L 6 HOH 48 448 336 HOH HOH A . L 6 HOH 49 449 364 HOH HOH A . L 6 HOH 50 450 373 HOH HOH A . L 6 HOH 51 451 265 HOH HOH A . L 6 HOH 52 452 278 HOH HOH A . L 6 HOH 53 453 344 HOH HOH A . L 6 HOH 54 454 395 HOH HOH A . L 6 HOH 55 455 321 HOH HOH A . L 6 HOH 56 456 377 HOH HOH A . L 6 HOH 57 457 295 HOH HOH A . L 6 HOH 58 458 359 HOH HOH A . L 6 HOH 59 459 281 HOH HOH A . L 6 HOH 60 460 266 HOH HOH A . L 6 HOH 61 461 368 HOH HOH A . L 6 HOH 62 462 303 HOH HOH A . L 6 HOH 63 463 325 HOH HOH A . L 6 HOH 64 464 317 HOH HOH A . L 6 HOH 65 465 275 HOH HOH A . L 6 HOH 66 466 356 HOH HOH A . L 6 HOH 67 467 358 HOH HOH A . L 6 HOH 68 468 274 HOH HOH A . L 6 HOH 69 469 297 HOH HOH A . L 6 HOH 70 470 371 HOH HOH A . L 6 HOH 71 471 304 HOH HOH A . L 6 HOH 72 472 347 HOH HOH A . L 6 HOH 73 473 378 HOH HOH A . L 6 HOH 74 474 257 HOH HOH A . L 6 HOH 75 475 381 HOH HOH A . L 6 HOH 76 476 339 HOH HOH A . L 6 HOH 77 477 361 HOH HOH A . L 6 HOH 78 478 258 HOH HOH A . L 6 HOH 79 479 259 HOH HOH A . L 6 HOH 80 480 338 HOH HOH A . L 6 HOH 81 481 280 HOH HOH A . L 6 HOH 82 482 386 HOH HOH A . L 6 HOH 83 483 391 HOH HOH A . L 6 HOH 84 484 298 HOH HOH A . L 6 HOH 85 485 291 HOH HOH A . L 6 HOH 86 486 337 HOH HOH A . L 6 HOH 87 487 379 HOH HOH A . L 6 HOH 88 488 313 HOH HOH A . L 6 HOH 89 489 393 HOH HOH A . L 6 HOH 90 490 276 HOH HOH A . L 6 HOH 91 491 330 HOH HOH A . L 6 HOH 92 492 353 HOH HOH A . L 6 HOH 93 493 323 HOH HOH A . L 6 HOH 94 494 310 HOH HOH A . L 6 HOH 95 495 271 HOH HOH A . L 6 HOH 96 496 283 HOH HOH A . L 6 HOH 97 497 315 HOH HOH A . L 6 HOH 98 498 349 HOH HOH A . L 6 HOH 99 499 394 HOH HOH A . L 6 HOH 100 500 316 HOH HOH A . L 6 HOH 101 501 397 HOH HOH A . L 6 HOH 102 502 402 HOH HOH A . L 6 HOH 103 503 340 HOH HOH A . L 6 HOH 104 504 263 HOH HOH A . L 6 HOH 105 505 299 HOH HOH A . L 6 HOH 106 506 302 HOH HOH A . L 6 HOH 107 507 267 HOH HOH A . L 6 HOH 108 508 357 HOH HOH A . L 6 HOH 109 509 399 HOH HOH A . L 6 HOH 110 510 311 HOH HOH A . L 6 HOH 111 511 319 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5YHA _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.190 _cell.length_a_esd ? _cell.length_b 103.190 _cell.length_b_esd ? _cell.length_c 103.190 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5YHA _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5YHA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 23.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'IN CELL' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'in vivo crystallization' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5YHA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.58 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25159 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 46.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.763 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.58 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 8155 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 46 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.58 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.355 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 12.459 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.942 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5YHA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.58 _refine.ls_d_res_low 42.1 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22665 _refine.ls_number_reflns_R_free 2494 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 9.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.15449 _refine.ls_R_factor_R_free 0.19656 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.14998 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 2OH6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.096 _refine.pdbx_overall_ESU_R_Free 0.099 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.153 _refine.overall_SU_ML 0.071 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2009 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 2142 _refine_hist.d_res_high 1.58 _refine_hist.d_res_low 42.1 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.019 2085 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1877 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.915 1.933 2832 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.293 3.000 4303 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.272 5.000 248 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.772 23.750 116 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.139 15.000 326 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.073 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.133 0.200 287 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 2437 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 543 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.081 1.030 991 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.066 1.029 990 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.624 1.540 1237 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.625 1.541 1238 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.228 1.356 1093 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.223 1.356 1093 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.405 1.892 1574 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.642 9.265 2463 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.641 9.271 2464 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.580 _refine_ls_shell.d_res_low 1.621 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 182 _refine_ls_shell.number_reflns_R_work 1655 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.329 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.288 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5YHA _struct.title 'Crystal structure of Pd(allyl)/Wild Type Polyhedra' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5YHA _struct_keywords.text 'In vivo protein crystal, Polyhedra, VIRAL PROTEIN, metal complexes' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 5 ? L N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYHD_CPVBM _struct_ref.pdbx_db_accession P11041 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADVAGTSNRDFRGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYREGQHNDSYD EYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIVG YSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSYG VALSNRQ ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5YHA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11041 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 248 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5YHA _struct_ref_seq_dif.mon_id ACE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P11041 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details acetylation _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11560 ? 1 MORE -70 ? 1 'SSA (A^2)' 34460 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? SER A 30 ? ASP A 11 SER A 30 1 ? 20 HELX_P HELX_P2 AA2 THR A 64 ? LYS A 69 ? THR A 64 LYS A 69 1 ? 6 HELX_P HELX_P3 AA3 ASP A 78 ? TYR A 91 ? ASP A 78 TYR A 91 1 ? 14 HELX_P HELX_P4 AA4 ASN A 118 ? ILE A 122 ? ASN A 118 ILE A 122 5 ? 5 HELX_P HELX_P5 AA5 TYR A 136 ? SER A 140 ? TYR A 136 SER A 140 5 ? 5 HELX_P HELX_P6 AA6 THR A 146 ? TYR A 150 ? THR A 146 TYR A 150 5 ? 5 HELX_P HELX_P7 AA7 ASN A 196 ? ALA A 207 ? ASN A 196 ALA A 207 1 ? 12 HELX_P HELX_P8 AA8 ALA A 216 ? TYR A 224 ? ALA A 216 TYR A 224 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ALA 2 N ? ? A ACE 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.333 ? ? metalc1 metalc ? ? A LYS 66 NZ ? ? ? 1_555 G PD . PD ? ? A LYS 66 A PD 306 5_555 ? ? ? ? ? ? ? 2.800 ? ? metalc2 metalc ? ? A HIS 76 ND1 ? ? ? 1_555 F PD . PD ? ? A HIS 76 A PD 305 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc3 metalc ? ? A HIS 76 ND1 ? ? ? 1_555 F PD . PD ? ? A HIS 76 A PD 305 2_665 ? ? ? ? ? ? ? 2.117 ? ? metalc4 metalc ? ? A HIS 170 NE2 ? ? ? 1_555 H PD . PD ? ? A HIS 170 A PD 307 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc5 metalc ? ? A CYS 204 SG ? ? ? 1_555 I PD . PD ? ? A CYS 204 A PD 308 1_555 ? ? ? ? ? ? ? 2.485 ? ? metalc6 metalc ? ? A CYS 211 SG ? ? ? 1_555 C PLL . PD ? ? A CYS 211 A PLL 302 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc7 metalc ? ? A CYS 211 SG ? ? ? 1_555 D PLL . PD ? ? A CYS 211 A PLL 303 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc8 metalc ? ? A CYS 211 SG ? ? ? 1_555 G PD . PD ? ? A CYS 211 A PD 306 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc9 metalc ? ? A HIS 238 NE2 ? ? ? 1_555 E PLL . PD ? ? A HIS 238 A PLL 304 1_555 ? ? ? ? ? ? ? 2.529 ? ? metalc10 metalc ? ? A HIS 238 ND1 ? ? ? 1_555 J PD . PD ? ? A HIS 238 A PD 309 1_555 ? ? ? ? ? ? ? 2.725 ? ? metalc11 metalc ? ? E PLL . PD ? ? ? 1_555 L HOH . O ? ? A PLL 304 A HOH 411 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc12 metalc ? ? I PD . PD ? ? ? 1_555 L HOH . O ? ? A PD 308 A HOH 509 1_555 ? ? ? ? ? ? ? 2.423 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NZ ? A LYS 66 ? A LYS 66 ? 1_555 PD ? G PD . ? A PD 306 ? 5_555 SG ? A CYS 211 ? A CYS 211 ? 1_555 41.8 ? 2 ND1 ? A HIS 76 ? A HIS 76 ? 1_555 PD ? F PD . ? A PD 305 ? 1_555 ND1 ? A HIS 76 ? A HIS 76 ? 1_555 0.0 ? 3 SG ? A CYS 204 ? A CYS 204 ? 1_555 PD ? I PD . ? A PD 308 ? 1_555 O ? L HOH . ? A HOH 509 ? 1_555 92.9 ? 4 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C19 ? C PLL . ? A PLL 302 ? 1_555 105.5 ? 5 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C20 ? C PLL . ? A PLL 302 ? 1_555 170.9 ? 6 C19 ? C PLL . ? A PLL 302 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C20 ? C PLL . ? A PLL 302 ? 1_555 79.7 ? 7 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C21 ? C PLL . ? A PLL 302 ? 1_555 142.9 ? 8 C19 ? C PLL . ? A PLL 302 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C21 ? C PLL . ? A PLL 302 ? 1_555 45.3 ? 9 C20 ? C PLL . ? A PLL 302 ? 1_555 PD ? C PLL . ? A PLL 302 ? 1_555 C21 ? C PLL . ? A PLL 302 ? 1_555 45.6 ? 10 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C19 ? D PLL . ? A PLL 303 ? 1_555 159.0 ? 11 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C20 ? D PLL . ? A PLL 303 ? 1_555 99.8 ? 12 C19 ? D PLL . ? A PLL 303 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C20 ? D PLL . ? A PLL 303 ? 1_555 80.0 ? 13 SG ? A CYS 211 ? A CYS 211 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C21 ? D PLL . ? A PLL 303 ? 1_555 120.2 ? 14 C19 ? D PLL . ? A PLL 303 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C21 ? D PLL . ? A PLL 303 ? 1_555 46.0 ? 15 C20 ? D PLL . ? A PLL 303 ? 1_555 PD ? D PLL . ? A PLL 303 ? 1_555 C21 ? D PLL . ? A PLL 303 ? 1_555 45.9 ? 16 NE2 ? A HIS 238 ? A HIS 238 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C19 ? E PLL . ? A PLL 304 ? 1_555 158.2 ? 17 NE2 ? A HIS 238 ? A HIS 238 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C20 ? E PLL . ? A PLL 304 ? 1_555 116.6 ? 18 C19 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C20 ? E PLL . ? A PLL 304 ? 1_555 81.3 ? 19 NE2 ? A HIS 238 ? A HIS 238 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C21 ? E PLL . ? A PLL 304 ? 1_555 139.2 ? 20 C19 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C21 ? E PLL . ? A PLL 304 ? 1_555 45.3 ? 21 C20 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 C21 ? E PLL . ? A PLL 304 ? 1_555 46.3 ? 22 NE2 ? A HIS 238 ? A HIS 238 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 O ? L HOH . ? A HOH 411 ? 1_555 66.2 ? 23 C19 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 O ? L HOH . ? A HOH 411 ? 1_555 130.6 ? 24 C20 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 O ? L HOH . ? A HOH 411 ? 1_555 86.6 ? 25 C21 ? E PLL . ? A PLL 304 ? 1_555 PD ? E PLL . ? A PLL 304 ? 1_555 O ? L HOH . ? A HOH 411 ? 1_555 131.0 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id ALA _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id ALA _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 2 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id ALA _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 151 ? ARG A 155 ? ARG A 151 ARG A 155 AA1 2 GLU A 158 ? GLU A 167 ? GLU A 158 GLU A 167 AA1 3 ALA A 108 ? PHE A 113 ? ALA A 108 PHE A 113 AA1 4 GLU A 34 ? TYR A 42 ? GLU A 34 TYR A 42 AA1 5 VAL A 48 ? GLN A 56 ? VAL A 48 GLN A 56 AA1 6 LEU A 208 ? TYR A 214 ? LEU A 208 TYR A 214 AA2 1 LYS A 58 ? GLU A 63 ? LYS A 58 GLU A 63 AA2 2 SER A 176 ? VAL A 182 ? SER A 176 VAL A 182 AA2 3 LYS A 123 ? GLY A 127 ? LYS A 123 GLY A 127 AA3 1 TYR A 232 ? LEU A 233 ? TYR A 232 LEU A 233 AA3 2 SER A 239 ? TYR A 240 ? SER A 239 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 153 ? N ILE A 153 O VAL A 160 ? O VAL A 160 AA1 2 3 O HIS A 164 ? O HIS A 164 N ILE A 111 ? N ILE A 111 AA1 3 4 O GLN A 110 ? O GLN A 110 N TYR A 40 ? N TYR A 40 AA1 4 5 N VAL A 39 ? N VAL A 39 O ILE A 51 ? O ILE A 51 AA1 5 6 N VAL A 48 ? N VAL A 48 O TYR A 214 ? O TYR A 214 AA2 1 2 N GLU A 63 ? N GLU A 63 O LEU A 177 ? O LEU A 177 AA2 2 3 O ALA A 178 ? O ALA A 178 N ALA A 125 ? N ALA A 125 AA3 1 2 N TYR A 232 ? N TYR A 232 O TYR A 240 ? O TYR A 240 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 2 'binding site for residue CL A 301' AC2 Software A PLL 302 ? 3 'binding site for residue PLL A 302' AC3 Software A PLL 303 ? 4 'binding site for residue PLL A 303' AC4 Software A PLL 304 ? 7 'binding site for residue PLL A 304' AC5 Software A PD 305 ? 2 'binding site for residue PD A 305' AC6 Software A PD 306 ? 3 'binding site for residue PD A 306' AC7 Software A PD 307 ? 1 'binding site for residue PD A 307' AC8 Software A PD 308 ? 4 'binding site for residue PD A 308' AC9 Software A PD 309 ? 1 'binding site for residue PD A 309' AD1 Software A EDO 310 ? 6 'binding site for residue EDO A 310' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ALA A 2 ? ALA A 2 . ? 2_655 ? 2 AC1 2 LEU A 31 ? LEU A 31 . ? 1_555 ? 3 AC2 3 ARG A 209 ? ARG A 209 . ? 1_555 ? 4 AC2 3 CYS A 211 ? CYS A 211 . ? 1_555 ? 5 AC2 3 PLL D . ? PLL A 303 . ? 1_555 ? 6 AC3 4 GLU A 63 ? GLU A 63 . ? 1_555 ? 7 AC3 4 CYS A 211 ? CYS A 211 . ? 1_555 ? 8 AC3 4 PLL C . ? PLL A 302 . ? 1_555 ? 9 AC3 4 PD G . ? PD A 306 . ? 1_555 ? 10 AC4 7 HIS A 141 ? HIS A 141 . ? 18_555 ? 11 AC4 7 TRP A 143 ? TRP A 143 . ? 18_555 ? 12 AC4 7 GLU A 144 ? GLU A 144 . ? 18_555 ? 13 AC4 7 ARG A 155 ? ARG A 155 . ? 1_555 ? 14 AC4 7 HIS A 238 ? HIS A 238 . ? 1_555 ? 15 AC4 7 SER A 239 ? SER A 239 . ? 1_555 ? 16 AC4 7 HOH L . ? HOH A 411 . ? 1_555 ? 17 AC5 2 HIS A 76 ? HIS A 76 . ? 1_555 ? 18 AC5 2 HIS A 76 ? HIS A 76 . ? 2_665 ? 19 AC6 3 LYS A 66 ? LYS A 66 . ? 9_555 ? 20 AC6 3 CYS A 211 ? CYS A 211 . ? 1_555 ? 21 AC6 3 PLL D . ? PLL A 303 . ? 1_555 ? 22 AC7 1 HIS A 170 ? HIS A 170 . ? 1_555 ? 23 AC8 4 LYS A 58 ? LYS A 58 . ? 1_555 ? 24 AC8 4 CYS A 204 ? CYS A 204 . ? 5_555 ? 25 AC8 4 CYS A 204 ? CYS A 204 . ? 1_555 ? 26 AC8 4 HOH L . ? HOH A 509 . ? 1_555 ? 27 AC9 1 HIS A 238 ? HIS A 238 . ? 1_555 ? 28 AD1 6 ASP A 3 ? ASP A 3 . ? 24_554 ? 29 AD1 6 GLY A 46 ? GLY A 46 . ? 1_555 ? 30 AD1 6 PHE A 100 ? PHE A 100 . ? 2_665 ? 31 AD1 6 ALA A 216 ? ALA A 216 . ? 1_555 ? 32 AD1 6 GLU A 217 ? GLU A 217 . ? 1_555 ? 33 AD1 6 HOH L . ? HOH A 421 . ? 1_555 ? # _pdbx_entry_details.entry_id 5YHA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 171 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 171 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.129 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation -0.123 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 57 ? ? 72.40 -54.47 2 1 SER A 131 ? ? 77.47 34.88 3 1 GLU A 135 ? ? 76.90 -55.56 4 1 ASN A 185 ? ? -154.79 85.60 5 1 TYR A 224 ? ? -130.27 -58.46 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id PD _pdbx_struct_special_symmetry.auth_seq_id 305 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id PD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CL CL CL N N 81 CYS N N N N 82 CYS CA C N R 83 CYS C C N N 84 CYS O O N N 85 CYS CB C N N 86 CYS SG S N N 87 CYS OXT O N N 88 CYS H H N N 89 CYS H2 H N N 90 CYS HA H N N 91 CYS HB2 H N N 92 CYS HB3 H N N 93 CYS HG H N N 94 CYS HXT H N N 95 EDO C1 C N N 96 EDO O1 O N N 97 EDO C2 C N N 98 EDO O2 O N N 99 EDO H11 H N N 100 EDO H12 H N N 101 EDO HO1 H N N 102 EDO H21 H N N 103 EDO H22 H N N 104 EDO HO2 H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PD PD PD N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PLL C20 C N N 292 PLL C21 C N N 293 PLL PD PD N N 294 PLL C19 C N N 295 PLL H20 H N N 296 PLL H20A H N N 297 PLL H21 H N N 298 PLL H19 H N N 299 PLL H19A H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 EDO C1 O1 sing N N 89 EDO C1 C2 sing N N 90 EDO C1 H11 sing N N 91 EDO C1 H12 sing N N 92 EDO O1 HO1 sing N N 93 EDO C2 O2 sing N N 94 EDO C2 H21 sing N N 95 EDO C2 H22 sing N N 96 EDO O2 HO2 sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 HIS N CA sing N N 144 HIS N H sing N N 145 HIS N H2 sing N N 146 HIS CA C sing N N 147 HIS CA CB sing N N 148 HIS CA HA sing N N 149 HIS C O doub N N 150 HIS C OXT sing N N 151 HIS CB CG sing N N 152 HIS CB HB2 sing N N 153 HIS CB HB3 sing N N 154 HIS CG ND1 sing Y N 155 HIS CG CD2 doub Y N 156 HIS ND1 CE1 doub Y N 157 HIS ND1 HD1 sing N N 158 HIS CD2 NE2 sing Y N 159 HIS CD2 HD2 sing N N 160 HIS CE1 NE2 sing Y N 161 HIS CE1 HE1 sing N N 162 HIS NE2 HE2 sing N N 163 HIS OXT HXT sing N N 164 HOH O H1 sing N N 165 HOH O H2 sing N N 166 ILE N CA sing N N 167 ILE N H sing N N 168 ILE N H2 sing N N 169 ILE CA C sing N N 170 ILE CA CB sing N N 171 ILE CA HA sing N N 172 ILE C O doub N N 173 ILE C OXT sing N N 174 ILE CB CG1 sing N N 175 ILE CB CG2 sing N N 176 ILE CB HB sing N N 177 ILE CG1 CD1 sing N N 178 ILE CG1 HG12 sing N N 179 ILE CG1 HG13 sing N N 180 ILE CG2 HG21 sing N N 181 ILE CG2 HG22 sing N N 182 ILE CG2 HG23 sing N N 183 ILE CD1 HD11 sing N N 184 ILE CD1 HD12 sing N N 185 ILE CD1 HD13 sing N N 186 ILE OXT HXT sing N N 187 LEU N CA sing N N 188 LEU N H sing N N 189 LEU N H2 sing N N 190 LEU CA C sing N N 191 LEU CA CB sing N N 192 LEU CA HA sing N N 193 LEU C O doub N N 194 LEU C OXT sing N N 195 LEU CB CG sing N N 196 LEU CB HB2 sing N N 197 LEU CB HB3 sing N N 198 LEU CG CD1 sing N N 199 LEU CG CD2 sing N N 200 LEU CG HG sing N N 201 LEU CD1 HD11 sing N N 202 LEU CD1 HD12 sing N N 203 LEU CD1 HD13 sing N N 204 LEU CD2 HD21 sing N N 205 LEU CD2 HD22 sing N N 206 LEU CD2 HD23 sing N N 207 LEU OXT HXT sing N N 208 LYS N CA sing N N 209 LYS N H sing N N 210 LYS N H2 sing N N 211 LYS CA C sing N N 212 LYS CA CB sing N N 213 LYS CA HA sing N N 214 LYS C O doub N N 215 LYS C OXT sing N N 216 LYS CB CG sing N N 217 LYS CB HB2 sing N N 218 LYS CB HB3 sing N N 219 LYS CG CD sing N N 220 LYS CG HG2 sing N N 221 LYS CG HG3 sing N N 222 LYS CD CE sing N N 223 LYS CD HD2 sing N N 224 LYS CD HD3 sing N N 225 LYS CE NZ sing N N 226 LYS CE HE2 sing N N 227 LYS CE HE3 sing N N 228 LYS NZ HZ1 sing N N 229 LYS NZ HZ2 sing N N 230 LYS NZ HZ3 sing N N 231 LYS OXT HXT sing N N 232 MET N CA sing N N 233 MET N H sing N N 234 MET N H2 sing N N 235 MET CA C sing N N 236 MET CA CB sing N N 237 MET CA HA sing N N 238 MET C O doub N N 239 MET C OXT sing N N 240 MET CB CG sing N N 241 MET CB HB2 sing N N 242 MET CB HB3 sing N N 243 MET CG SD sing N N 244 MET CG HG2 sing N N 245 MET CG HG3 sing N N 246 MET SD CE sing N N 247 MET CE HE1 sing N N 248 MET CE HE2 sing N N 249 MET CE HE3 sing N N 250 MET OXT HXT sing N N 251 PHE N CA sing N N 252 PHE N H sing N N 253 PHE N H2 sing N N 254 PHE CA C sing N N 255 PHE CA CB sing N N 256 PHE CA HA sing N N 257 PHE C O doub N N 258 PHE C OXT sing N N 259 PHE CB CG sing N N 260 PHE CB HB2 sing N N 261 PHE CB HB3 sing N N 262 PHE CG CD1 doub Y N 263 PHE CG CD2 sing Y N 264 PHE CD1 CE1 sing Y N 265 PHE CD1 HD1 sing N N 266 PHE CD2 CE2 doub Y N 267 PHE CD2 HD2 sing N N 268 PHE CE1 CZ doub Y N 269 PHE CE1 HE1 sing N N 270 PHE CE2 CZ sing Y N 271 PHE CE2 HE2 sing N N 272 PHE CZ HZ sing N N 273 PHE OXT HXT sing N N 274 PLL C20 C21 sing N N 275 PLL C21 C19 sing N N 276 PLL PD C19 sing N N 277 PLL PD C20 sing N N 278 PLL PD C21 sing N N 279 PLL C20 H20 sing N N 280 PLL C20 H20A sing N N 281 PLL C21 H21 sing N N 282 PLL C19 H19 sing N N 283 PLL C19 H19A sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number JP16H00827 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2OH6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5YHA _atom_sites.fract_transf_matrix[1][1] 0.009691 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009691 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009691 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O PD S # loop_