data_5Z55 # _entry.id 5Z55 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5Z55 pdb_00005z55 10.2210/pdb5z55/pdb WWPDB D_1300006427 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27240 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5Z55 _pdbx_database_status.recvd_initial_deposition_date 2018-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ma, X.' 1 ? 'Hu, K.F.' 2 0000-0002-2343-2012 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biomol NMR Assign' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1874-270X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 145 _citation.page_last 148 _citation.title ;Backbone and side-chain chemical shift assignments of the kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ROR1). ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s12104-017-9797-9 _citation.pdbx_database_id_PubMed 29313214 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, X.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Liu, B.' 3 ? primary 'Yang, J.' 4 ? primary 'Hu, K.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Inactive tyrosine-protein kinase transmembrane receptor ROR1' _entity.formula_weight 9562.522 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Kringle domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'tyrosine kinase-like orphan receptor 1,Neurotrophic tyrosine kinase,receptor-related 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIP ACDSK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIP ACDSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 CYS n 1 5 TYR n 1 6 ASN n 1 7 SER n 1 8 THR n 1 9 GLY n 1 10 VAL n 1 11 ASP n 1 12 TYR n 1 13 ARG n 1 14 GLY n 1 15 THR n 1 16 VAL n 1 17 SER n 1 18 VAL n 1 19 THR n 1 20 LYS n 1 21 SER n 1 22 GLY n 1 23 ARG n 1 24 GLN n 1 25 CYS n 1 26 GLN n 1 27 PRO n 1 28 TRP n 1 29 ASN n 1 30 SER n 1 31 GLN n 1 32 TYR n 1 33 PRO n 1 34 HIS n 1 35 THR n 1 36 HIS n 1 37 THR n 1 38 PHE n 1 39 THR n 1 40 ALA n 1 41 LEU n 1 42 ARG n 1 43 PHE n 1 44 PRO n 1 45 GLU n 1 46 LEU n 1 47 ASN n 1 48 GLY n 1 49 GLY n 1 50 HIS n 1 51 SER n 1 52 TYR n 1 53 CYS n 1 54 ARG n 1 55 ASN n 1 56 PRO n 1 57 GLY n 1 58 ASN n 1 59 GLN n 1 60 LYS n 1 61 GLU n 1 62 ALA n 1 63 PRO n 1 64 TRP n 1 65 CYS n 1 66 PHE n 1 67 THR n 1 68 LEU n 1 69 ASP n 1 70 GLU n 1 71 ASN n 1 72 PHE n 1 73 LYS n 1 74 SER n 1 75 ASP n 1 76 LEU n 1 77 CYS n 1 78 ASP n 1 79 ILE n 1 80 PRO n 1 81 ALA n 1 82 CYS n 1 83 ASP n 1 84 SER n 1 85 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 85 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ROR1, NTRKR1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ROR1_HUMAN _struct_ref.pdbx_db_accession Q01973 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC DSK ; _struct_ref.pdbx_align_begin 312 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5Z55 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01973 _struct_ref_seq.db_align_beg 312 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 394 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5Z55 GLY A 1 ? UNP Q01973 ? ? 'expression tag' 1 1 1 5Z55 SER A 2 ? UNP Q01973 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 'HBHA(CO)NH' 1 isotropic 2 1 1 'H(CCO)NH' 1 isotropic 3 1 1 'C(CO)NH' 1 isotropic 4 1 1 'CBCA (CO) NH' 1 isotropic 5 1 1 '(Hali)CaliCaroHaro-TOCSY' 1 isotropic 6 1 1 HNCA 2 isotropic 15 1 1 '3D HNCACB' 2 isotropic 14 1 1 '3D HNCO' 2 isotropic 13 1 1 '3D HCCH-TOCSY' 2 isotropic 12 1 1 '3D CCH-TOCSY' 2 isotropic 11 1 1 '2D 1H-15N HSQC' 2 isotropic 10 1 1 '2D 1H-13C CT-HSQC' 2 isotropic 9 1 1 '3D 1H-15N NOESY' 2 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 7 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 8.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ;buffer: 25 mM Tris, 150 mM NaCl, 6% D2O and 0.02% NaN3 (w/v) at pH 8.0 and 298 K ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM 99%U-13C, U-15N ROR1Kr, 94% H2O/6% D2O' _pdbx_nmr_sample_details.solvent_system '94% H2O/6% D2O' _pdbx_nmr_sample_details.label 13C_15N_ROR1Kr _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'Kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ROR1)' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 5Z55 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 5Z55 _pdbx_nmr_ensemble.conformers_calculated_total_number 96 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5Z55 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 2 collection TopSpin ? 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'peak picking' Sparky ? Goddard 1 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 4 'data analysis' Sparky ? Goddard 6 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5Z55 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5Z55 _struct.title 'NMR Solution Structure of the Kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ROR1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5Z55 _struct_keywords.text 'ROR1, Kringle, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 43 ? ASN A 47 ? PHE A 43 ASN A 47 5 ? 5 HELX_P HELX_P2 AA2 ASN A 55 ? GLN A 59 ? ASN A 55 GLN A 59 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 4 A CYS 82 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 25 A CYS 65 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf3 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 53 A CYS 77 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 1 0.17 2 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 2 0.37 3 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 3 0.13 4 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 4 0.18 5 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 5 0.38 6 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 6 0.45 7 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 7 0.10 8 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 8 0.06 9 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 9 0.37 10 TYR 32 A . ? TYR 32 A PRO 33 A ? PRO 33 A 10 0.32 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 64 ? PHE A 66 ? TRP A 64 PHE A 66 AA1 2 SER A 74 ? LEU A 76 ? SER A 74 LEU A 76 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 65 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 65 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 75 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 75 # _atom_sites.entry_id 5Z55 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5220 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-16 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component ROR1Kr _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '99%U-13C, U-15N' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A GLN 26 ? ? O A PHE 66 ? ? 1.59 2 4 H1 A GLY 1 ? ? H A THR 15 ? ? 1.27 3 6 HG1 A THR 39 ? ? H A ARG 42 ? ? 1.34 4 8 H A GLN 26 ? ? O A PHE 66 ? ? 1.56 5 9 H A GLN 26 ? ? O A PHE 66 ? ? 1.58 6 10 H A GLN 26 ? ? O A PHE 66 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 7 ? ? 42.64 -127.99 2 1 PHE A 38 ? ? -162.02 99.27 3 2 SER A 7 ? ? 43.53 -124.20 4 2 PHE A 38 ? ? -160.53 102.56 5 3 SER A 7 ? ? 41.84 -131.27 6 3 PHE A 38 ? ? -162.00 99.48 7 4 SER A 7 ? ? 55.78 -131.51 8 4 PHE A 38 ? ? -160.84 98.94 9 5 SER A 7 ? ? 56.98 -107.92 10 5 PHE A 38 ? ? -162.35 101.44 11 6 SER A 7 ? ? 56.17 -133.35 12 7 SER A 7 ? ? 55.52 -115.05 13 7 PHE A 38 ? ? -162.79 101.69 14 8 SER A 7 ? ? 55.35 -137.64 15 8 PHE A 38 ? ? -162.24 100.30 16 9 LYS A 3 ? ? 55.40 -93.12 17 9 SER A 7 ? ? 59.46 -132.15 18 9 PHE A 38 ? ? -161.68 102.40 19 10 SER A 7 ? ? 73.95 -136.73 20 10 PHE A 38 ? ? -161.31 99.96 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Key Research and Development Program of China' China 2017YFC0906900 1 'National Natural Science Foundation of China' China 21573258 2 'National Natural Science Foundation of China' China 81401904 3 'Yunnan Provincial Science and Technology Department' China 2015FA028 4 'Yunnan Provincial Science and Technology Department' China 2015FB170 5 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #