data_5ZCZ # _entry.id 5ZCZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZCZ pdb_00005zcz 10.2210/pdb5zcz/pdb WWPDB D_1300006866 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-21 2 'Structure model' 1 1 2020-03-04 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5ZCZ _pdbx_database_status.recvd_initial_deposition_date 2018-02-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27354 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tanaka, T.' 1 ? 'Teppei, I.' 2 ? 'Kamoshida, H.' 3 ? 'Mishima, M.' 4 ? 'Shirakawa, M.' 5 ? 'Guentert, P.' 6 ? 'Ito, Y.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 58 _citation.language ? _citation.page_first 7284 _citation.page_last 7288 _citation.title 'High-Resolution Protein 3D Structure Determination in Living Eukaryotic Cells.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.201900840 _citation.pdbx_database_id_PubMed 30938016 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanaka, T.' 1 ? primary 'Ikeya, T.' 2 ? primary 'Kamoshida, H.' 3 ? primary 'Suemoto, Y.' 4 ? primary 'Mishima, M.' 5 ? primary 'Shirakawa, M.' 6 ? primary 'Guntert, P.' 7 0000-0002-2911-7574 primary 'Ito, Y.' 8 0000-0002-1030-4660 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Heavy metal binding protein' _entity.formula_weight 7051.325 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA _entity_poly.pdbx_seq_one_letter_code_can MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 LYS n 1 4 LEU n 1 5 LYS n 1 6 VAL n 1 7 GLU n 1 8 GLY n 1 9 MET n 1 10 THR n 1 11 CYS n 1 12 ASN n 1 13 HIS n 1 14 CYS n 1 15 VAL n 1 16 MET n 1 17 ALA n 1 18 VAL n 1 19 THR n 1 20 LYS n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 LYS n 1 25 VAL n 1 26 PRO n 1 27 GLY n 1 28 VAL n 1 29 GLU n 1 30 LYS n 1 31 VAL n 1 32 GLU n 1 33 VAL n 1 34 SER n 1 35 LEU n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 ALA n 1 41 LEU n 1 42 VAL n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 ALA n 1 47 ASP n 1 48 PRO n 1 49 LYS n 1 50 ALA n 1 51 LEU n 1 52 VAL n 1 53 GLN n 1 54 ALA n 1 55 VAL n 1 56 GLU n 1 57 GLU n 1 58 GLU n 1 59 GLY n 1 60 TYR n 1 61 LYS n 1 62 ALA n 1 63 GLU n 1 64 VAL n 1 65 LEU n 1 66 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 66 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TTHA1718 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus HB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZCZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZCZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZCZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 5ZCZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5ZCZ _struct.title 'Solution structure of the T. Thermophilus HB8 TTHA1718 protein in living eukaryotic cells by in-cell NMR spectroscopy' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZCZ _struct_keywords.text 'A putative heavy-metal binding protein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SHL2_THET8 _struct_ref.pdbx_db_accession Q5SHL2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZCZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SHL2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4810 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 18 ? LYS A 24 ? VAL A 18 LYS A 24 1 ? 7 HELX_P HELX_P2 AA2 ASP A 47 ? GLU A 58 ? ASP A 47 GLU A 58 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 28 ? SER A 34 ? VAL A 28 SER A 34 AA1 2 GLU A 39 ? GLY A 44 ? GLU A 39 GLY A 44 AA1 3 LEU A 4 ? VAL A 6 ? LEU A 4 VAL A 6 AA1 4 ALA A 62 ? VAL A 64 ? ALA A 62 VAL A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 32 ? N GLU A 32 O LEU A 41 ? O LEU A 41 AA1 2 3 O ALA A 40 ? O ALA A 40 N LEU A 4 ? N LEU A 4 AA1 3 4 N LYS A 5 ? N LYS A 5 O GLU A 63 ? O GLU A 63 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? -164.47 79.38 2 2 VAL A 6 ? ? -59.77 170.90 3 2 CYS A 11 ? ? 50.35 9.00 4 2 THR A 19 ? ? -63.79 6.61 5 2 GLU A 29 ? ? -147.63 -18.56 6 2 ALA A 46 ? ? -56.03 173.62 7 3 LYS A 3 ? ? -155.12 79.41 8 3 CYS A 11 ? ? 46.06 26.99 9 3 LEU A 65 ? ? -83.71 34.15 10 4 LYS A 3 ? ? -160.24 77.52 11 4 ALA A 17 ? ? -69.67 94.35 12 5 LYS A 3 ? ? -153.81 80.08 13 5 LEU A 65 ? ? -84.08 31.28 14 6 GLU A 63 ? ? -53.61 107.60 15 6 LEU A 65 ? ? -84.04 35.34 16 7 LYS A 3 ? ? -167.14 78.78 17 7 ALA A 62 ? ? -162.39 111.33 18 8 LYS A 3 ? ? -157.31 77.10 19 9 LYS A 3 ? ? -159.42 78.82 20 10 LYS A 3 ? ? -153.39 77.97 21 10 MET A 9 ? ? -69.14 -74.77 22 10 ALA A 17 ? ? -69.58 91.59 23 10 VAL A 64 ? ? -58.81 108.53 24 11 LYS A 3 ? ? -153.15 81.36 25 11 VAL A 64 ? ? -58.96 109.02 26 12 LYS A 3 ? ? -159.73 78.74 27 13 LYS A 3 ? ? -156.31 76.41 28 13 ALA A 62 ? ? -155.10 78.83 29 14 LYS A 3 ? ? -161.71 79.62 30 14 ALA A 62 ? ? -160.55 117.26 31 14 LEU A 65 ? ? -82.39 31.80 32 15 LYS A 3 ? ? -161.64 81.15 33 15 CYS A 14 ? ? -127.60 -169.08 34 15 LEU A 65 ? ? -80.66 33.41 35 16 LYS A 3 ? ? -159.97 77.74 36 16 CYS A 14 ? ? -127.53 -167.87 37 16 LEU A 65 ? ? -94.30 32.16 38 17 LYS A 3 ? ? -156.91 78.81 39 17 MET A 9 ? ? -68.83 -73.15 40 17 LEU A 65 ? ? -82.87 34.62 41 18 LYS A 3 ? ? -156.21 81.25 42 18 VAL A 64 ? ? -58.78 106.32 43 19 LYS A 3 ? ? -159.65 76.58 44 19 ALA A 62 ? ? -162.66 79.57 45 19 LEU A 65 ? ? -108.46 59.48 46 20 LYS A 3 ? ? -161.80 77.46 47 20 ALA A 17 ? ? -68.90 91.14 48 20 ALA A 62 ? ? -161.50 92.81 # _pdbx_nmr_ensemble.entry_id 5ZCZ _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5ZCZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;50 uM [U-100% 13C; U-100% 15N] thermophilus HB8 TTHA1718 gene product 1, 50 uM [U-100% 15N] thermophilus HB8 TTHA1718 gene product 2, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label TTHA1718_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'thermophilus HB8 TTHA1718 gene product 1' 50 ? uM '[U-100% 13C; U-100% 15N]' 1 'thermophilus HB8 TTHA1718 gene product 2' 50 ? uM '[U-100% 15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 atm AMBIENT 0 0 ? ? 'Not defined' conditions_1 ? pH ? ? K 2 300 atm AMBIENT 0 0 ? ? 'Not defined' conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N SOFAST-HMQC' 1 isotropic 2 2 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 2 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 5ZCZ _pdbx_nmr_refine.method 'energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement OPAL 1.4 'Luginbuhl, Guntert, Billeter and Wuthrich' 2 processing Azara 2.8.1 Boucher 3 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 4 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 5 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 LEU N N N N 131 LEU CA C N S 132 LEU C C N N 133 LEU O O N N 134 LEU CB C N N 135 LEU CG C N N 136 LEU CD1 C N N 137 LEU CD2 C N N 138 LEU OXT O N N 139 LEU H H N N 140 LEU H2 H N N 141 LEU HA H N N 142 LEU HB2 H N N 143 LEU HB3 H N N 144 LEU HG H N N 145 LEU HD11 H N N 146 LEU HD12 H N N 147 LEU HD13 H N N 148 LEU HD21 H N N 149 LEU HD22 H N N 150 LEU HD23 H N N 151 LEU HXT H N N 152 LYS N N N N 153 LYS CA C N S 154 LYS C C N N 155 LYS O O N N 156 LYS CB C N N 157 LYS CG C N N 158 LYS CD C N N 159 LYS CE C N N 160 LYS NZ N N N 161 LYS OXT O N N 162 LYS H H N N 163 LYS H2 H N N 164 LYS HA H N N 165 LYS HB2 H N N 166 LYS HB3 H N N 167 LYS HG2 H N N 168 LYS HG3 H N N 169 LYS HD2 H N N 170 LYS HD3 H N N 171 LYS HE2 H N N 172 LYS HE3 H N N 173 LYS HZ1 H N N 174 LYS HZ2 H N N 175 LYS HZ3 H N N 176 LYS HXT H N N 177 MET N N N N 178 MET CA C N S 179 MET C C N N 180 MET O O N N 181 MET CB C N N 182 MET CG C N N 183 MET SD S N N 184 MET CE C N N 185 MET OXT O N N 186 MET H H N N 187 MET H2 H N N 188 MET HA H N N 189 MET HB2 H N N 190 MET HB3 H N N 191 MET HG2 H N N 192 MET HG3 H N N 193 MET HE1 H N N 194 MET HE2 H N N 195 MET HE3 H N N 196 MET HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 SER N N N N 215 SER CA C N S 216 SER C C N N 217 SER O O N N 218 SER CB C N N 219 SER OG O N N 220 SER OXT O N N 221 SER H H N N 222 SER H2 H N N 223 SER HA H N N 224 SER HB2 H N N 225 SER HB3 H N N 226 SER HG H N N 227 SER HXT H N N 228 THR N N N N 229 THR CA C N S 230 THR C C N N 231 THR O O N N 232 THR CB C N R 233 THR OG1 O N N 234 THR CG2 C N N 235 THR OXT O N N 236 THR H H N N 237 THR H2 H N N 238 THR HA H N N 239 THR HB H N N 240 THR HG1 H N N 241 THR HG21 H N N 242 THR HG22 H N N 243 THR HG23 H N N 244 THR HXT H N N 245 TYR N N N N 246 TYR CA C N S 247 TYR C C N N 248 TYR O O N N 249 TYR CB C N N 250 TYR CG C Y N 251 TYR CD1 C Y N 252 TYR CD2 C Y N 253 TYR CE1 C Y N 254 TYR CE2 C Y N 255 TYR CZ C Y N 256 TYR OH O N N 257 TYR OXT O N N 258 TYR H H N N 259 TYR H2 H N N 260 TYR HA H N N 261 TYR HB2 H N N 262 TYR HB3 H N N 263 TYR HD1 H N N 264 TYR HD2 H N N 265 TYR HE1 H N N 266 TYR HE2 H N N 267 TYR HH H N N 268 TYR HXT H N N 269 VAL N N N N 270 VAL CA C N S 271 VAL C C N N 272 VAL O O N N 273 VAL CB C N N 274 VAL CG1 C N N 275 VAL CG2 C N N 276 VAL OXT O N N 277 VAL H H N N 278 VAL H2 H N N 279 VAL HA H N N 280 VAL HB H N N 281 VAL HG11 H N N 282 VAL HG12 H N N 283 VAL HG13 H N N 284 VAL HG21 H N N 285 VAL HG22 H N N 286 VAL HG23 H N N 287 VAL HXT H N N 288 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PRO N CA sing N N 188 PRO N CD sing N N 189 PRO N H sing N N 190 PRO CA C sing N N 191 PRO CA CB sing N N 192 PRO CA HA sing N N 193 PRO C O doub N N 194 PRO C OXT sing N N 195 PRO CB CG sing N N 196 PRO CB HB2 sing N N 197 PRO CB HB3 sing N N 198 PRO CG CD sing N N 199 PRO CG HG2 sing N N 200 PRO CG HG3 sing N N 201 PRO CD HD2 sing N N 202 PRO CD HD3 sing N N 203 PRO OXT HXT sing N N 204 SER N CA sing N N 205 SER N H sing N N 206 SER N H2 sing N N 207 SER CA C sing N N 208 SER CA CB sing N N 209 SER CA HA sing N N 210 SER C O doub N N 211 SER C OXT sing N N 212 SER CB OG sing N N 213 SER CB HB2 sing N N 214 SER CB HB3 sing N N 215 SER OG HG sing N N 216 SER OXT HXT sing N N 217 THR N CA sing N N 218 THR N H sing N N 219 THR N H2 sing N N 220 THR CA C sing N N 221 THR CA CB sing N N 222 THR CA HA sing N N 223 THR C O doub N N 224 THR C OXT sing N N 225 THR CB OG1 sing N N 226 THR CB CG2 sing N N 227 THR CB HB sing N N 228 THR OG1 HG1 sing N N 229 THR CG2 HG21 sing N N 230 THR CG2 HG22 sing N N 231 THR CG2 HG23 sing N N 232 THR OXT HXT sing N N 233 TYR N CA sing N N 234 TYR N H sing N N 235 TYR N H2 sing N N 236 TYR CA C sing N N 237 TYR CA CB sing N N 238 TYR CA HA sing N N 239 TYR C O doub N N 240 TYR C OXT sing N N 241 TYR CB CG sing N N 242 TYR CB HB2 sing N N 243 TYR CB HB3 sing N N 244 TYR CG CD1 doub Y N 245 TYR CG CD2 sing Y N 246 TYR CD1 CE1 sing Y N 247 TYR CD1 HD1 sing N N 248 TYR CD2 CE2 doub Y N 249 TYR CD2 HD2 sing N N 250 TYR CE1 CZ doub Y N 251 TYR CE1 HE1 sing N N 252 TYR CE2 CZ sing Y N 253 TYR CE2 HE2 sing N N 254 TYR CZ OH sing N N 255 TYR OH HH sing N N 256 TYR OXT HXT sing N N 257 VAL N CA sing N N 258 VAL N H sing N N 259 VAL N H2 sing N N 260 VAL CA C sing N N 261 VAL CA CB sing N N 262 VAL CA HA sing N N 263 VAL C O doub N N 264 VAL C OXT sing N N 265 VAL CB CG1 sing N N 266 VAL CB CG2 sing N N 267 VAL CB HB sing N N 268 VAL CG1 HG11 sing N N 269 VAL CG1 HG12 sing N N 270 VAL CG1 HG13 sing N N 271 VAL CG2 HG21 sing N N 272 VAL CG2 HG22 sing N N 273 VAL CG2 HG23 sing N N 274 VAL OXT HXT sing N N 275 # _pdbx_audit_support.funding_organization 'Japan Science and Technology' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 'CREST; JPMJCR13M3' _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5ZCZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_