data_5ZF3 # _entry.id 5ZF3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZF3 pdb_00005zf3 10.2210/pdb5zf3/pdb WWPDB D_1300006949 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 2DFC unspecified PDB . 4HKW unspecified PDB . 4HKl unspecified PDB . 4HK9 unspecified PDB . 4HKO unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZF3 _pdbx_database_status.recvd_initial_deposition_date 2018-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, X.' 1 ? 'Wan, Q.' 2 ? 'Li, Z.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, X.' 1 ? primary 'Wan, Q.' 2 ? primary 'Li, Z.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ZF3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.413 _cell.length_a_esd ? _cell.length_b 58.492 _cell.length_b_esd ? _cell.length_c 69.281 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZF3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Endo-1,4-beta-xylanase 2' 20727.338 1 3.2.1.8 ? ? ? 2 branched man 'beta-D-xylopyranose-(1-4)-beta-D-xylopyranose-(1-4)-beta-D-xylopyranose' 414.360 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'IODIDE ION' 126.904 2 ? ? ? ? 5 water nat water 18.015 278 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Endo-beta-1,4-xylanase II,Xylanase 2,1,4-beta-D-xylan xylanohydrolase 2,Alkaline endo-beta-1,4-xylanase' 2 4beta-beta-xylotriose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _entity_poly.pdbx_seq_one_letter_code_can ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ILE n 1 3 GLN n 1 4 PRO n 1 5 GLY n 1 6 THR n 1 7 GLY n 1 8 TYR n 1 9 ASN n 1 10 ASN n 1 11 GLY n 1 12 TYR n 1 13 PHE n 1 14 TYR n 1 15 SER n 1 16 TYR n 1 17 TRP n 1 18 ASN n 1 19 ASP n 1 20 GLY n 1 21 HIS n 1 22 GLY n 1 23 GLY n 1 24 VAL n 1 25 THR n 1 26 TYR n 1 27 THR n 1 28 ASN n 1 29 GLY n 1 30 PRO n 1 31 GLY n 1 32 GLY n 1 33 GLN n 1 34 PHE n 1 35 SER n 1 36 VAL n 1 37 ASN n 1 38 TRP n 1 39 SER n 1 40 ASN n 1 41 SER n 1 42 GLY n 1 43 ASN n 1 44 PHE n 1 45 VAL n 1 46 GLY n 1 47 GLY n 1 48 LYS n 1 49 GLY n 1 50 TRP n 1 51 GLN n 1 52 PRO n 1 53 GLY n 1 54 THR n 1 55 LYS n 1 56 ASN n 1 57 LYS n 1 58 VAL n 1 59 ILE n 1 60 ASN n 1 61 PHE n 1 62 SER n 1 63 GLY n 1 64 SER n 1 65 TYR n 1 66 ASN n 1 67 PRO n 1 68 ASN n 1 69 GLY n 1 70 ASN n 1 71 SER n 1 72 TYR n 1 73 LEU n 1 74 SER n 1 75 VAL n 1 76 TYR n 1 77 GLY n 1 78 TRP n 1 79 SER n 1 80 ARG n 1 81 ASN n 1 82 PRO n 1 83 LEU n 1 84 ILE n 1 85 GLU n 1 86 TYR n 1 87 TYR n 1 88 ILE n 1 89 VAL n 1 90 GLU n 1 91 ASN n 1 92 PHE n 1 93 GLY n 1 94 THR n 1 95 TYR n 1 96 ASN n 1 97 PRO n 1 98 SER n 1 99 THR n 1 100 GLY n 1 101 ALA n 1 102 THR n 1 103 LYS n 1 104 LEU n 1 105 GLY n 1 106 GLU n 1 107 VAL n 1 108 THR n 1 109 SER n 1 110 ASP n 1 111 GLY n 1 112 SER n 1 113 VAL n 1 114 TYR n 1 115 ASP n 1 116 ILE n 1 117 TYR n 1 118 ARG n 1 119 THR n 1 120 GLN n 1 121 ARG n 1 122 VAL n 1 123 ASN n 1 124 GLN n 1 125 PRO n 1 126 SER n 1 127 ILE n 1 128 ILE n 1 129 GLY n 1 130 THR n 1 131 ALA n 1 132 THR n 1 133 PHE n 1 134 TYR n 1 135 GLN n 1 136 TYR n 1 137 TRP n 1 138 SER n 1 139 VAL n 1 140 ARG n 1 141 ARG n 1 142 ASN n 1 143 HIS n 1 144 ARG n 1 145 SER n 1 146 SER n 1 147 GLY n 1 148 SER n 1 149 VAL n 1 150 ASN n 1 151 THR n 1 152 ALA n 1 153 ASN n 1 154 HIS n 1 155 PHE n 1 156 ASN n 1 157 ALA n 1 158 TRP n 1 159 ALA n 1 160 GLN n 1 161 GLN n 1 162 GLY n 1 163 LEU n 1 164 THR n 1 165 LEU n 1 166 GLY n 1 167 THR n 1 168 MET n 1 169 ASP n 1 170 TYR n 1 171 GLN n 1 172 ILE n 1 173 VAL n 1 174 ALA n 1 175 VAL n 1 176 GLU n 1 177 GLY n 1 178 TYR n 1 179 PHE n 1 180 SER n 1 181 SER n 1 182 GLY n 1 183 SER n 1 184 ALA n 1 185 SER n 1 186 ILE n 1 187 THR n 1 188 VAL n 1 189 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name 'Trichoderma reesei' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'xyn2, M419DRAFT_124931' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1344414 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYN2_HYPJR _struct_ref.pdbx_db_accession P36217 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _struct_ref.pdbx_align_begin 35 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZF3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36217 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 223 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 190 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYP 'D-saccharide, beta linking' . beta-D-xylopyranose 'beta-D-xylose; D-xylose; xylose' 'C5 H10 O5' 150.130 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZF3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 8000, 0.2M NaI, 0.1M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-01-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 11.100 _reflns.entry_id 5ZF3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.2 _reflns.d_resolution_low 39.6840 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 61740 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.09 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.92 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.2 _reflns_shell.d_res_low 1.243 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.87 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5884 _reflns_shell.percent_possible_all 94.84 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 66.430 _refine.B_iso_mean 15.2352 _refine.B_iso_min 6.090 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'The structure factor file contains friedel pairs in F_PLUS/MINUS and I_PLUS/MINUS columns.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZF3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2000 _refine.ls_d_res_low 39.6840 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 61674 _refine.ls_number_reflns_R_free 3100 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0900 _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1334 _refine.ls_R_factor_R_free 0.1441 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1328 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2DFC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 13.4400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.2000 _refine_hist.d_res_low 39.6840 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.number_atoms_solvent 278 _refine_hist.number_atoms_total 1820 _refine_hist.pdbx_number_residues_total 189 _refine_hist.pdbx_B_iso_mean_ligand 21.24 _refine_hist.pdbx_B_iso_mean_solvent 31.39 _refine_hist.pdbx_number_atoms_protein 1472 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1642 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.351 ? 2260 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.111 ? 231 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 298 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.102 ? 551 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2000 1.2188 2626 . 123 2503 93.0000 . . . 0.2386 0.0000 0.2102 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.2188 1.2388 2693 . 145 2548 97.0000 . . . 0.2054 0.0000 0.1922 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.2388 1.2601 2734 . 137 2597 99.0000 . . . 0.2151 0.0000 0.1778 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.2601 1.2830 2799 . 129 2670 100.0000 . . . 0.1944 0.0000 0.1730 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.2830 1.3077 2790 . 125 2665 100.0000 . . . 0.1836 0.0000 0.1617 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.3077 1.3344 2792 . 154 2638 100.0000 . . . 0.1931 0.0000 0.1549 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.3344 1.3634 2772 . 128 2644 100.0000 . . . 0.1754 0.0000 0.1488 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.3634 1.3951 2774 . 156 2618 99.0000 . . . 0.1735 0.0000 0.1499 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.3951 1.4300 2794 . 137 2657 99.0000 . . . 0.1619 0.0000 0.1389 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4300 1.4687 2791 . 136 2655 100.0000 . . . 0.1529 0.0000 0.1343 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4687 1.5119 2805 . 136 2669 100.0000 . . . 0.1529 0.0000 0.1251 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.5119 1.5607 2807 . 149 2658 100.0000 . . . 0.1444 0.0000 0.1203 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.5607 1.6165 2823 . 147 2676 100.0000 . . . 0.1280 0.0000 0.1174 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.6165 1.6812 2801 . 152 2649 100.0000 . . . 0.1507 0.0000 0.1182 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.6812 1.7577 2805 . 155 2650 100.0000 . . . 0.1250 0.0000 0.1258 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.7577 1.8504 2823 . 144 2679 100.0000 . . . 0.1372 0.0000 0.1184 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.8504 1.9663 2814 . 115 2699 99.0000 . . . 0.1306 0.0000 0.1214 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.9663 2.1182 2847 . 151 2696 100.0000 . . . 0.1505 0.0000 0.1172 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.1182 2.3313 2848 . 154 2694 100.0000 . . . 0.1204 0.0000 0.1235 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.3313 2.6686 2869 . 143 2726 100.0000 . . . 0.1325 0.0000 0.1233 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.6686 3.3618 2884 . 142 2742 100.0000 . . . 0.1356 0.0000 0.1278 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 3.3618 39.7057 2983 . 142 2841 98.0000 . . . 0.1369 0.0000 0.1420 . . . . . . 22 . . . # _struct.entry_id 5ZF3 _struct.title 'Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZF3 _struct_keywords.text 'xylanase II, complex, Co-crystallization, Xylotriose, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 151 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 161 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 152 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 162 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B XYP . O4 ? ? ? 1_555 B XYP . C1 ? ? B XYP 1 B XYP 2 1_555 ? ? ? ? ? ? ? 1.465 ? ? covale2 covale both ? B XYP . O4 ? ? ? 1_555 B XYP . C1 ? ? B XYP 2 B XYP 3 1_555 ? ? ? ? ? ? ? 1.397 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 51 A . ? GLN 52 A PRO 52 A ? PRO 53 A 1 -0.71 2 ASN 81 A . ? ASN 82 A PRO 82 A ? PRO 83 A 1 12.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 5 ? ASN A 9 ? GLY A 6 ASN A 10 AA1 2 TYR A 12 ? ASN A 18 ? TYR A 13 ASN A 19 AA1 3 ASN A 43 ? TRP A 50 ? ASN A 44 TRP A 51 AA1 4 THR A 167 ? TYR A 178 ? THR A 168 TYR A 179 AA1 5 SER A 71 ? ARG A 80 ? SER A 72 ARG A 81 AA1 6 ILE A 84 ? PHE A 92 ? ILE A 85 PHE A 93 AA1 7 ALA A 131 ? ARG A 140 ? ALA A 132 ARG A 141 AA1 8 SER A 112 ? GLN A 124 ? SER A 113 GLN A 125 AA1 9 THR A 102 ? SER A 109 ? THR A 103 SER A 110 AA2 1 VAL A 24 ? ASN A 28 ? VAL A 25 ASN A 29 AA2 2 GLN A 33 ? TRP A 38 ? GLN A 34 TRP A 39 AA2 3 SER A 181 ? SER A 189 ? SER A 182 SER A 190 AA2 4 VAL A 58 ? ASN A 68 ? VAL A 59 ASN A 69 AA2 5 GLY A 147 ? ASN A 150 ? GLY A 148 ASN A 151 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 9 ? N ASN A 10 O TYR A 12 ? O TYR A 13 AA1 2 3 N PHE A 13 ? N PHE A 14 O GLY A 49 ? O GLY A 50 AA1 3 4 N TRP A 50 ? N TRP A 51 O GLN A 171 ? O GLN A 172 AA1 4 5 O ILE A 172 ? O ILE A 173 N TYR A 76 ? N TYR A 77 AA1 5 6 N GLY A 77 ? N GLY A 78 O TYR A 86 ? O TYR A 87 AA1 6 7 N VAL A 89 ? N VAL A 90 O SER A 138 ? O SER A 139 AA1 7 8 O PHE A 133 ? O PHE A 134 N ARG A 121 ? N ARG A 122 AA1 8 9 O ILE A 116 ? O ILE A 117 N LEU A 104 ? N LEU A 105 AA2 1 2 N THR A 27 ? N THR A 28 O SER A 35 ? O SER A 36 AA2 2 3 N TRP A 38 ? N TRP A 39 O GLY A 182 ? O GLY A 183 AA2 3 4 O SER A 181 ? O SER A 182 N ASN A 68 ? N ASN A 69 AA2 4 5 N ILE A 59 ? N ILE A 60 O VAL A 149 ? O VAL A 150 # _atom_sites.entry_id 5ZF3 _atom_sites.fract_transf_matrix[1][1] 0.020656 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017096 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014434 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H I N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 2 2 THR THR A . n A 1 2 ILE 2 3 3 ILE ILE A . n A 1 3 GLN 3 4 4 GLN GLN A . n A 1 4 PRO 4 5 5 PRO PRO A . n A 1 5 GLY 5 6 6 GLY GLY A . n A 1 6 THR 6 7 7 THR THR A . n A 1 7 GLY 7 8 8 GLY GLY A . n A 1 8 TYR 8 9 9 TYR TYR A . n A 1 9 ASN 9 10 10 ASN ASN A . n A 1 10 ASN 10 11 11 ASN ASN A . n A 1 11 GLY 11 12 12 GLY GLY A . n A 1 12 TYR 12 13 13 TYR TYR A . n A 1 13 PHE 13 14 14 PHE PHE A . n A 1 14 TYR 14 15 15 TYR TYR A . n A 1 15 SER 15 16 16 SER SER A . n A 1 16 TYR 16 17 17 TYR TYR A . n A 1 17 TRP 17 18 18 TRP TRP A . n A 1 18 ASN 18 19 19 ASN ASN A . n A 1 19 ASP 19 20 20 ASP ASP A . n A 1 20 GLY 20 21 21 GLY GLY A . n A 1 21 HIS 21 22 22 HIS HIS A . n A 1 22 GLY 22 23 23 GLY GLY A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 VAL 24 25 25 VAL VAL A . n A 1 25 THR 25 26 26 THR THR A . n A 1 26 TYR 26 27 27 TYR TYR A . n A 1 27 THR 27 28 28 THR THR A . n A 1 28 ASN 28 29 29 ASN ASN A . n A 1 29 GLY 29 30 30 GLY GLY A . n A 1 30 PRO 30 31 31 PRO PRO A . n A 1 31 GLY 31 32 32 GLY GLY A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 GLN 33 34 34 GLN GLN A . n A 1 34 PHE 34 35 35 PHE PHE A . n A 1 35 SER 35 36 36 SER SER A . n A 1 36 VAL 36 37 37 VAL VAL A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 TRP 38 39 39 TRP TRP A . n A 1 39 SER 39 40 40 SER SER A . n A 1 40 ASN 40 41 41 ASN ASN A . n A 1 41 SER 41 42 42 SER SER A . n A 1 42 GLY 42 43 43 GLY GLY A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 PHE 44 45 45 PHE PHE A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 GLY 47 48 48 GLY GLY A . n A 1 48 LYS 48 49 49 LYS LYS A . n A 1 49 GLY 49 50 50 GLY GLY A . n A 1 50 TRP 50 51 51 TRP TRP A . n A 1 51 GLN 51 52 52 GLN GLN A . n A 1 52 PRO 52 53 53 PRO PRO A . n A 1 53 GLY 53 54 54 GLY GLY A . n A 1 54 THR 54 55 55 THR THR A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 ASN 56 57 57 ASN ASN A . n A 1 57 LYS 57 58 58 LYS LYS A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 ASN 60 61 61 ASN ASN A . n A 1 61 PHE 61 62 62 PHE PHE A . n A 1 62 SER 62 63 63 SER SER A . n A 1 63 GLY 63 64 64 GLY GLY A . n A 1 64 SER 64 65 65 SER SER A . n A 1 65 TYR 65 66 66 TYR TYR A . n A 1 66 ASN 66 67 67 ASN ASN A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 ASN 68 69 69 ASN ASN A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 TYR 72 73 73 TYR TYR A . n A 1 73 LEU 73 74 74 LEU LEU A . n A 1 74 SER 74 75 75 SER SER A . n A 1 75 VAL 75 76 76 VAL VAL A . n A 1 76 TYR 76 77 77 TYR TYR A . n A 1 77 GLY 77 78 78 GLY GLY A . n A 1 78 TRP 78 79 79 TRP TRP A . n A 1 79 SER 79 80 80 SER SER A . n A 1 80 ARG 80 81 81 ARG ARG A . n A 1 81 ASN 81 82 82 ASN ASN A . n A 1 82 PRO 82 83 83 PRO PRO A . n A 1 83 LEU 83 84 84 LEU LEU A . n A 1 84 ILE 84 85 85 ILE ILE A . n A 1 85 GLU 85 86 86 GLU GLU A . n A 1 86 TYR 86 87 87 TYR TYR A . n A 1 87 TYR 87 88 88 TYR TYR A . n A 1 88 ILE 88 89 89 ILE ILE A . n A 1 89 VAL 89 90 90 VAL VAL A . n A 1 90 GLU 90 91 91 GLU GLU A . n A 1 91 ASN 91 92 92 ASN ASN A . n A 1 92 PHE 92 93 93 PHE PHE A . n A 1 93 GLY 93 94 94 GLY GLY A . n A 1 94 THR 94 95 95 THR THR A . n A 1 95 TYR 95 96 96 TYR TYR A . n A 1 96 ASN 96 97 97 ASN ASN A . n A 1 97 PRO 97 98 98 PRO PRO A . n A 1 98 SER 98 99 99 SER SER A . n A 1 99 THR 99 100 100 THR THR A . n A 1 100 GLY 100 101 101 GLY GLY A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 THR 102 103 103 THR THR A . n A 1 103 LYS 103 104 104 LYS LYS A . n A 1 104 LEU 104 105 105 LEU LEU A . n A 1 105 GLY 105 106 106 GLY GLY A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 VAL 107 108 108 VAL VAL A . n A 1 108 THR 108 109 109 THR THR A . n A 1 109 SER 109 110 110 SER SER A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 GLY 111 112 112 GLY GLY A . n A 1 112 SER 112 113 113 SER SER A . n A 1 113 VAL 113 114 114 VAL VAL A . n A 1 114 TYR 114 115 115 TYR TYR A . n A 1 115 ASP 115 116 116 ASP ASP A . n A 1 116 ILE 116 117 117 ILE ILE A . n A 1 117 TYR 117 118 118 TYR TYR A . n A 1 118 ARG 118 119 119 ARG ARG A . n A 1 119 THR 119 120 120 THR THR A . n A 1 120 GLN 120 121 121 GLN GLN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 VAL 122 123 123 VAL VAL A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 GLN 124 125 125 GLN GLN A . n A 1 125 PRO 125 126 126 PRO PRO A . n A 1 126 SER 126 127 127 SER SER A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ILE 128 129 129 ILE ILE A . n A 1 129 GLY 129 130 130 GLY GLY A . n A 1 130 THR 130 131 131 THR THR A . n A 1 131 ALA 131 132 132 ALA ALA A . n A 1 132 THR 132 133 133 THR THR A . n A 1 133 PHE 133 134 134 PHE PHE A . n A 1 134 TYR 134 135 135 TYR TYR A . n A 1 135 GLN 135 136 136 GLN GLN A . n A 1 136 TYR 136 137 137 TYR TYR A . n A 1 137 TRP 137 138 138 TRP TRP A . n A 1 138 SER 138 139 139 SER SER A . n A 1 139 VAL 139 140 140 VAL VAL A . n A 1 140 ARG 140 141 141 ARG ARG A . n A 1 141 ARG 141 142 142 ARG ARG A . n A 1 142 ASN 142 143 143 ASN ASN A . n A 1 143 HIS 143 144 144 HIS HIS A . n A 1 144 ARG 144 145 145 ARG ARG A . n A 1 145 SER 145 146 146 SER SER A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 GLY 147 148 148 GLY GLY A . n A 1 148 SER 148 149 149 SER SER A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 ASN 150 151 151 ASN ASN A . n A 1 151 THR 151 152 152 THR THR A . n A 1 152 ALA 152 153 153 ALA ALA A . n A 1 153 ASN 153 154 154 ASN ASN A . n A 1 154 HIS 154 155 155 HIS HIS A . n A 1 155 PHE 155 156 156 PHE PHE A . n A 1 156 ASN 156 157 157 ASN ASN A . n A 1 157 ALA 157 158 158 ALA ALA A . n A 1 158 TRP 158 159 159 TRP TRP A . n A 1 159 ALA 159 160 160 ALA ALA A . n A 1 160 GLN 160 161 161 GLN GLN A . n A 1 161 GLN 161 162 162 GLN GLN A . n A 1 162 GLY 162 163 163 GLY GLY A . n A 1 163 LEU 163 164 164 LEU LEU A . n A 1 164 THR 164 165 165 THR THR A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 GLY 166 167 167 GLY GLY A . n A 1 167 THR 167 168 168 THR THR A . n A 1 168 MET 168 169 169 MET MET A . n A 1 169 ASP 169 170 170 ASP ASP A . n A 1 170 TYR 170 171 171 TYR TYR A . n A 1 171 GLN 171 172 172 GLN GLN A . n A 1 172 ILE 172 173 173 ILE ILE A . n A 1 173 VAL 173 174 174 VAL VAL A . n A 1 174 ALA 174 175 175 ALA ALA A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLU 176 177 177 GLU GLU A . n A 1 177 GLY 177 178 178 GLY GLY A . n A 1 178 TYR 178 179 179 TYR TYR A . n A 1 179 PHE 179 180 180 PHE PHE A . n A 1 180 SER 180 181 181 SER SER A . n A 1 181 SER 181 182 182 SER SER A . n A 1 182 GLY 182 183 183 GLY GLY A . n A 1 183 SER 183 184 184 SER SER A . n A 1 184 ALA 184 185 185 ALA ALA A . n A 1 185 SER 185 186 186 SER SER A . n A 1 186 ILE 186 187 187 ILE ILE A . n A 1 187 THR 187 188 188 THR THR A . n A 1 188 VAL 188 189 189 VAL VAL A . n A 1 189 SER 189 190 190 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 204 204 GOL GOL A . D 4 IOD 1 205 1 IOD IOD A . E 4 IOD 1 206 2 IOD IOD A . F 5 HOH 1 301 248 HOH HOH A . F 5 HOH 2 302 198 HOH HOH A . F 5 HOH 3 303 320 HOH HOH A . F 5 HOH 4 304 277 HOH HOH A . F 5 HOH 5 305 97 HOH HOH A . F 5 HOH 6 306 307 HOH HOH A . F 5 HOH 7 307 141 HOH HOH A . F 5 HOH 8 308 270 HOH HOH A . F 5 HOH 9 309 142 HOH HOH A . F 5 HOH 10 310 256 HOH HOH A . F 5 HOH 11 311 281 HOH HOH A . F 5 HOH 12 312 81 HOH HOH A . F 5 HOH 13 313 133 HOH HOH A . F 5 HOH 14 314 170 HOH HOH A . F 5 HOH 15 315 11 HOH HOH A . F 5 HOH 16 316 284 HOH HOH A . F 5 HOH 17 317 124 HOH HOH A . F 5 HOH 18 318 280 HOH HOH A . F 5 HOH 19 319 72 HOH HOH A . F 5 HOH 20 320 253 HOH HOH A . F 5 HOH 21 321 217 HOH HOH A . F 5 HOH 22 322 51 HOH HOH A . F 5 HOH 23 323 177 HOH HOH A . F 5 HOH 24 324 15 HOH HOH A . F 5 HOH 25 325 137 HOH HOH A . F 5 HOH 26 326 150 HOH HOH A . F 5 HOH 27 327 286 HOH HOH A . F 5 HOH 28 328 88 HOH HOH A . F 5 HOH 29 329 254 HOH HOH A . F 5 HOH 30 330 178 HOH HOH A . F 5 HOH 31 331 27 HOH HOH A . F 5 HOH 32 332 211 HOH HOH A . F 5 HOH 33 333 235 HOH HOH A . F 5 HOH 34 334 160 HOH HOH A . F 5 HOH 35 335 37 HOH HOH A . F 5 HOH 36 336 146 HOH HOH A . F 5 HOH 37 337 31 HOH HOH A . F 5 HOH 38 338 26 HOH HOH A . F 5 HOH 39 339 55 HOH HOH A . F 5 HOH 40 340 21 HOH HOH A . F 5 HOH 41 341 8 HOH HOH A . F 5 HOH 42 342 302 HOH HOH A . F 5 HOH 43 343 10 HOH HOH A . F 5 HOH 44 344 6 HOH HOH A . F 5 HOH 45 345 119 HOH HOH A . F 5 HOH 46 346 189 HOH HOH A . F 5 HOH 47 347 112 HOH HOH A . F 5 HOH 48 348 293 HOH HOH A . F 5 HOH 49 349 99 HOH HOH A . F 5 HOH 50 350 166 HOH HOH A . F 5 HOH 51 351 61 HOH HOH A . F 5 HOH 52 352 288 HOH HOH A . F 5 HOH 53 353 128 HOH HOH A . F 5 HOH 54 354 96 HOH HOH A . F 5 HOH 55 355 19 HOH HOH A . F 5 HOH 56 356 111 HOH HOH A . F 5 HOH 57 357 164 HOH HOH A . F 5 HOH 58 358 118 HOH HOH A . F 5 HOH 59 359 33 HOH HOH A . F 5 HOH 60 360 125 HOH HOH A . F 5 HOH 61 361 200 HOH HOH A . F 5 HOH 62 362 95 HOH HOH A . F 5 HOH 63 363 85 HOH HOH A . F 5 HOH 64 364 32 HOH HOH A . F 5 HOH 65 365 17 HOH HOH A . F 5 HOH 66 366 71 HOH HOH A . F 5 HOH 67 367 48 HOH HOH A . F 5 HOH 68 368 258 HOH HOH A . F 5 HOH 69 369 132 HOH HOH A . F 5 HOH 70 370 265 HOH HOH A . F 5 HOH 71 371 237 HOH HOH A . F 5 HOH 72 372 251 HOH HOH A . F 5 HOH 73 373 38 HOH HOH A . F 5 HOH 74 374 78 HOH HOH A . F 5 HOH 75 375 62 HOH HOH A . F 5 HOH 76 376 75 HOH HOH A . F 5 HOH 77 377 1 HOH HOH A . F 5 HOH 78 378 67 HOH HOH A . F 5 HOH 79 379 102 HOH HOH A . F 5 HOH 80 380 108 HOH HOH A . F 5 HOH 81 381 204 HOH HOH A . F 5 HOH 82 382 134 HOH HOH A . F 5 HOH 83 383 68 HOH HOH A . F 5 HOH 84 384 2 HOH HOH A . F 5 HOH 85 385 123 HOH HOH A . F 5 HOH 86 386 176 HOH HOH A . F 5 HOH 87 387 35 HOH HOH A . F 5 HOH 88 388 196 HOH HOH A . F 5 HOH 89 389 54 HOH HOH A . F 5 HOH 90 390 215 HOH HOH A . F 5 HOH 91 391 158 HOH HOH A . F 5 HOH 92 392 291 HOH HOH A . F 5 HOH 93 393 203 HOH HOH A . F 5 HOH 94 394 47 HOH HOH A . F 5 HOH 95 395 86 HOH HOH A . F 5 HOH 96 396 36 HOH HOH A . F 5 HOH 97 397 274 HOH HOH A . F 5 HOH 98 398 262 HOH HOH A . F 5 HOH 99 399 171 HOH HOH A . F 5 HOH 100 400 324 HOH HOH A . F 5 HOH 101 401 298 HOH HOH A . F 5 HOH 102 402 91 HOH HOH A . F 5 HOH 103 403 87 HOH HOH A . F 5 HOH 104 404 292 HOH HOH A . F 5 HOH 105 405 144 HOH HOH A . F 5 HOH 106 406 89 HOH HOH A . F 5 HOH 107 407 190 HOH HOH A . F 5 HOH 108 408 109 HOH HOH A . F 5 HOH 109 409 46 HOH HOH A . F 5 HOH 110 410 181 HOH HOH A . F 5 HOH 111 411 104 HOH HOH A . F 5 HOH 112 412 69 HOH HOH A . F 5 HOH 113 413 156 HOH HOH A . F 5 HOH 114 414 105 HOH HOH A . F 5 HOH 115 415 76 HOH HOH A . F 5 HOH 116 416 3 HOH HOH A . F 5 HOH 117 417 22 HOH HOH A . F 5 HOH 118 418 70 HOH HOH A . F 5 HOH 119 419 268 HOH HOH A . F 5 HOH 120 420 74 HOH HOH A . F 5 HOH 121 421 162 HOH HOH A . F 5 HOH 122 422 64 HOH HOH A . F 5 HOH 123 423 25 HOH HOH A . F 5 HOH 124 424 249 HOH HOH A . F 5 HOH 125 425 117 HOH HOH A . F 5 HOH 126 426 231 HOH HOH A . F 5 HOH 127 427 79 HOH HOH A . F 5 HOH 128 428 49 HOH HOH A . F 5 HOH 129 429 5 HOH HOH A . F 5 HOH 130 430 39 HOH HOH A . F 5 HOH 131 431 80 HOH HOH A . F 5 HOH 132 432 201 HOH HOH A . F 5 HOH 133 433 143 HOH HOH A . F 5 HOH 134 434 45 HOH HOH A . F 5 HOH 135 435 155 HOH HOH A . F 5 HOH 136 436 161 HOH HOH A . F 5 HOH 137 437 30 HOH HOH A . F 5 HOH 138 438 113 HOH HOH A . F 5 HOH 139 439 192 HOH HOH A . F 5 HOH 140 440 34 HOH HOH A . F 5 HOH 141 441 84 HOH HOH A . F 5 HOH 142 442 43 HOH HOH A . F 5 HOH 143 443 213 HOH HOH A . F 5 HOH 144 444 163 HOH HOH A . F 5 HOH 145 445 14 HOH HOH A . F 5 HOH 146 446 214 HOH HOH A . F 5 HOH 147 447 167 HOH HOH A . F 5 HOH 148 448 93 HOH HOH A . F 5 HOH 149 449 18 HOH HOH A . F 5 HOH 150 450 135 HOH HOH A . F 5 HOH 151 451 187 HOH HOH A . F 5 HOH 152 452 116 HOH HOH A . F 5 HOH 153 453 173 HOH HOH A . F 5 HOH 154 454 40 HOH HOH A . F 5 HOH 155 455 24 HOH HOH A . F 5 HOH 156 456 20 HOH HOH A . F 5 HOH 157 457 139 HOH HOH A . F 5 HOH 158 458 278 HOH HOH A . F 5 HOH 159 459 56 HOH HOH A . F 5 HOH 160 460 83 HOH HOH A . F 5 HOH 161 461 90 HOH HOH A . F 5 HOH 162 462 148 HOH HOH A . F 5 HOH 163 463 63 HOH HOH A . F 5 HOH 164 464 250 HOH HOH A . F 5 HOH 165 465 175 HOH HOH A . F 5 HOH 166 466 52 HOH HOH A . F 5 HOH 167 467 209 HOH HOH A . F 5 HOH 168 468 50 HOH HOH A . F 5 HOH 169 469 314 HOH HOH A . F 5 HOH 170 470 296 HOH HOH A . F 5 HOH 171 471 283 HOH HOH A . F 5 HOH 172 472 223 HOH HOH A . F 5 HOH 173 473 136 HOH HOH A . F 5 HOH 174 474 107 HOH HOH A . F 5 HOH 175 475 149 HOH HOH A . F 5 HOH 176 476 122 HOH HOH A . F 5 HOH 177 477 244 HOH HOH A . F 5 HOH 178 478 82 HOH HOH A . F 5 HOH 179 479 172 HOH HOH A . F 5 HOH 180 480 218 HOH HOH A . F 5 HOH 181 481 300 HOH HOH A . F 5 HOH 182 482 53 HOH HOH A . F 5 HOH 183 483 126 HOH HOH A . F 5 HOH 184 484 94 HOH HOH A . F 5 HOH 185 485 59 HOH HOH A . F 5 HOH 186 486 73 HOH HOH A . F 5 HOH 187 487 66 HOH HOH A . F 5 HOH 188 488 252 HOH HOH A . F 5 HOH 189 489 325 HOH HOH A . F 5 HOH 190 490 183 HOH HOH A . F 5 HOH 191 491 267 HOH HOH A . F 5 HOH 192 492 308 HOH HOH A . F 5 HOH 193 493 157 HOH HOH A . F 5 HOH 194 494 114 HOH HOH A . F 5 HOH 195 495 101 HOH HOH A . F 5 HOH 196 496 275 HOH HOH A . F 5 HOH 197 497 323 HOH HOH A . F 5 HOH 198 498 216 HOH HOH A . F 5 HOH 199 499 186 HOH HOH A . F 5 HOH 200 500 259 HOH HOH A . F 5 HOH 201 501 303 HOH HOH A . F 5 HOH 202 502 197 HOH HOH A . F 5 HOH 203 503 121 HOH HOH A . F 5 HOH 204 504 220 HOH HOH A . F 5 HOH 205 505 299 HOH HOH A . F 5 HOH 206 506 230 HOH HOH A . F 5 HOH 207 507 290 HOH HOH A . F 5 HOH 208 508 145 HOH HOH A . F 5 HOH 209 509 188 HOH HOH A . F 5 HOH 210 510 297 HOH HOH A . F 5 HOH 211 511 92 HOH HOH A . F 5 HOH 212 512 194 HOH HOH A . F 5 HOH 213 513 247 HOH HOH A . F 5 HOH 214 514 245 HOH HOH A . F 5 HOH 215 515 174 HOH HOH A . F 5 HOH 216 516 319 HOH HOH A . F 5 HOH 217 517 205 HOH HOH A . F 5 HOH 218 518 212 HOH HOH A . F 5 HOH 219 519 234 HOH HOH A . F 5 HOH 220 520 42 HOH HOH A . F 5 HOH 221 521 327 HOH HOH A . F 5 HOH 222 522 236 HOH HOH A . F 5 HOH 223 523 127 HOH HOH A . F 5 HOH 224 524 276 HOH HOH A . F 5 HOH 225 525 243 HOH HOH A . F 5 HOH 226 526 138 HOH HOH A . F 5 HOH 227 527 241 HOH HOH A . F 5 HOH 228 528 246 HOH HOH A . F 5 HOH 229 529 195 HOH HOH A . F 5 HOH 230 530 208 HOH HOH A . F 5 HOH 231 531 180 HOH HOH A . F 5 HOH 232 532 285 HOH HOH A . F 5 HOH 233 533 316 HOH HOH A . F 5 HOH 234 534 154 HOH HOH A . F 5 HOH 235 535 264 HOH HOH A . F 5 HOH 236 536 185 HOH HOH A . F 5 HOH 237 537 263 HOH HOH A . F 5 HOH 238 538 318 HOH HOH A . F 5 HOH 239 539 295 HOH HOH A . F 5 HOH 240 540 199 HOH HOH A . F 5 HOH 241 541 120 HOH HOH A . F 5 HOH 242 542 206 HOH HOH A . F 5 HOH 243 543 224 HOH HOH A . F 5 HOH 244 544 60 HOH HOH A . F 5 HOH 245 545 193 HOH HOH A . F 5 HOH 246 546 227 HOH HOH A . F 5 HOH 247 547 130 HOH HOH A . F 5 HOH 248 548 110 HOH HOH A . F 5 HOH 249 549 282 HOH HOH A . F 5 HOH 250 550 304 HOH HOH A . F 5 HOH 251 551 207 HOH HOH A . F 5 HOH 252 552 191 HOH HOH A . F 5 HOH 253 553 287 HOH HOH A . F 5 HOH 254 554 310 HOH HOH A . F 5 HOH 255 555 153 HOH HOH A . F 5 HOH 256 556 269 HOH HOH A . F 5 HOH 257 557 140 HOH HOH A . F 5 HOH 258 558 98 HOH HOH A . F 5 HOH 259 559 233 HOH HOH A . F 5 HOH 260 560 182 HOH HOH A . F 5 HOH 261 561 221 HOH HOH A . F 5 HOH 262 562 184 HOH HOH A . F 5 HOH 263 563 294 HOH HOH A . F 5 HOH 264 564 257 HOH HOH A . F 5 HOH 265 565 279 HOH HOH A . F 5 HOH 266 566 103 HOH HOH A . F 5 HOH 267 567 301 HOH HOH A . F 5 HOH 268 568 306 HOH HOH A . F 5 HOH 269 569 273 HOH HOH A . F 5 HOH 270 570 313 HOH HOH A . F 5 HOH 271 571 289 HOH HOH A . F 5 HOH 272 572 152 HOH HOH A . F 5 HOH 273 573 202 HOH HOH A . F 5 HOH 274 574 315 HOH HOH A . F 5 HOH 275 575 312 HOH HOH A . F 5 HOH 276 576 106 HOH HOH A . F 5 HOH 277 577 271 HOH HOH A . F 5 HOH 278 578 260 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900117 _pdbx_molecule_features.name 4beta-beta-xylotriose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Metabolism _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900117 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 970 ? 1 MORE -11 ? 1 'SSA (A^2)' 7670 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-06 2 'Structure model' 2 0 2020-07-29 3 'Structure model' 2 1 2023-11-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Derived calculations' 8 3 'Structure model' 'Refinement description' 9 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' entity 4 2 'Structure model' entity_name_com 5 2 'Structure model' pdbx_branch_scheme 6 2 'Structure model' pdbx_chem_comp_identifier 7 2 'Structure model' pdbx_entity_branch 8 2 'Structure model' pdbx_entity_branch_descriptor 9 2 'Structure model' pdbx_entity_branch_link 10 2 'Structure model' pdbx_entity_branch_list 11 2 'Structure model' pdbx_entity_nonpoly 12 2 'Structure model' pdbx_molecule_features 13 2 'Structure model' pdbx_nonpoly_scheme 14 2 'Structure model' pdbx_struct_assembly_gen 15 2 'Structure model' struct_asym 16 2 'Structure model' struct_conn 17 2 'Structure model' struct_site 18 2 'Structure model' struct_site_gen 19 3 'Structure model' chem_comp 20 3 'Structure model' chem_comp_atom 21 3 'Structure model' chem_comp_bond 22 3 'Structure model' database_2 23 3 'Structure model' pdbx_initial_refinement_model 24 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_asym_id' 6 2 'Structure model' '_atom_site.auth_atom_id' 7 2 'Structure model' '_atom_site.auth_seq_id' 8 2 'Structure model' '_atom_site.label_asym_id' 9 2 'Structure model' '_atom_site.label_atom_id' 10 2 'Structure model' '_atom_site.type_symbol' 11 2 'Structure model' '_chem_comp.name' 12 2 'Structure model' '_chem_comp.type' 13 2 'Structure model' '_entity.formula_weight' 14 2 'Structure model' '_entity.pdbx_description' 15 2 'Structure model' '_entity.pdbx_number_of_molecules' 16 2 'Structure model' '_entity.type' 17 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 24 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 3 'Structure model' '_chem_comp.pdbx_synonyms' 28 3 'Structure model' '_database_2.pdbx_DOI' 29 3 'Structure model' '_database_2.pdbx_database_accession' 30 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C A VAL 189 ? B H A SER 190 ? ? 1.13 2 1 C A VAL 189 ? A H A SER 190 ? ? 1.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A SER 75 ? B OG A SER 75 ? B 1.338 1.418 -0.080 0.013 N 2 1 CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 1.413 1.326 0.087 0.013 N 3 1 CZ A ARG 119 ? ? NH2 A ARG 119 ? ? 1.418 1.326 0.092 0.013 N 4 1 CZ A ARG 122 ? ? NH1 A ARG 122 ? ? 1.413 1.326 0.087 0.013 N 5 1 CZ A ARG 122 ? ? NH2 A ARG 122 ? ? 1.409 1.326 0.083 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 57 ? ? -140.17 24.11 2 1 ASP A 170 ? ? -100.60 -138.03 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IOD I I N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 XYP O1 O N N 392 XYP C1 C N R 393 XYP C2 C N R 394 XYP C3 C N S 395 XYP C4 C N R 396 XYP C5 C N N 397 XYP O2 O N N 398 XYP O3 O N N 399 XYP O4 O N N 400 XYP O5 O N N 401 XYP HO1 H N N 402 XYP H1 H N N 403 XYP H2 H N N 404 XYP H3 H N N 405 XYP H4 H N N 406 XYP H51 H N N 407 XYP H52 H N N 408 XYP HO2 H N N 409 XYP HO3 H N N 410 XYP HO4 H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 XYP O1 C1 sing N N 376 XYP O1 HO1 sing N N 377 XYP C1 C2 sing N N 378 XYP C1 O5 sing N N 379 XYP C1 H1 sing N N 380 XYP C2 C3 sing N N 381 XYP C2 O2 sing N N 382 XYP C2 H2 sing N N 383 XYP C3 C4 sing N N 384 XYP C3 O3 sing N N 385 XYP C3 H3 sing N N 386 XYP C4 C5 sing N N 387 XYP C4 O4 sing N N 388 XYP C4 H4 sing N N 389 XYP C5 O5 sing N N 390 XYP C5 H51 sing N N 391 XYP C5 H52 sing N N 392 XYP O2 HO2 sing N N 393 XYP O3 HO3 sing N N 394 XYP O4 HO4 sing N N 395 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31670790 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 XYP 1 B XYP 1 A XYP 203 n B 2 XYP 2 B XYP 2 A XYP 202 n B 2 XYP 3 B XYP 3 A XYP 201 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier XYP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpb XYP 'COMMON NAME' GMML 1.0 b-D-xylopyranose XYP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Xylp XYP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DXylpb1-4DXylpb1-4DXylpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a212h-1b_1-5]/1-1-1/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Xylp]{[(4+1)][b-D-Xylp]{[(4+1)][b-D-Xylp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 XYP C1 O1 1 XYP O4 HO4 sing ? 2 2 3 XYP C1 O1 2 XYP O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 XYP 1 n 2 XYP 2 n 2 XYP 3 n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id XYP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id XYP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'IODIDE ION' IOD 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2DFC _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.1107/S1399004713023626 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'molecular weight of 20 KDa shown in gel filtration' #