data_5ZRI # _entry.id 5ZRI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZRI pdb_00005zri 10.2210/pdb5zri/pdb WWPDB D_1300007542 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5ZRC unspecified PDB . 5ZRG unspecified PDB . 5ZRH unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZRI _pdbx_database_status.recvd_initial_deposition_date 2018-04-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Singh, A.' 1 ? 'Arif, S.M.' 2 ? 'Sang, P.B.' 3 ? 'Varshney, U.' 4 ? 'Vijayan, M.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 204 _citation.language ? _citation.page_first 449 _citation.page_last 456 _citation.title 'Structural insights into the specificity and catalytic mechanism of mycobacterial nucleotide pool sanitizing enzyme MutT2.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2018.10.002 _citation.pdbx_database_id_PubMed 30312643 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singh, A.' 1 ? primary 'Mohammad Arif, S.' 2 ? primary 'Biak Sang, P.' 3 ? primary 'Varshney, U.' 4 ? primary 'Vijayan, M.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZRI _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.520 _cell.length_a_esd ? _cell.length_b 58.840 _cell.length_b_esd ? _cell.length_c 31.350 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZRI _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative mutator protein MutT2/NUDIX hydrolase' 16081.142 1 ? ? ? ? 2 non-polymer syn '[(2R,3S,5R)-5-(4-azanyl-5-methyl-pyrimidin-1-ium-1-yl)-3-oxidanyl-oxolan-2-yl]methyl dihydrogen phosphate' 306.232 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 163 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMTKQIVVAGALISRGTLLVAQRDRPAELAGLWELPGGKVTPGESDADALARELREELGVD VAVGERLGADVALNDAMTLRAYRVTLRSGSPHPHDHRALRWVGADEIDGLAWVPADRAWVPDLVAALSGR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMTKQIVVAGALISRGTLLVAQRDRPAELAGLWELPGGKVTPGESDADALARELREELGVD VAVGERLGADVALNDAMTLRAYRVTLRSGSPHPHDHRALRWVGADEIDGLAWVPADRAWVPDLVAALSGR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 THR n 1 23 LYS n 1 24 GLN n 1 25 ILE n 1 26 VAL n 1 27 VAL n 1 28 ALA n 1 29 GLY n 1 30 ALA n 1 31 LEU n 1 32 ILE n 1 33 SER n 1 34 ARG n 1 35 GLY n 1 36 THR n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ALA n 1 41 GLN n 1 42 ARG n 1 43 ASP n 1 44 ARG n 1 45 PRO n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 ALA n 1 50 GLY n 1 51 LEU n 1 52 TRP n 1 53 GLU n 1 54 LEU n 1 55 PRO n 1 56 GLY n 1 57 GLY n 1 58 LYS n 1 59 VAL n 1 60 THR n 1 61 PRO n 1 62 GLY n 1 63 GLU n 1 64 SER n 1 65 ASP n 1 66 ALA n 1 67 ASP n 1 68 ALA n 1 69 LEU n 1 70 ALA n 1 71 ARG n 1 72 GLU n 1 73 LEU n 1 74 ARG n 1 75 GLU n 1 76 GLU n 1 77 LEU n 1 78 GLY n 1 79 VAL n 1 80 ASP n 1 81 VAL n 1 82 ALA n 1 83 VAL n 1 84 GLY n 1 85 GLU n 1 86 ARG n 1 87 LEU n 1 88 GLY n 1 89 ALA n 1 90 ASP n 1 91 VAL n 1 92 ALA n 1 93 LEU n 1 94 ASN n 1 95 ASP n 1 96 ALA n 1 97 MET n 1 98 THR n 1 99 LEU n 1 100 ARG n 1 101 ALA n 1 102 TYR n 1 103 ARG n 1 104 VAL n 1 105 THR n 1 106 LEU n 1 107 ARG n 1 108 SER n 1 109 GLY n 1 110 SER n 1 111 PRO n 1 112 HIS n 1 113 PRO n 1 114 HIS n 1 115 ASP n 1 116 HIS n 1 117 ARG n 1 118 ALA n 1 119 LEU n 1 120 ARG n 1 121 TRP n 1 122 VAL n 1 123 GLY n 1 124 ALA n 1 125 ASP n 1 126 GLU n 1 127 ILE n 1 128 ASP n 1 129 GLY n 1 130 LEU n 1 131 ALA n 1 132 TRP n 1 133 VAL n 1 134 PRO n 1 135 ALA n 1 136 ASP n 1 137 ARG n 1 138 ALA n 1 139 TRP n 1 140 VAL n 1 141 PRO n 1 142 ASP n 1 143 LEU n 1 144 VAL n 1 145 ALA n 1 146 ALA n 1 147 LEU n 1 148 SER n 1 149 GLY n 1 150 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mutT2, MSMEI_5016' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084 / mc(2)155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I7FJF7_MYCS2 _struct_ref.pdbx_db_accession I7FJF7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTKQIVVAGALISRGTLLVAQRDRPAELAGLWELPGGKVTPGESDADALARELREELGVDVAVGERLGADVALNDAMTLR AYRVTLRSGSPHPHDHRALRWVGADEIDGLAWVPADRAWVPDLVAALSGR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ZRI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I7FJF7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZRI MET A 1 ? UNP I7FJF7 ? ? 'initiating methionine' -19 1 1 5ZRI GLY A 2 ? UNP I7FJF7 ? ? 'expression tag' -18 2 1 5ZRI SER A 3 ? UNP I7FJF7 ? ? 'expression tag' -17 3 1 5ZRI SER A 4 ? UNP I7FJF7 ? ? 'expression tag' -16 4 1 5ZRI HIS A 5 ? UNP I7FJF7 ? ? 'expression tag' -15 5 1 5ZRI HIS A 6 ? UNP I7FJF7 ? ? 'expression tag' -14 6 1 5ZRI HIS A 7 ? UNP I7FJF7 ? ? 'expression tag' -13 7 1 5ZRI HIS A 8 ? UNP I7FJF7 ? ? 'expression tag' -12 8 1 5ZRI HIS A 9 ? UNP I7FJF7 ? ? 'expression tag' -11 9 1 5ZRI HIS A 10 ? UNP I7FJF7 ? ? 'expression tag' -10 10 1 5ZRI SER A 11 ? UNP I7FJF7 ? ? 'expression tag' -9 11 1 5ZRI SER A 12 ? UNP I7FJF7 ? ? 'expression tag' -8 12 1 5ZRI GLY A 13 ? UNP I7FJF7 ? ? 'expression tag' -7 13 1 5ZRI LEU A 14 ? UNP I7FJF7 ? ? 'expression tag' -6 14 1 5ZRI VAL A 15 ? UNP I7FJF7 ? ? 'expression tag' -5 15 1 5ZRI PRO A 16 ? UNP I7FJF7 ? ? 'expression tag' -4 16 1 5ZRI ARG A 17 ? UNP I7FJF7 ? ? 'expression tag' -3 17 1 5ZRI GLY A 18 ? UNP I7FJF7 ? ? 'expression tag' -2 18 1 5ZRI SER A 19 ? UNP I7FJF7 ? ? 'expression tag' -1 19 1 5ZRI HIS A 20 ? UNP I7FJF7 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9L3 non-polymer . '[(2R,3S,5R)-5-(4-azanyl-5-methyl-pyrimidin-1-ium-1-yl)-3-oxidanyl-oxolan-2-yl]methyl dihydrogen phosphate' ? 'C10 H17 N3 O6 P 1' 306.232 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZRI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Imidazole pH 6.5, 1.0 M Sodium acetate trihydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.953720 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.953720 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ZRI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.58 _reflns.d_resolution_low 29.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17324 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.58 _reflns_shell.d_res_low 1.66 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2481 _reflns_shell.percent_possible_all 99.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.512 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.69 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -1.06 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.38 _refine.B_iso_max ? _refine.B_iso_mean 18.666 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZRI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.58 _refine.ls_d_res_low 29.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16415 _refine.ls_number_reflns_R_free 877 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.47 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17834 _refine.ls_R_factor_R_free 0.21116 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17669 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ZRC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.090 _refine.pdbx_overall_ESU_R_Free 0.091 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.927 _refine.overall_SU_ML 0.068 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 938 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 163 _refine_hist.number_atoms_total 1122 _refine_hist.d_res_high 1.58 _refine_hist.d_res_low 29.42 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.019 1037 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 996 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.836 1.986 1425 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.515 3.000 2273 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.075 5.000 136 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.448 21.778 45 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.371 15.000 156 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.382 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 160 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.017 0.021 1200 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 239 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.676 1.572 529 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.651 1.567 528 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.565 2.347 667 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.570 2.350 668 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.767 1.912 508 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.763 1.911 508 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.281 2.738 758 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.783 15.192 1277 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.566 14.163 1194 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.576 _refine_ls_shell.d_res_low 1.617 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 79 _refine_ls_shell.number_reflns_R_work 1153 _refine_ls_shell.percent_reflns_obs 98.17 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.262 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.308 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZRI _struct.title 'M. smegmatis antimutator protein MutT2 in complex with 5m-dCMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZRI _struct_keywords.text 'Nudix hydrolase, MutT, antimutator, CTP pyrophosphorylase, CMP, HYDROLASE, base excision repair' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 64 ? GLY A 78 ? SER A 44 GLY A 58 1 ? 15 HELX_P HELX_P2 AA2 GLY A 123 ? ILE A 127 ? GLY A 103 ILE A 107 5 ? 5 HELX_P HELX_P3 AA3 VAL A 133 ? ALA A 138 ? VAL A 113 ALA A 118 1 ? 6 HELX_P HELX_P4 AA4 TRP A 139 ? LEU A 147 ? TRP A 119 LEU A 127 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 56 O ? ? ? 1_555 C MG . MG ? ? A GLY 36 A MG 202 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc2 metalc ? ? A GLU 76 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 56 A MG 202 1_555 ? ? ? ? ? ? ? 2.193 ? ? metalc3 metalc ? ? B 9L3 . O3A ? ? ? 1_555 C MG . MG ? ? A 9L3 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 312 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 365 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 379 1_555 ? ? ? ? ? ? ? 2.269 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 44 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 24 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 45 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 25 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -16.80 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 3 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 56 ? LYS A 58 ? GLY A 36 LYS A 38 AA1 2 GLN A 24 ? SER A 33 ? GLN A 4 SER A 13 AA1 3 TRP A 52 ? GLU A 53 ? TRP A 32 GLU A 33 AA1 4 ALA A 118 ? VAL A 122 ? ALA A 98 VAL A 102 AA2 1 GLY A 56 ? LYS A 58 ? GLY A 36 LYS A 38 AA2 2 GLN A 24 ? SER A 33 ? GLN A 4 SER A 13 AA2 3 MET A 97 ? SER A 108 ? MET A 77 SER A 88 AA2 4 VAL A 91 ? ALA A 92 ? VAL A 71 ALA A 72 AA3 1 VAL A 91 ? ALA A 92 ? VAL A 71 ALA A 72 AA3 2 MET A 97 ? SER A 108 ? MET A 77 SER A 88 AA3 3 ASP A 80 ? ARG A 86 ? ASP A 60 ARG A 66 AA4 1 GLY A 56 ? LYS A 58 ? GLY A 36 LYS A 38 AA4 2 GLN A 24 ? SER A 33 ? GLN A 4 SER A 13 AA4 3 THR A 36 ? GLN A 41 ? THR A 16 GLN A 21 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 57 ? O GLY A 37 N VAL A 27 ? N VAL A 7 AA2 1 2 O GLY A 57 ? O GLY A 37 N VAL A 27 ? N VAL A 7 AA2 2 3 N VAL A 26 ? N VAL A 6 O THR A 98 ? O THR A 78 AA2 3 4 O LEU A 99 ? O LEU A 79 N VAL A 91 ? N VAL A 71 AA3 1 2 N VAL A 91 ? N VAL A 71 O LEU A 99 ? O LEU A 79 AA3 2 3 O ARG A 107 ? O ARG A 87 N ASP A 80 ? N ASP A 60 AA4 1 2 O GLY A 57 ? O GLY A 37 N VAL A 27 ? N VAL A 7 AA4 2 3 N LEU A 31 ? N LEU A 11 O LEU A 38 ? O LEU A 18 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 9L3 201 ? 13 'binding site for residue 9L3 A 201' AC2 Software A MG 202 ? 6 'binding site for residue MG A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ARG A 42 ? ARG A 22 . ? 1_555 ? 2 AC1 13 GLU A 53 ? GLU A 33 . ? 1_555 ? 3 AC1 13 LEU A 54 ? LEU A 34 . ? 1_555 ? 4 AC1 13 GLY A 56 ? GLY A 36 . ? 1_555 ? 5 AC1 13 LEU A 93 ? LEU A 73 . ? 1_555 ? 6 AC1 13 LEU A 99 ? LEU A 79 . ? 1_555 ? 7 AC1 13 ASP A 136 ? ASP A 116 . ? 1_555 ? 8 AC1 13 MG C . ? MG A 202 . ? 1_555 ? 9 AC1 13 HOH D . ? HOH A 303 . ? 1_555 ? 10 AC1 13 HOH D . ? HOH A 334 . ? 1_555 ? 11 AC1 13 HOH D . ? HOH A 365 . ? 1_555 ? 12 AC1 13 HOH D . ? HOH A 373 . ? 1_555 ? 13 AC1 13 HOH D . ? HOH A 379 . ? 1_555 ? 14 AC2 6 GLY A 56 ? GLY A 36 . ? 1_555 ? 15 AC2 6 GLU A 76 ? GLU A 56 . ? 1_555 ? 16 AC2 6 9L3 B . ? 9L3 A 201 . ? 1_555 ? 17 AC2 6 HOH D . ? HOH A 312 . ? 1_555 ? 18 AC2 6 HOH D . ? HOH A 365 . ? 1_555 ? 19 AC2 6 HOH D . ? HOH A 379 . ? 1_555 ? # _atom_sites.entry_id 5ZRI _atom_sites.fract_transf_matrix[1][1] 0.015263 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016995 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031898 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 THR 22 2 ? ? ? A . n A 1 23 LYS 23 3 3 LYS LYS A . n A 1 24 GLN 24 4 4 GLN GLN A . n A 1 25 ILE 25 5 5 ILE ILE A . n A 1 26 VAL 26 6 6 VAL VAL A . n A 1 27 VAL 27 7 7 VAL VAL A . n A 1 28 ALA 28 8 8 ALA ALA A . n A 1 29 GLY 29 9 9 GLY GLY A . n A 1 30 ALA 30 10 10 ALA ALA A . n A 1 31 LEU 31 11 11 LEU LEU A . n A 1 32 ILE 32 12 12 ILE ILE A . n A 1 33 SER 33 13 13 SER SER A . n A 1 34 ARG 34 14 14 ARG ARG A . n A 1 35 GLY 35 15 15 GLY GLY A . n A 1 36 THR 36 16 16 THR THR A . n A 1 37 LEU 37 17 17 LEU LEU A . n A 1 38 LEU 38 18 18 LEU LEU A . n A 1 39 VAL 39 19 19 VAL VAL A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 GLN 41 21 21 GLN GLN A . n A 1 42 ARG 42 22 22 ARG ARG A . n A 1 43 ASP 43 23 23 ASP ASP A . n A 1 44 ARG 44 24 24 ARG ARG A . n A 1 45 PRO 45 25 25 PRO PRO A . n A 1 46 ALA 46 26 26 ALA ALA A . n A 1 47 GLU 47 27 27 GLU GLU A . n A 1 48 LEU 48 28 28 LEU LEU A . n A 1 49 ALA 49 29 29 ALA ALA A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 LEU 51 31 31 LEU LEU A . n A 1 52 TRP 52 32 32 TRP TRP A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 LEU 54 34 34 LEU LEU A . n A 1 55 PRO 55 35 35 PRO PRO A . n A 1 56 GLY 56 36 36 GLY GLY A . n A 1 57 GLY 57 37 37 GLY GLY A . n A 1 58 LYS 58 38 38 LYS LYS A . n A 1 59 VAL 59 39 39 VAL VAL A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 PRO 61 41 41 PRO PRO A . n A 1 62 GLY 62 42 42 GLY GLY A . n A 1 63 GLU 63 43 43 GLU GLU A . n A 1 64 SER 64 44 44 SER SER A . n A 1 65 ASP 65 45 45 ASP ASP A . n A 1 66 ALA 66 46 46 ALA ALA A . n A 1 67 ASP 67 47 47 ASP ASP A . n A 1 68 ALA 68 48 48 ALA ALA A . n A 1 69 LEU 69 49 49 LEU LEU A . n A 1 70 ALA 70 50 50 ALA ALA A . n A 1 71 ARG 71 51 51 ARG ARG A . n A 1 72 GLU 72 52 52 GLU GLU A . n A 1 73 LEU 73 53 53 LEU LEU A . n A 1 74 ARG 74 54 54 ARG ARG A . n A 1 75 GLU 75 55 55 GLU GLU A . n A 1 76 GLU 76 56 56 GLU GLU A . n A 1 77 LEU 77 57 57 LEU LEU A . n A 1 78 GLY 78 58 58 GLY GLY A . n A 1 79 VAL 79 59 59 VAL VAL A . n A 1 80 ASP 80 60 60 ASP ASP A . n A 1 81 VAL 81 61 61 VAL VAL A . n A 1 82 ALA 82 62 62 ALA ALA A . n A 1 83 VAL 83 63 63 VAL VAL A . n A 1 84 GLY 84 64 64 GLY GLY A . n A 1 85 GLU 85 65 65 GLU GLU A . n A 1 86 ARG 86 66 66 ARG ARG A . n A 1 87 LEU 87 67 67 LEU LEU A . n A 1 88 GLY 88 68 68 GLY GLY A . n A 1 89 ALA 89 69 69 ALA ALA A . n A 1 90 ASP 90 70 70 ASP ASP A . n A 1 91 VAL 91 71 71 VAL VAL A . n A 1 92 ALA 92 72 72 ALA ALA A . n A 1 93 LEU 93 73 73 LEU LEU A . n A 1 94 ASN 94 74 74 ASN ASN A . n A 1 95 ASP 95 75 75 ASP ASP A . n A 1 96 ALA 96 76 76 ALA ALA A . n A 1 97 MET 97 77 77 MET MET A . n A 1 98 THR 98 78 78 THR THR A . n A 1 99 LEU 99 79 79 LEU LEU A . n A 1 100 ARG 100 80 80 ARG ARG A . n A 1 101 ALA 101 81 81 ALA ALA A . n A 1 102 TYR 102 82 82 TYR TYR A . n A 1 103 ARG 103 83 83 ARG ARG A . n A 1 104 VAL 104 84 84 VAL VAL A . n A 1 105 THR 105 85 85 THR THR A . n A 1 106 LEU 106 86 86 LEU LEU A . n A 1 107 ARG 107 87 87 ARG ARG A . n A 1 108 SER 108 88 88 SER SER A . n A 1 109 GLY 109 89 89 GLY GLY A . n A 1 110 SER 110 90 90 SER SER A . n A 1 111 PRO 111 91 91 PRO PRO A . n A 1 112 HIS 112 92 92 HIS HIS A . n A 1 113 PRO 113 93 93 PRO PRO A . n A 1 114 HIS 114 94 94 HIS HIS A . n A 1 115 ASP 115 95 95 ASP ASP A . n A 1 116 HIS 116 96 96 HIS HIS A . n A 1 117 ARG 117 97 97 ARG ARG A . n A 1 118 ALA 118 98 98 ALA ALA A . n A 1 119 LEU 119 99 99 LEU LEU A . n A 1 120 ARG 120 100 100 ARG ARG A . n A 1 121 TRP 121 101 101 TRP TRP A . n A 1 122 VAL 122 102 102 VAL VAL A . n A 1 123 GLY 123 103 103 GLY GLY A . n A 1 124 ALA 124 104 104 ALA ALA A . n A 1 125 ASP 125 105 105 ASP ASP A . n A 1 126 GLU 126 106 106 GLU GLU A . n A 1 127 ILE 127 107 107 ILE ILE A . n A 1 128 ASP 128 108 108 ASP ASP A . n A 1 129 GLY 129 109 109 GLY GLY A . n A 1 130 LEU 130 110 110 LEU LEU A . n A 1 131 ALA 131 111 111 ALA ALA A . n A 1 132 TRP 132 112 112 TRP TRP A . n A 1 133 VAL 133 113 113 VAL VAL A . n A 1 134 PRO 134 114 114 PRO PRO A . n A 1 135 ALA 135 115 115 ALA ALA A . n A 1 136 ASP 136 116 116 ASP ASP A . n A 1 137 ARG 137 117 117 ARG ARG A . n A 1 138 ALA 138 118 118 ALA ALA A . n A 1 139 TRP 139 119 119 TRP TRP A . n A 1 140 VAL 140 120 120 VAL VAL A . n A 1 141 PRO 141 121 121 PRO PRO A . n A 1 142 ASP 142 122 122 ASP ASP A . n A 1 143 LEU 143 123 123 LEU LEU A . n A 1 144 VAL 144 124 124 VAL VAL A . n A 1 145 ALA 145 125 125 ALA ALA A . n A 1 146 ALA 146 126 126 ALA ALA A . n A 1 147 LEU 147 127 127 LEU LEU A . n A 1 148 SER 148 128 128 SER SER A . n A 1 149 GLY 149 129 ? ? ? A . n A 1 150 ARG 150 130 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 9L3 1 201 1 9L3 523 A . C 3 MG 1 202 1 MG MG A . D 4 HOH 1 301 138 HOH HOH A . D 4 HOH 2 302 72 HOH HOH A . D 4 HOH 3 303 56 HOH HOH A . D 4 HOH 4 304 165 HOH HOH A . D 4 HOH 5 305 88 HOH HOH A . D 4 HOH 6 306 50 HOH HOH A . D 4 HOH 7 307 185 HOH HOH A . D 4 HOH 8 308 45 HOH HOH A . D 4 HOH 9 309 12 HOH HOH A . D 4 HOH 10 310 110 HOH HOH A . D 4 HOH 11 311 145 HOH HOH A . D 4 HOH 12 312 26 HOH HOH A . D 4 HOH 13 313 79 HOH HOH A . D 4 HOH 14 314 49 HOH HOH A . D 4 HOH 15 315 52 HOH HOH A . D 4 HOH 16 316 22 HOH HOH A . D 4 HOH 17 317 97 HOH HOH A . D 4 HOH 18 318 42 HOH HOH A . D 4 HOH 19 319 190 HOH HOH A . D 4 HOH 20 320 34 HOH HOH A . D 4 HOH 21 321 114 HOH HOH A . D 4 HOH 22 322 47 HOH HOH A . D 4 HOH 23 323 30 HOH HOH A . D 4 HOH 24 324 55 HOH HOH A . D 4 HOH 25 325 13 HOH HOH A . D 4 HOH 26 326 92 HOH HOH A . D 4 HOH 27 327 64 HOH HOH A . D 4 HOH 28 328 101 HOH HOH A . D 4 HOH 29 329 14 HOH HOH A . D 4 HOH 30 330 140 HOH HOH A . D 4 HOH 31 331 51 HOH HOH A . D 4 HOH 32 332 182 HOH HOH A . D 4 HOH 33 333 37 HOH HOH A . D 4 HOH 34 334 107 HOH HOH A . D 4 HOH 35 335 31 HOH HOH A . D 4 HOH 36 336 169 HOH HOH A . D 4 HOH 37 337 57 HOH HOH A . D 4 HOH 38 338 11 HOH HOH A . D 4 HOH 39 339 87 HOH HOH A . D 4 HOH 40 340 35 HOH HOH A . D 4 HOH 41 341 70 HOH HOH A . D 4 HOH 42 342 94 HOH HOH A . D 4 HOH 43 343 43 HOH HOH A . D 4 HOH 44 344 28 HOH HOH A . D 4 HOH 45 345 109 HOH HOH A . D 4 HOH 46 346 8 HOH HOH A . D 4 HOH 47 347 102 HOH HOH A . D 4 HOH 48 348 188 HOH HOH A . D 4 HOH 49 349 179 HOH HOH A . D 4 HOH 50 350 27 HOH HOH A . D 4 HOH 51 351 175 HOH HOH A . D 4 HOH 52 352 29 HOH HOH A . D 4 HOH 53 353 168 HOH HOH A . D 4 HOH 54 354 166 HOH HOH A . D 4 HOH 55 355 93 HOH HOH A . D 4 HOH 56 356 124 HOH HOH A . D 4 HOH 57 357 60 HOH HOH A . D 4 HOH 58 358 25 HOH HOH A . D 4 HOH 59 359 63 HOH HOH A . D 4 HOH 60 360 48 HOH HOH A . D 4 HOH 61 361 184 HOH HOH A . D 4 HOH 62 362 186 HOH HOH A . D 4 HOH 63 363 21 HOH HOH A . D 4 HOH 64 364 100 HOH HOH A . D 4 HOH 65 365 68 HOH HOH A . D 4 HOH 66 366 4 HOH HOH A . D 4 HOH 67 367 76 HOH HOH A . D 4 HOH 68 368 65 HOH HOH A . D 4 HOH 69 369 187 HOH HOH A . D 4 HOH 70 370 157 HOH HOH A . D 4 HOH 71 371 53 HOH HOH A . D 4 HOH 72 372 7 HOH HOH A . D 4 HOH 73 373 121 HOH HOH A . D 4 HOH 74 374 159 HOH HOH A . D 4 HOH 75 375 33 HOH HOH A . D 4 HOH 76 376 74 HOH HOH A . D 4 HOH 77 377 69 HOH HOH A . D 4 HOH 78 378 16 HOH HOH A . D 4 HOH 79 379 139 HOH HOH A . D 4 HOH 80 380 170 HOH HOH A . D 4 HOH 81 381 20 HOH HOH A . D 4 HOH 82 382 146 HOH HOH A . D 4 HOH 83 383 99 HOH HOH A . D 4 HOH 84 384 39 HOH HOH A . D 4 HOH 85 385 183 HOH HOH A . D 4 HOH 86 386 59 HOH HOH A . D 4 HOH 87 387 19 HOH HOH A . D 4 HOH 88 388 41 HOH HOH A . D 4 HOH 89 389 44 HOH HOH A . D 4 HOH 90 390 164 HOH HOH A . D 4 HOH 91 391 148 HOH HOH A . D 4 HOH 92 392 66 HOH HOH A . D 4 HOH 93 393 122 HOH HOH A . D 4 HOH 94 394 112 HOH HOH A . D 4 HOH 95 395 77 HOH HOH A . D 4 HOH 96 396 32 HOH HOH A . D 4 HOH 97 397 154 HOH HOH A . D 4 HOH 98 398 82 HOH HOH A . D 4 HOH 99 399 126 HOH HOH A . D 4 HOH 100 400 91 HOH HOH A . D 4 HOH 101 401 9 HOH HOH A . D 4 HOH 102 402 119 HOH HOH A . D 4 HOH 103 403 61 HOH HOH A . D 4 HOH 104 404 151 HOH HOH A . D 4 HOH 105 405 156 HOH HOH A . D 4 HOH 106 406 173 HOH HOH A . D 4 HOH 107 407 167 HOH HOH A . D 4 HOH 108 408 143 HOH HOH A . D 4 HOH 109 409 23 HOH HOH A . D 4 HOH 110 410 40 HOH HOH A . D 4 HOH 111 411 75 HOH HOH A . D 4 HOH 112 412 171 HOH HOH A . D 4 HOH 113 413 46 HOH HOH A . D 4 HOH 114 414 54 HOH HOH A . D 4 HOH 115 415 81 HOH HOH A . D 4 HOH 116 416 116 HOH HOH A . D 4 HOH 117 417 130 HOH HOH A . D 4 HOH 118 418 73 HOH HOH A . D 4 HOH 119 419 3 HOH HOH A . D 4 HOH 120 420 58 HOH HOH A . D 4 HOH 121 421 83 HOH HOH A . D 4 HOH 122 422 85 HOH HOH A . D 4 HOH 123 423 95 HOH HOH A . D 4 HOH 124 424 153 HOH HOH A . D 4 HOH 125 425 120 HOH HOH A . D 4 HOH 126 426 80 HOH HOH A . D 4 HOH 127 427 125 HOH HOH A . D 4 HOH 128 428 103 HOH HOH A . D 4 HOH 129 429 191 HOH HOH A . D 4 HOH 130 430 160 HOH HOH A . D 4 HOH 131 431 71 HOH HOH A . D 4 HOH 132 432 144 HOH HOH A . D 4 HOH 133 433 133 HOH HOH A . D 4 HOH 134 434 131 HOH HOH A . D 4 HOH 135 435 132 HOH HOH A . D 4 HOH 136 436 142 HOH HOH A . D 4 HOH 137 437 161 HOH HOH A . D 4 HOH 138 438 176 HOH HOH A . D 4 HOH 139 439 135 HOH HOH A . D 4 HOH 140 440 86 HOH HOH A . D 4 HOH 141 441 5 HOH HOH A . D 4 HOH 142 442 36 HOH HOH A . D 4 HOH 143 443 178 HOH HOH A . D 4 HOH 144 444 181 HOH HOH A . D 4 HOH 145 445 111 HOH HOH A . D 4 HOH 146 446 134 HOH HOH A . D 4 HOH 147 447 108 HOH HOH A . D 4 HOH 148 448 149 HOH HOH A . D 4 HOH 149 449 136 HOH HOH A . D 4 HOH 150 450 172 HOH HOH A . D 4 HOH 151 451 180 HOH HOH A . D 4 HOH 152 452 18 HOH HOH A . D 4 HOH 153 453 123 HOH HOH A . D 4 HOH 154 454 78 HOH HOH A . D 4 HOH 155 455 118 HOH HOH A . D 4 HOH 156 456 163 HOH HOH A . D 4 HOH 157 457 117 HOH HOH A . D 4 HOH 158 458 113 HOH HOH A . D 4 HOH 159 459 158 HOH HOH A . D 4 HOH 160 460 104 HOH HOH A . D 4 HOH 161 461 106 HOH HOH A . D 4 HOH 162 462 147 HOH HOH A . D 4 HOH 163 463 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -9 ? 1 'SSA (A^2)' 6280 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 459 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 56 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OE2 ? A GLU 76 ? A GLU 56 ? 1_555 88.9 ? 2 O ? A GLY 56 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O3A ? B 9L3 . ? A 9L3 201 ? 1_555 106.6 ? 3 OE2 ? A GLU 76 ? A GLU 56 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O3A ? B 9L3 . ? A 9L3 201 ? 1_555 163.4 ? 4 O ? A GLY 56 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 312 ? 1_555 74.8 ? 5 OE2 ? A GLU 76 ? A GLU 56 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 312 ? 1_555 82.6 ? 6 O3A ? B 9L3 . ? A 9L3 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 312 ? 1_555 106.9 ? 7 O ? A GLY 56 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 365 ? 1_555 168.5 ? 8 OE2 ? A GLU 76 ? A GLU 56 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 365 ? 1_555 79.7 ? 9 O3A ? B 9L3 . ? A 9L3 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 365 ? 1_555 84.7 ? 10 O ? D HOH . ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 365 ? 1_555 104.5 ? 11 O ? A GLY 56 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 379 ? 1_555 87.2 ? 12 OE2 ? A GLU 76 ? A GLU 56 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 379 ? 1_555 86.3 ? 13 O3A ? B 9L3 . ? A 9L3 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 379 ? 1_555 88.4 ? 14 O ? D HOH . ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 379 ? 1_555 159.0 ? 15 O ? D HOH . ? A HOH 365 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 379 ? 1_555 90.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-24 2 'Structure model' 1 1 2019-11-06 3 'Structure model' 1 2 2022-03-23 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.value' 19 3 'Structure model' '_struct_conn.pdbx_dist_value' 20 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PRO _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 25 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -68.26 _pdbx_validate_torsion.psi -170.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CE ? A LYS 23 CE 2 1 Y 1 A LYS 3 ? NZ ? A LYS 23 NZ 3 1 Y 1 A ARG 24 ? CZ ? A ARG 44 CZ 4 1 Y 1 A ARG 24 ? NH1 ? A ARG 44 NH1 5 1 Y 1 A ARG 24 ? NH2 ? A ARG 44 NH2 6 1 Y 1 A LYS 38 ? CE ? A LYS 58 CE 7 1 Y 1 A LYS 38 ? NZ ? A LYS 58 NZ 8 1 Y 1 A ASP 75 ? CG ? A ASP 95 CG 9 1 Y 1 A ASP 75 ? OD1 ? A ASP 95 OD1 10 1 Y 1 A ASP 75 ? OD2 ? A ASP 95 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A THR 2 ? A THR 22 23 1 Y 1 A GLY 129 ? A GLY 149 24 1 Y 1 A ARG 130 ? A ARG 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9L3 N1 N Y N 1 9L3 C2 C Y N 2 9L3 N3 N Y N 3 9L3 C4 C Y N 4 9L3 C5 C Y N 5 9L3 C5A C N N 6 9L3 C6 C Y N 7 9L3 N4 N N N 8 9L3 "C1'" C N R 9 9L3 "C2'" C N N 10 9L3 "C3'" C N S 11 9L3 "C4'" C N R 12 9L3 "O4'" O N N 13 9L3 "O3'" O N N 14 9L3 "C5'" C N N 15 9L3 "O5'" O N N 16 9L3 PA P N N 17 9L3 O1A O N N 18 9L3 O2A O N N 19 9L3 O3A O N N 20 9L3 H1 H N N 21 9L3 H2 H N N 22 9L3 H3 H N N 23 9L3 H4 H N N 24 9L3 H5 H N N 25 9L3 H6 H N N 26 9L3 H7 H N N 27 9L3 H8 H N N 28 9L3 H9 H N N 29 9L3 H10 H N N 30 9L3 H11 H N N 31 9L3 H12 H N N 32 9L3 H13 H N N 33 9L3 H14 H N N 34 9L3 H15 H N N 35 9L3 H16 H N N 36 9L3 H17 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 HIS N N N N 160 HIS CA C N S 161 HIS C C N N 162 HIS O O N N 163 HIS CB C N N 164 HIS CG C Y N 165 HIS ND1 N Y N 166 HIS CD2 C Y N 167 HIS CE1 C Y N 168 HIS NE2 N Y N 169 HIS OXT O N N 170 HIS H H N N 171 HIS H2 H N N 172 HIS HA H N N 173 HIS HB2 H N N 174 HIS HB3 H N N 175 HIS HD1 H N N 176 HIS HD2 H N N 177 HIS HE1 H N N 178 HIS HE2 H N N 179 HIS HXT H N N 180 HOH O O N N 181 HOH H1 H N N 182 HOH H2 H N N 183 ILE N N N N 184 ILE CA C N S 185 ILE C C N N 186 ILE O O N N 187 ILE CB C N S 188 ILE CG1 C N N 189 ILE CG2 C N N 190 ILE CD1 C N N 191 ILE OXT O N N 192 ILE H H N N 193 ILE H2 H N N 194 ILE HA H N N 195 ILE HB H N N 196 ILE HG12 H N N 197 ILE HG13 H N N 198 ILE HG21 H N N 199 ILE HG22 H N N 200 ILE HG23 H N N 201 ILE HD11 H N N 202 ILE HD12 H N N 203 ILE HD13 H N N 204 ILE HXT H N N 205 LEU N N N N 206 LEU CA C N S 207 LEU C C N N 208 LEU O O N N 209 LEU CB C N N 210 LEU CG C N N 211 LEU CD1 C N N 212 LEU CD2 C N N 213 LEU OXT O N N 214 LEU H H N N 215 LEU H2 H N N 216 LEU HA H N N 217 LEU HB2 H N N 218 LEU HB3 H N N 219 LEU HG H N N 220 LEU HD11 H N N 221 LEU HD12 H N N 222 LEU HD13 H N N 223 LEU HD21 H N N 224 LEU HD22 H N N 225 LEU HD23 H N N 226 LEU HXT H N N 227 LYS N N N N 228 LYS CA C N S 229 LYS C C N N 230 LYS O O N N 231 LYS CB C N N 232 LYS CG C N N 233 LYS CD C N N 234 LYS CE C N N 235 LYS NZ N N N 236 LYS OXT O N N 237 LYS H H N N 238 LYS H2 H N N 239 LYS HA H N N 240 LYS HB2 H N N 241 LYS HB3 H N N 242 LYS HG2 H N N 243 LYS HG3 H N N 244 LYS HD2 H N N 245 LYS HD3 H N N 246 LYS HE2 H N N 247 LYS HE3 H N N 248 LYS HZ1 H N N 249 LYS HZ2 H N N 250 LYS HZ3 H N N 251 LYS HXT H N N 252 MET N N N N 253 MET CA C N S 254 MET C C N N 255 MET O O N N 256 MET CB C N N 257 MET CG C N N 258 MET SD S N N 259 MET CE C N N 260 MET OXT O N N 261 MET H H N N 262 MET H2 H N N 263 MET HA H N N 264 MET HB2 H N N 265 MET HB3 H N N 266 MET HG2 H N N 267 MET HG3 H N N 268 MET HE1 H N N 269 MET HE2 H N N 270 MET HE3 H N N 271 MET HXT H N N 272 MG MG MG N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9L3 O2A PA doub N N 1 9L3 O3A PA sing N N 2 9L3 PA O1A sing N N 3 9L3 PA "O5'" sing N N 4 9L3 "O5'" "C5'" sing N N 5 9L3 "C5'" "C4'" sing N N 6 9L3 C5A C5 sing N N 7 9L3 "C4'" "C3'" sing N N 8 9L3 "C4'" "O4'" sing N N 9 9L3 C5 C6 doub Y N 10 9L3 C5 C4 sing Y N 11 9L3 C6 N1 sing Y N 12 9L3 "C3'" "C2'" sing N N 13 9L3 "C3'" "O3'" sing N N 14 9L3 "O4'" "C1'" sing N N 15 9L3 "C2'" "C1'" sing N N 16 9L3 N4 C4 sing N N 17 9L3 C4 N3 doub Y N 18 9L3 N1 "C1'" sing N N 19 9L3 N1 C2 doub Y N 20 9L3 N3 C2 sing Y N 21 9L3 C2 H1 sing N N 22 9L3 C5A H2 sing N N 23 9L3 C5A H3 sing N N 24 9L3 C5A H4 sing N N 25 9L3 C6 H5 sing N N 26 9L3 N4 H6 sing N N 27 9L3 N4 H7 sing N N 28 9L3 "C1'" H8 sing N N 29 9L3 "C2'" H9 sing N N 30 9L3 "C2'" H10 sing N N 31 9L3 "C3'" H11 sing N N 32 9L3 "C4'" H12 sing N N 33 9L3 "O3'" H13 sing N N 34 9L3 "C5'" H14 sing N N 35 9L3 "C5'" H15 sing N N 36 9L3 O1A H16 sing N N 37 9L3 O3A H17 sing N N 38 ALA N CA sing N N 39 ALA N H sing N N 40 ALA N H2 sing N N 41 ALA CA C sing N N 42 ALA CA CB sing N N 43 ALA CA HA sing N N 44 ALA C O doub N N 45 ALA C OXT sing N N 46 ALA CB HB1 sing N N 47 ALA CB HB2 sing N N 48 ALA CB HB3 sing N N 49 ALA OXT HXT sing N N 50 ARG N CA sing N N 51 ARG N H sing N N 52 ARG N H2 sing N N 53 ARG CA C sing N N 54 ARG CA CB sing N N 55 ARG CA HA sing N N 56 ARG C O doub N N 57 ARG C OXT sing N N 58 ARG CB CG sing N N 59 ARG CB HB2 sing N N 60 ARG CB HB3 sing N N 61 ARG CG CD sing N N 62 ARG CG HG2 sing N N 63 ARG CG HG3 sing N N 64 ARG CD NE sing N N 65 ARG CD HD2 sing N N 66 ARG CD HD3 sing N N 67 ARG NE CZ sing N N 68 ARG NE HE sing N N 69 ARG CZ NH1 sing N N 70 ARG CZ NH2 doub N N 71 ARG NH1 HH11 sing N N 72 ARG NH1 HH12 sing N N 73 ARG NH2 HH21 sing N N 74 ARG NH2 HH22 sing N N 75 ARG OXT HXT sing N N 76 ASN N CA sing N N 77 ASN N H sing N N 78 ASN N H2 sing N N 79 ASN CA C sing N N 80 ASN CA CB sing N N 81 ASN CA HA sing N N 82 ASN C O doub N N 83 ASN C OXT sing N N 84 ASN CB CG sing N N 85 ASN CB HB2 sing N N 86 ASN CB HB3 sing N N 87 ASN CG OD1 doub N N 88 ASN CG ND2 sing N N 89 ASN ND2 HD21 sing N N 90 ASN ND2 HD22 sing N N 91 ASN OXT HXT sing N N 92 ASP N CA sing N N 93 ASP N H sing N N 94 ASP N H2 sing N N 95 ASP CA C sing N N 96 ASP CA CB sing N N 97 ASP CA HA sing N N 98 ASP C O doub N N 99 ASP C OXT sing N N 100 ASP CB CG sing N N 101 ASP CB HB2 sing N N 102 ASP CB HB3 sing N N 103 ASP CG OD1 doub N N 104 ASP CG OD2 sing N N 105 ASP OD2 HD2 sing N N 106 ASP OXT HXT sing N N 107 GLN N CA sing N N 108 GLN N H sing N N 109 GLN N H2 sing N N 110 GLN CA C sing N N 111 GLN CA CB sing N N 112 GLN CA HA sing N N 113 GLN C O doub N N 114 GLN C OXT sing N N 115 GLN CB CG sing N N 116 GLN CB HB2 sing N N 117 GLN CB HB3 sing N N 118 GLN CG CD sing N N 119 GLN CG HG2 sing N N 120 GLN CG HG3 sing N N 121 GLN CD OE1 doub N N 122 GLN CD NE2 sing N N 123 GLN NE2 HE21 sing N N 124 GLN NE2 HE22 sing N N 125 GLN OXT HXT sing N N 126 GLU N CA sing N N 127 GLU N H sing N N 128 GLU N H2 sing N N 129 GLU CA C sing N N 130 GLU CA CB sing N N 131 GLU CA HA sing N N 132 GLU C O doub N N 133 GLU C OXT sing N N 134 GLU CB CG sing N N 135 GLU CB HB2 sing N N 136 GLU CB HB3 sing N N 137 GLU CG CD sing N N 138 GLU CG HG2 sing N N 139 GLU CG HG3 sing N N 140 GLU CD OE1 doub N N 141 GLU CD OE2 sing N N 142 GLU OE2 HE2 sing N N 143 GLU OXT HXT sing N N 144 GLY N CA sing N N 145 GLY N H sing N N 146 GLY N H2 sing N N 147 GLY CA C sing N N 148 GLY CA HA2 sing N N 149 GLY CA HA3 sing N N 150 GLY C O doub N N 151 GLY C OXT sing N N 152 GLY OXT HXT sing N N 153 HIS N CA sing N N 154 HIS N H sing N N 155 HIS N H2 sing N N 156 HIS CA C sing N N 157 HIS CA CB sing N N 158 HIS CA HA sing N N 159 HIS C O doub N N 160 HIS C OXT sing N N 161 HIS CB CG sing N N 162 HIS CB HB2 sing N N 163 HIS CB HB3 sing N N 164 HIS CG ND1 sing Y N 165 HIS CG CD2 doub Y N 166 HIS ND1 CE1 doub Y N 167 HIS ND1 HD1 sing N N 168 HIS CD2 NE2 sing Y N 169 HIS CD2 HD2 sing N N 170 HIS CE1 NE2 sing Y N 171 HIS CE1 HE1 sing N N 172 HIS NE2 HE2 sing N N 173 HIS OXT HXT sing N N 174 HOH O H1 sing N N 175 HOH O H2 sing N N 176 ILE N CA sing N N 177 ILE N H sing N N 178 ILE N H2 sing N N 179 ILE CA C sing N N 180 ILE CA CB sing N N 181 ILE CA HA sing N N 182 ILE C O doub N N 183 ILE C OXT sing N N 184 ILE CB CG1 sing N N 185 ILE CB CG2 sing N N 186 ILE CB HB sing N N 187 ILE CG1 CD1 sing N N 188 ILE CG1 HG12 sing N N 189 ILE CG1 HG13 sing N N 190 ILE CG2 HG21 sing N N 191 ILE CG2 HG22 sing N N 192 ILE CG2 HG23 sing N N 193 ILE CD1 HD11 sing N N 194 ILE CD1 HD12 sing N N 195 ILE CD1 HD13 sing N N 196 ILE OXT HXT sing N N 197 LEU N CA sing N N 198 LEU N H sing N N 199 LEU N H2 sing N N 200 LEU CA C sing N N 201 LEU CA CB sing N N 202 LEU CA HA sing N N 203 LEU C O doub N N 204 LEU C OXT sing N N 205 LEU CB CG sing N N 206 LEU CB HB2 sing N N 207 LEU CB HB3 sing N N 208 LEU CG CD1 sing N N 209 LEU CG CD2 sing N N 210 LEU CG HG sing N N 211 LEU CD1 HD11 sing N N 212 LEU CD1 HD12 sing N N 213 LEU CD1 HD13 sing N N 214 LEU CD2 HD21 sing N N 215 LEU CD2 HD22 sing N N 216 LEU CD2 HD23 sing N N 217 LEU OXT HXT sing N N 218 LYS N CA sing N N 219 LYS N H sing N N 220 LYS N H2 sing N N 221 LYS CA C sing N N 222 LYS CA CB sing N N 223 LYS CA HA sing N N 224 LYS C O doub N N 225 LYS C OXT sing N N 226 LYS CB CG sing N N 227 LYS CB HB2 sing N N 228 LYS CB HB3 sing N N 229 LYS CG CD sing N N 230 LYS CG HG2 sing N N 231 LYS CG HG3 sing N N 232 LYS CD CE sing N N 233 LYS CD HD2 sing N N 234 LYS CD HD3 sing N N 235 LYS CE NZ sing N N 236 LYS CE HE2 sing N N 237 LYS CE HE3 sing N N 238 LYS NZ HZ1 sing N N 239 LYS NZ HZ2 sing N N 240 LYS NZ HZ3 sing N N 241 LYS OXT HXT sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 9L3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 9L3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[(2R,3S,5R)-5-(4-azanyl-5-methyl-pyrimidin-1-ium-1-yl)-3-oxidanyl-oxolan-2-yl]methyl dihydrogen phosphate' 9L3 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ZRC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #