data_5ZVK # _entry.id 5ZVK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ZVK pdb_00005zvk 10.2210/pdb5zvk/pdb WWPDB D_1300007721 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5zuv contains the same peptide complexed with 229E HR1 motif' _pdbx_database_related.db_id 5zuv _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ZVK _pdbx_database_status.recvd_initial_deposition_date 2018-05-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, L.' 1 ? 'Yang, B.' 2 0000-0001-5389-3859 'Wilson, I.A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first eaav4580 _citation.page_last eaav4580 _citation.title 'A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.aav4580 _citation.pdbx_database_id_PubMed 30989115 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xia, S.' 1 0000-0001-7896-4182 primary 'Yan, L.' 2 0000-0003-1775-5533 primary 'Xu, W.' 3 0000-0003-3013-7182 primary 'Agrawal, A.S.' 4 ? primary 'Algaissi, A.' 5 ? primary 'Tseng, C.K.' 6 ? primary 'Wang, Q.' 7 ? primary 'Du, L.' 8 ? primary 'Tan, W.' 9 ? primary 'Wilson, I.A.' 10 0000-0002-6469-2419 primary 'Jiang, S.' 11 0000-0003-1493-6523 primary 'Yang, B.' 12 0000-0001-5389-3859 primary 'Lu, L.' 13 0000-0002-2255-0391 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5ZVK _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.280 _cell.length_a_esd ? _cell.length_b 60.280 _cell.length_b_esd ? _cell.length_c 175.228 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ZVK _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Human Coronavirus MERS HR1 motif' 8561.517 3 ? ? 'UNP residues 984-1062' ? 2 polymer man 'pan-CoV inhibitory peptide EK1' 4923.550 3 ? ? ? 'The manually designed EK1 inhibitor was modified from a Coronavirus sequence (UNP P36334 SPIKE_CVHOC, UNP residues 1252-1288).' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no SGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLE SGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLE A,B,C ? 2 'polypeptide(L)' no no SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG a,b,c ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ILE n 1 4 THR n 1 5 GLN n 1 6 GLN n 1 7 VAL n 1 8 LEU n 1 9 SER n 1 10 GLU n 1 11 ASN n 1 12 GLN n 1 13 LYS n 1 14 LEU n 1 15 ILE n 1 16 ALA n 1 17 ASN n 1 18 LYS n 1 19 PHE n 1 20 ASN n 1 21 GLN n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 ALA n 1 26 MET n 1 27 GLN n 1 28 THR n 1 29 GLY n 1 30 PHE n 1 31 THR n 1 32 THR n 1 33 THR n 1 34 ASN n 1 35 GLU n 1 36 ALA n 1 37 PHE n 1 38 ARG n 1 39 LYS n 1 40 VAL n 1 41 GLN n 1 42 ASP n 1 43 ALA n 1 44 VAL n 1 45 ASN n 1 46 ASN n 1 47 ASN n 1 48 ALA n 1 49 GLN n 1 50 ALA n 1 51 LEU n 1 52 SER n 1 53 LYS n 1 54 LEU n 1 55 ALA n 1 56 SER n 1 57 GLU n 1 58 LEU n 1 59 SER n 1 60 ASN n 1 61 THR n 1 62 PHE n 1 63 GLY n 1 64 ALA n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 ILE n 1 70 GLY n 1 71 ASP n 1 72 ILE n 1 73 ILE n 1 74 GLN n 1 75 ARG n 1 76 LEU n 1 77 ASP n 1 78 VAL n 1 79 LEU n 1 80 GLU n 2 1 SER n 2 2 GLY n 2 3 GLY n 2 4 ARG n 2 5 GLY n 2 6 GLY n 2 7 SER n 2 8 LEU n 2 9 ASP n 2 10 GLN n 2 11 ILE n 2 12 ASN n 2 13 VAL n 2 14 THR n 2 15 PHE n 2 16 LEU n 2 17 ASP n 2 18 LEU n 2 19 GLU n 2 20 TYR n 2 21 GLU n 2 22 MET n 2 23 LYS n 2 24 LYS n 2 25 LEU n 2 26 GLU n 2 27 GLU n 2 28 ALA n 2 29 ILE n 2 30 LYS n 2 31 LYS n 2 32 LEU n 2 33 GLU n 2 34 GLU n 2 35 SER n 2 36 TYR n 2 37 ILE n 2 38 ASP n 2 39 LEU n 2 40 LYS n 2 41 GLU n 2 42 LEU n 2 43 GLY n 2 44 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 80 'MERS coronavirus, MERS-CoV' ? ? ? ? ? ? ? ? 'Middle East respiratory syndrome-related coronavirus' 1335626 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP W6A0A7_9BETC W6A0A7 ? 1 GITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLE 984 2 PDB 5ZVK 5ZVK ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ZVK A 2 ? 80 ? W6A0A7 984 ? 1062 ? 984 1062 2 1 5ZVK B 2 ? 80 ? W6A0A7 984 ? 1062 ? 984 1062 3 1 5ZVK C 2 ? 80 ? W6A0A7 984 ? 1062 ? 984 1062 4 2 5ZVK a 1 ? 44 ? 5ZVK 1 ? 44 ? 1 44 5 2 5ZVK b 1 ? 44 ? 5ZVK 1 ? 44 ? 1 44 6 2 5ZVK c 1 ? 44 ? 5ZVK 1 ? 44 ? 1 44 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ZVK SER A 1 ? UNP W6A0A7 ? ? 'expression tag' 983 1 2 5ZVK SER B 1 ? UNP W6A0A7 ? ? 'expression tag' 983 2 3 5ZVK SER C 1 ? UNP W6A0A7 ? ? 'expression tag' 983 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ZVK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M KSCN, pH 7.0, 20% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 109 _reflns.entry_id 5ZVK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.31 _reflns.d_resolution_low 25.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6009 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.122 _reflns.pdbx_Rpim_I_all 0.036 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.897 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.31 _reflns_shell.d_res_low 3.43 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 564 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.775 _reflns_shell.pdbx_Rpim_I_all 0.324 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ZVK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.31 _refine.ls_d_res_low 25.8 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5953 _refine.ls_number_reflns_R_free 339 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.85 _refine.ls_percent_reflns_R_free 5.69 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2622 _refine.ls_R_factor_R_free 0.3136 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2590 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4mod _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.17 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.44 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2341 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2341 _refine_hist.d_res_high 3.31 _refine_hist.d_res_low 25.8 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2356 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.552 ? 3163 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.396 ? 1456 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.036 ? 378 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 408 ? f_plane_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.31 _refine_ls_shell.d_res_low 3.43 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.318 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.34 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5ZVK _struct.title 'Crystal Structure of the Human Coronavirus MERS HR1 motif in complex with pan-CoVs inhibitor EK1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ZVK _struct_keywords.text 'MERS, Spike protein, S2 domain, HR1 motif, pan-Coronavirus, VIRAL PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? ILE A 73 ? THR A 986 ILE A 1055 1 ? 70 HELX_P HELX_P2 AA2 GLN B 5 ? ILE B 73 ? GLN B 987 ILE B 1055 1 ? 69 HELX_P HELX_P3 AA3 GLN C 5 ? ASP C 71 ? GLN C 987 ASP C 1053 1 ? 67 HELX_P HELX_P4 AA4 LEU D 18 ? GLU D 34 ? LEU a 18 GLU a 34 1 ? 17 HELX_P HELX_P5 AA5 LEU E 18 ? GLU E 34 ? LEU b 18 GLU b 34 1 ? 17 HELX_P HELX_P6 AA6 LEU F 18 ? GLU F 34 ? LEU c 18 GLU c 34 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5ZVK _atom_sites.fract_transf_matrix[1][1] 0.016589 _atom_sites.fract_transf_matrix[1][2] 0.009578 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019156 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005707 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 983 ? ? ? A . n A 1 2 GLY 2 984 ? ? ? A . n A 1 3 ILE 3 985 ? ? ? A . n A 1 4 THR 4 986 986 THR THR A . n A 1 5 GLN 5 987 987 GLN GLN A . n A 1 6 GLN 6 988 988 GLN GLN A . n A 1 7 VAL 7 989 989 VAL VAL A . n A 1 8 LEU 8 990 990 LEU LEU A . n A 1 9 SER 9 991 991 SER SER A . n A 1 10 GLU 10 992 992 GLU GLU A . n A 1 11 ASN 11 993 993 ASN ASN A . n A 1 12 GLN 12 994 994 GLN GLN A . n A 1 13 LYS 13 995 995 LYS LYS A . n A 1 14 LEU 14 996 996 LEU LEU A . n A 1 15 ILE 15 997 997 ILE ILE A . n A 1 16 ALA 16 998 998 ALA ALA A . n A 1 17 ASN 17 999 999 ASN ASN A . n A 1 18 LYS 18 1000 1000 LYS LYS A . n A 1 19 PHE 19 1001 1001 PHE PHE A . n A 1 20 ASN 20 1002 1002 ASN ASN A . n A 1 21 GLN 21 1003 1003 GLN GLN A . n A 1 22 ALA 22 1004 1004 ALA ALA A . n A 1 23 LEU 23 1005 1005 LEU LEU A . n A 1 24 GLY 24 1006 1006 GLY GLY A . n A 1 25 ALA 25 1007 1007 ALA ALA A . n A 1 26 MET 26 1008 1008 MET MET A . n A 1 27 GLN 27 1009 1009 GLN GLN A . n A 1 28 THR 28 1010 1010 THR THR A . n A 1 29 GLY 29 1011 1011 GLY GLY A . n A 1 30 PHE 30 1012 1012 PHE PHE A . n A 1 31 THR 31 1013 1013 THR THR A . n A 1 32 THR 32 1014 1014 THR THR A . n A 1 33 THR 33 1015 1015 THR THR A . n A 1 34 ASN 34 1016 1016 ASN ASN A . n A 1 35 GLU 35 1017 1017 GLU GLU A . n A 1 36 ALA 36 1018 1018 ALA ALA A . n A 1 37 PHE 37 1019 1019 PHE PHE A . n A 1 38 ARG 38 1020 1020 ARG ARG A . n A 1 39 LYS 39 1021 1021 LYS LYS A . n A 1 40 VAL 40 1022 1022 VAL VAL A . n A 1 41 GLN 41 1023 1023 GLN GLN A . n A 1 42 ASP 42 1024 1024 ASP ASP A . n A 1 43 ALA 43 1025 1025 ALA ALA A . n A 1 44 VAL 44 1026 1026 VAL VAL A . n A 1 45 ASN 45 1027 1027 ASN ASN A . n A 1 46 ASN 46 1028 1028 ASN ASN A . n A 1 47 ASN 47 1029 1029 ASN ASN A . n A 1 48 ALA 48 1030 1030 ALA ALA A . n A 1 49 GLN 49 1031 1031 GLN GLN A . n A 1 50 ALA 50 1032 1032 ALA ALA A . n A 1 51 LEU 51 1033 1033 LEU LEU A . n A 1 52 SER 52 1034 1034 SER SER A . n A 1 53 LYS 53 1035 1035 LYS LYS A . n A 1 54 LEU 54 1036 1036 LEU LEU A . n A 1 55 ALA 55 1037 1037 ALA ALA A . n A 1 56 SER 56 1038 1038 SER SER A . n A 1 57 GLU 57 1039 1039 GLU GLU A . n A 1 58 LEU 58 1040 1040 LEU LEU A . n A 1 59 SER 59 1041 1041 SER SER A . n A 1 60 ASN 60 1042 1042 ASN ASN A . n A 1 61 THR 61 1043 1043 THR THR A . n A 1 62 PHE 62 1044 1044 PHE PHE A . n A 1 63 GLY 63 1045 1045 GLY GLY A . n A 1 64 ALA 64 1046 1046 ALA ALA A . n A 1 65 ILE 65 1047 1047 ILE ILE A . n A 1 66 SER 66 1048 1048 SER SER A . n A 1 67 ALA 67 1049 1049 ALA ALA A . n A 1 68 SER 68 1050 1050 SER SER A . n A 1 69 ILE 69 1051 1051 ILE ILE A . n A 1 70 GLY 70 1052 1052 GLY GLY A . n A 1 71 ASP 71 1053 1053 ASP ASP A . n A 1 72 ILE 72 1054 1054 ILE ILE A . n A 1 73 ILE 73 1055 1055 ILE ILE A . n A 1 74 GLN 74 1056 ? ? ? A . n A 1 75 ARG 75 1057 ? ? ? A . n A 1 76 LEU 76 1058 ? ? ? A . n A 1 77 ASP 77 1059 ? ? ? A . n A 1 78 VAL 78 1060 ? ? ? A . n A 1 79 LEU 79 1061 ? ? ? A . n A 1 80 GLU 80 1062 ? ? ? A . n B 1 1 SER 1 983 ? ? ? B . n B 1 2 GLY 2 984 ? ? ? B . n B 1 3 ILE 3 985 ? ? ? B . n B 1 4 THR 4 986 986 THR THR B . n B 1 5 GLN 5 987 987 GLN GLN B . n B 1 6 GLN 6 988 988 GLN GLN B . n B 1 7 VAL 7 989 989 VAL VAL B . n B 1 8 LEU 8 990 990 LEU LEU B . n B 1 9 SER 9 991 991 SER SER B . n B 1 10 GLU 10 992 992 GLU GLU B . n B 1 11 ASN 11 993 993 ASN ASN B . n B 1 12 GLN 12 994 994 GLN GLN B . n B 1 13 LYS 13 995 995 LYS LYS B . n B 1 14 LEU 14 996 996 LEU LEU B . n B 1 15 ILE 15 997 997 ILE ILE B . n B 1 16 ALA 16 998 998 ALA ALA B . n B 1 17 ASN 17 999 999 ASN ASN B . n B 1 18 LYS 18 1000 1000 LYS LYS B . n B 1 19 PHE 19 1001 1001 PHE PHE B . n B 1 20 ASN 20 1002 1002 ASN ASN B . n B 1 21 GLN 21 1003 1003 GLN GLN B . n B 1 22 ALA 22 1004 1004 ALA ALA B . n B 1 23 LEU 23 1005 1005 LEU LEU B . n B 1 24 GLY 24 1006 1006 GLY GLY B . n B 1 25 ALA 25 1007 1007 ALA ALA B . n B 1 26 MET 26 1008 1008 MET MET B . n B 1 27 GLN 27 1009 1009 GLN GLN B . n B 1 28 THR 28 1010 1010 THR THR B . n B 1 29 GLY 29 1011 1011 GLY GLY B . n B 1 30 PHE 30 1012 1012 PHE PHE B . n B 1 31 THR 31 1013 1013 THR THR B . n B 1 32 THR 32 1014 1014 THR THR B . n B 1 33 THR 33 1015 1015 THR THR B . n B 1 34 ASN 34 1016 1016 ASN ASN B . n B 1 35 GLU 35 1017 1017 GLU GLU B . n B 1 36 ALA 36 1018 1018 ALA ALA B . n B 1 37 PHE 37 1019 1019 PHE PHE B . n B 1 38 ARG 38 1020 1020 ARG ARG B . n B 1 39 LYS 39 1021 1021 LYS LYS B . n B 1 40 VAL 40 1022 1022 VAL VAL B . n B 1 41 GLN 41 1023 1023 GLN GLN B . n B 1 42 ASP 42 1024 1024 ASP ASP B . n B 1 43 ALA 43 1025 1025 ALA ALA B . n B 1 44 VAL 44 1026 1026 VAL VAL B . n B 1 45 ASN 45 1027 1027 ASN ASN B . n B 1 46 ASN 46 1028 1028 ASN ASN B . n B 1 47 ASN 47 1029 1029 ASN ASN B . n B 1 48 ALA 48 1030 1030 ALA ALA B . n B 1 49 GLN 49 1031 1031 GLN GLN B . n B 1 50 ALA 50 1032 1032 ALA ALA B . n B 1 51 LEU 51 1033 1033 LEU LEU B . n B 1 52 SER 52 1034 1034 SER SER B . n B 1 53 LYS 53 1035 1035 LYS LYS B . n B 1 54 LEU 54 1036 1036 LEU LEU B . n B 1 55 ALA 55 1037 1037 ALA ALA B . n B 1 56 SER 56 1038 1038 SER SER B . n B 1 57 GLU 57 1039 1039 GLU GLU B . n B 1 58 LEU 58 1040 1040 LEU LEU B . n B 1 59 SER 59 1041 1041 SER SER B . n B 1 60 ASN 60 1042 1042 ASN ASN B . n B 1 61 THR 61 1043 1043 THR THR B . n B 1 62 PHE 62 1044 1044 PHE PHE B . n B 1 63 GLY 63 1045 1045 GLY GLY B . n B 1 64 ALA 64 1046 1046 ALA ALA B . n B 1 65 ILE 65 1047 1047 ILE ILE B . n B 1 66 SER 66 1048 1048 SER SER B . n B 1 67 ALA 67 1049 1049 ALA ALA B . n B 1 68 SER 68 1050 1050 SER SER B . n B 1 69 ILE 69 1051 1051 ILE ILE B . n B 1 70 GLY 70 1052 1052 GLY GLY B . n B 1 71 ASP 71 1053 1053 ASP ASP B . n B 1 72 ILE 72 1054 1054 ILE ILE B . n B 1 73 ILE 73 1055 1055 ILE ILE B . n B 1 74 GLN 74 1056 ? ? ? B . n B 1 75 ARG 75 1057 ? ? ? B . n B 1 76 LEU 76 1058 ? ? ? B . n B 1 77 ASP 77 1059 ? ? ? B . n B 1 78 VAL 78 1060 ? ? ? B . n B 1 79 LEU 79 1061 ? ? ? B . n B 1 80 GLU 80 1062 ? ? ? B . n C 1 1 SER 1 983 ? ? ? C . n C 1 2 GLY 2 984 ? ? ? C . n C 1 3 ILE 3 985 ? ? ? C . n C 1 4 THR 4 986 986 THR THR C . n C 1 5 GLN 5 987 987 GLN GLN C . n C 1 6 GLN 6 988 988 GLN GLN C . n C 1 7 VAL 7 989 989 VAL VAL C . n C 1 8 LEU 8 990 990 LEU LEU C . n C 1 9 SER 9 991 991 SER SER C . n C 1 10 GLU 10 992 992 GLU GLU C . n C 1 11 ASN 11 993 993 ASN ASN C . n C 1 12 GLN 12 994 994 GLN GLN C . n C 1 13 LYS 13 995 995 LYS LYS C . n C 1 14 LEU 14 996 996 LEU LEU C . n C 1 15 ILE 15 997 997 ILE ILE C . n C 1 16 ALA 16 998 998 ALA ALA C . n C 1 17 ASN 17 999 999 ASN ASN C . n C 1 18 LYS 18 1000 1000 LYS LYS C . n C 1 19 PHE 19 1001 1001 PHE PHE C . n C 1 20 ASN 20 1002 1002 ASN ASN C . n C 1 21 GLN 21 1003 1003 GLN GLN C . n C 1 22 ALA 22 1004 1004 ALA ALA C . n C 1 23 LEU 23 1005 1005 LEU LEU C . n C 1 24 GLY 24 1006 1006 GLY GLY C . n C 1 25 ALA 25 1007 1007 ALA ALA C . n C 1 26 MET 26 1008 1008 MET MET C . n C 1 27 GLN 27 1009 1009 GLN GLN C . n C 1 28 THR 28 1010 1010 THR THR C . n C 1 29 GLY 29 1011 1011 GLY GLY C . n C 1 30 PHE 30 1012 1012 PHE PHE C . n C 1 31 THR 31 1013 1013 THR THR C . n C 1 32 THR 32 1014 1014 THR THR C . n C 1 33 THR 33 1015 1015 THR THR C . n C 1 34 ASN 34 1016 1016 ASN ASN C . n C 1 35 GLU 35 1017 1017 GLU GLU C . n C 1 36 ALA 36 1018 1018 ALA ALA C . n C 1 37 PHE 37 1019 1019 PHE PHE C . n C 1 38 ARG 38 1020 1020 ARG ARG C . n C 1 39 LYS 39 1021 1021 LYS LYS C . n C 1 40 VAL 40 1022 1022 VAL VAL C . n C 1 41 GLN 41 1023 1023 GLN GLN C . n C 1 42 ASP 42 1024 1024 ASP ASP C . n C 1 43 ALA 43 1025 1025 ALA ALA C . n C 1 44 VAL 44 1026 1026 VAL VAL C . n C 1 45 ASN 45 1027 1027 ASN ASN C . n C 1 46 ASN 46 1028 1028 ASN ASN C . n C 1 47 ASN 47 1029 1029 ASN ASN C . n C 1 48 ALA 48 1030 1030 ALA ALA C . n C 1 49 GLN 49 1031 1031 GLN GLN C . n C 1 50 ALA 50 1032 1032 ALA ALA C . n C 1 51 LEU 51 1033 1033 LEU LEU C . n C 1 52 SER 52 1034 1034 SER SER C . n C 1 53 LYS 53 1035 1035 LYS LYS C . n C 1 54 LEU 54 1036 1036 LEU LEU C . n C 1 55 ALA 55 1037 1037 ALA ALA C . n C 1 56 SER 56 1038 1038 SER SER C . n C 1 57 GLU 57 1039 1039 GLU GLU C . n C 1 58 LEU 58 1040 1040 LEU LEU C . n C 1 59 SER 59 1041 1041 SER SER C . n C 1 60 ASN 60 1042 1042 ASN ASN C . n C 1 61 THR 61 1043 1043 THR THR C . n C 1 62 PHE 62 1044 1044 PHE PHE C . n C 1 63 GLY 63 1045 1045 GLY GLY C . n C 1 64 ALA 64 1046 1046 ALA ALA C . n C 1 65 ILE 65 1047 1047 ILE ILE C . n C 1 66 SER 66 1048 1048 SER SER C . n C 1 67 ALA 67 1049 1049 ALA ALA C . n C 1 68 SER 68 1050 1050 SER SER C . n C 1 69 ILE 69 1051 1051 ILE ILE C . n C 1 70 GLY 70 1052 1052 GLY GLY C . n C 1 71 ASP 71 1053 1053 ASP ASP C . n C 1 72 ILE 72 1054 1054 ILE ILE C . n C 1 73 ILE 73 1055 1055 ILE ILE C . n C 1 74 GLN 74 1056 ? ? ? C . n C 1 75 ARG 75 1057 ? ? ? C . n C 1 76 LEU 76 1058 ? ? ? C . n C 1 77 ASP 77 1059 ? ? ? C . n C 1 78 VAL 78 1060 ? ? ? C . n C 1 79 LEU 79 1061 ? ? ? C . n C 1 80 GLU 80 1062 ? ? ? C . n D 2 1 SER 1 1 ? ? ? a . n D 2 2 GLY 2 2 ? ? ? a . n D 2 3 GLY 3 3 ? ? ? a . n D 2 4 ARG 4 4 ? ? ? a . n D 2 5 GLY 5 5 ? ? ? a . n D 2 6 GLY 6 6 ? ? ? a . n D 2 7 SER 7 7 ? ? ? a . n D 2 8 LEU 8 8 ? ? ? a . n D 2 9 ASP 9 9 ? ? ? a . n D 2 10 GLN 10 10 ? ? ? a . n D 2 11 ILE 11 11 ? ? ? a . n D 2 12 ASN 12 12 12 ASN ASN a . n D 2 13 VAL 13 13 13 VAL VAL a . n D 2 14 THR 14 14 14 THR THR a . n D 2 15 PHE 15 15 15 PHE PHE a . n D 2 16 LEU 16 16 16 LEU LEU a . n D 2 17 ASP 17 17 17 ASP ASP a . n D 2 18 LEU 18 18 18 LEU LEU a . n D 2 19 GLU 19 19 19 GLU GLU a . n D 2 20 TYR 20 20 20 TYR TYR a . n D 2 21 GLU 21 21 21 GLU GLU a . n D 2 22 MET 22 22 22 MET MET a . n D 2 23 LYS 23 23 23 LYS LYS a . n D 2 24 LYS 24 24 24 LYS LYS a . n D 2 25 LEU 25 25 25 LEU LEU a . n D 2 26 GLU 26 26 26 GLU GLU a . n D 2 27 GLU 27 27 27 GLU GLU a . n D 2 28 ALA 28 28 28 ALA ALA a . n D 2 29 ILE 29 29 29 ILE ILE a . n D 2 30 LYS 30 30 30 LYS LYS a . n D 2 31 LYS 31 31 31 LYS LYS a . n D 2 32 LEU 32 32 32 LEU LEU a . n D 2 33 GLU 33 33 33 GLU GLU a . n D 2 34 GLU 34 34 34 GLU GLU a . n D 2 35 SER 35 35 35 SER SER a . n D 2 36 TYR 36 36 36 TYR TYR a . n D 2 37 ILE 37 37 37 ILE ILE a . n D 2 38 ASP 38 38 38 ASP ASP a . n D 2 39 LEU 39 39 39 LEU LEU a . n D 2 40 LYS 40 40 40 LYS LYS a . n D 2 41 GLU 41 41 41 GLU GLU a . n D 2 42 LEU 42 42 ? ? ? a . n D 2 43 GLY 43 43 ? ? ? a . n D 2 44 GLY 44 44 ? ? ? a . n E 2 1 SER 1 1 ? ? ? b . n E 2 2 GLY 2 2 ? ? ? b . n E 2 3 GLY 3 3 ? ? ? b . n E 2 4 ARG 4 4 ? ? ? b . n E 2 5 GLY 5 5 ? ? ? b . n E 2 6 GLY 6 6 ? ? ? b . n E 2 7 SER 7 7 ? ? ? b . n E 2 8 LEU 8 8 ? ? ? b . n E 2 9 ASP 9 9 ? ? ? b . n E 2 10 GLN 10 10 10 GLN GLN b . n E 2 11 ILE 11 11 11 ILE ILE b . n E 2 12 ASN 12 12 12 ASN ASN b . n E 2 13 VAL 13 13 13 VAL VAL b . n E 2 14 THR 14 14 14 THR THR b . n E 2 15 PHE 15 15 15 PHE PHE b . n E 2 16 LEU 16 16 16 LEU LEU b . n E 2 17 ASP 17 17 17 ASP ASP b . n E 2 18 LEU 18 18 18 LEU LEU b . n E 2 19 GLU 19 19 19 GLU GLU b . n E 2 20 TYR 20 20 20 TYR TYR b . n E 2 21 GLU 21 21 21 GLU GLU b . n E 2 22 MET 22 22 22 MET MET b . n E 2 23 LYS 23 23 23 LYS LYS b . n E 2 24 LYS 24 24 24 LYS LYS b . n E 2 25 LEU 25 25 25 LEU LEU b . n E 2 26 GLU 26 26 26 GLU GLU b . n E 2 27 GLU 27 27 27 GLU GLU b . n E 2 28 ALA 28 28 28 ALA ALA b . n E 2 29 ILE 29 29 29 ILE ILE b . n E 2 30 LYS 30 30 30 LYS LYS b . n E 2 31 LYS 31 31 31 LYS LYS b . n E 2 32 LEU 32 32 32 LEU LEU b . n E 2 33 GLU 33 33 33 GLU GLU b . n E 2 34 GLU 34 34 34 GLU GLU b . n E 2 35 SER 35 35 35 SER SER b . n E 2 36 TYR 36 36 36 TYR TYR b . n E 2 37 ILE 37 37 37 ILE ILE b . n E 2 38 ASP 38 38 38 ASP ASP b . n E 2 39 LEU 39 39 39 LEU LEU b . n E 2 40 LYS 40 40 40 LYS LYS b . n E 2 41 GLU 41 41 ? ? ? b . n E 2 42 LEU 42 42 ? ? ? b . n E 2 43 GLY 43 43 ? ? ? b . n E 2 44 GLY 44 44 ? ? ? b . n F 2 1 SER 1 1 ? ? ? c . n F 2 2 GLY 2 2 ? ? ? c . n F 2 3 GLY 3 3 ? ? ? c . n F 2 4 ARG 4 4 ? ? ? c . n F 2 5 GLY 5 5 ? ? ? c . n F 2 6 GLY 6 6 ? ? ? c . n F 2 7 SER 7 7 ? ? ? c . n F 2 8 LEU 8 8 ? ? ? c . n F 2 9 ASP 9 9 ? ? ? c . n F 2 10 GLN 10 10 ? ? ? c . n F 2 11 ILE 11 11 11 ILE ILE c . n F 2 12 ASN 12 12 12 ASN ASN c . n F 2 13 VAL 13 13 13 VAL VAL c . n F 2 14 THR 14 14 14 THR THR c . n F 2 15 PHE 15 15 15 PHE PHE c . n F 2 16 LEU 16 16 16 LEU LEU c . n F 2 17 ASP 17 17 17 ASP ASP c . n F 2 18 LEU 18 18 18 LEU LEU c . n F 2 19 GLU 19 19 19 GLU GLU c . n F 2 20 TYR 20 20 20 TYR TYR c . n F 2 21 GLU 21 21 21 GLU GLU c . n F 2 22 MET 22 22 22 MET MET c . n F 2 23 LYS 23 23 23 LYS LYS c . n F 2 24 LYS 24 24 24 LYS LYS c . n F 2 25 LEU 25 25 25 LEU LEU c . n F 2 26 GLU 26 26 26 GLU GLU c . n F 2 27 GLU 27 27 27 GLU GLU c . n F 2 28 ALA 28 28 28 ALA ALA c . n F 2 29 ILE 29 29 29 ILE ILE c . n F 2 30 LYS 30 30 30 LYS LYS c . n F 2 31 LYS 31 31 31 LYS LYS c . n F 2 32 LEU 32 32 32 LEU LEU c . n F 2 33 GLU 33 33 33 GLU GLU c . n F 2 34 GLU 34 34 34 GLU GLU c . n F 2 35 SER 35 35 35 SER SER c . n F 2 36 TYR 36 36 36 TYR TYR c . n F 2 37 ILE 37 37 37 ILE ILE c . n F 2 38 ASP 38 38 38 ASP ASP c . n F 2 39 LEU 39 39 39 LEU LEU c . n F 2 40 LYS 40 40 40 LYS LYS c . n F 2 41 GLU 41 41 ? ? ? c . n F 2 42 LEU 42 42 ? ? ? c . n F 2 43 GLY 43 43 ? ? ? c . n F 2 44 GLY 44 44 ? ? ? c . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14210 ? 1 MORE -119 ? 1 'SSA (A^2)' 16840 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-10 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2019-05-15 4 'Structure model' 1 3 2019-08-28 5 'Structure model' 1 4 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' reflns 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 2 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 3 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 4 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 5 2 'Structure model' '_entity_src_gen.pdbx_seq_type' 6 3 'Structure model' '_citation.country' 7 3 'Structure model' '_citation.journal_abbrev' 8 3 'Structure model' '_citation.journal_id_CSD' 9 3 'Structure model' '_citation.journal_id_ISSN' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.pdbx_database_id_DOI' 14 3 'Structure model' '_citation.pdbx_database_id_PubMed' 15 3 'Structure model' '_citation.title' 16 3 'Structure model' '_citation.year' 17 4 'Structure model' '_reflns.pdbx_Rpim_I_all' 18 4 'Structure model' '_reflns.pdbx_Rrim_I_all' 19 5 'Structure model' '_database_2.pdbx_DOI' 20 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 36.3284 _pdbx_refine_tls.origin_y 34.8555 _pdbx_refine_tls.origin_z 188.4057 _pdbx_refine_tls.T[1][1] 0.6780 _pdbx_refine_tls.T[2][2] 0.6651 _pdbx_refine_tls.T[3][3] 0.7339 _pdbx_refine_tls.T[1][2] 0.1873 _pdbx_refine_tls.T[1][3] 0.0751 _pdbx_refine_tls.T[2][3] 0.1082 _pdbx_refine_tls.L[1][1] 7.0740 _pdbx_refine_tls.L[2][2] 3.4631 _pdbx_refine_tls.L[3][3] 2.4813 _pdbx_refine_tls.L[1][2] -3.7619 _pdbx_refine_tls.L[1][3] -2.5162 _pdbx_refine_tls.L[2][3] 1.5613 _pdbx_refine_tls.S[1][1] 0.4311 _pdbx_refine_tls.S[1][2] 0.4167 _pdbx_refine_tls.S[1][3] 0.0777 _pdbx_refine_tls.S[2][1] -0.3267 _pdbx_refine_tls.S[2][2] -0.2002 _pdbx_refine_tls.S[2][3] 0.2979 _pdbx_refine_tls.S[3][1] -0.5074 _pdbx_refine_tls.S[3][2] -0.5441 _pdbx_refine_tls.S[3][3] -0.2010 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5ZVK _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;The protein used for crystallization is a HR1-SGGRGG-EK1 fusion protein that contains MERS HR1 motif, followed by SGGRGG linker, followed by manually designed EK1 peptide. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id c _pdbx_validate_torsion.auth_seq_id 39 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 41.51 _pdbx_validate_torsion.psi 71.81 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 983 ? A SER 1 2 1 Y 1 A GLY 984 ? A GLY 2 3 1 Y 1 A ILE 985 ? A ILE 3 4 1 Y 1 A GLN 1056 ? A GLN 74 5 1 Y 1 A ARG 1057 ? A ARG 75 6 1 Y 1 A LEU 1058 ? A LEU 76 7 1 Y 1 A ASP 1059 ? A ASP 77 8 1 Y 1 A VAL 1060 ? A VAL 78 9 1 Y 1 A LEU 1061 ? A LEU 79 10 1 Y 1 A GLU 1062 ? A GLU 80 11 1 Y 1 B SER 983 ? B SER 1 12 1 Y 1 B GLY 984 ? B GLY 2 13 1 Y 1 B ILE 985 ? B ILE 3 14 1 Y 1 B GLN 1056 ? B GLN 74 15 1 Y 1 B ARG 1057 ? B ARG 75 16 1 Y 1 B LEU 1058 ? B LEU 76 17 1 Y 1 B ASP 1059 ? B ASP 77 18 1 Y 1 B VAL 1060 ? B VAL 78 19 1 Y 1 B LEU 1061 ? B LEU 79 20 1 Y 1 B GLU 1062 ? B GLU 80 21 1 Y 1 C SER 983 ? C SER 1 22 1 Y 1 C GLY 984 ? C GLY 2 23 1 Y 1 C ILE 985 ? C ILE 3 24 1 Y 1 C GLN 1056 ? C GLN 74 25 1 Y 1 C ARG 1057 ? C ARG 75 26 1 Y 1 C LEU 1058 ? C LEU 76 27 1 Y 1 C ASP 1059 ? C ASP 77 28 1 Y 1 C VAL 1060 ? C VAL 78 29 1 Y 1 C LEU 1061 ? C LEU 79 30 1 Y 1 C GLU 1062 ? C GLU 80 31 1 Y 1 a SER 1 ? D SER 1 32 1 Y 1 a GLY 2 ? D GLY 2 33 1 Y 1 a GLY 3 ? D GLY 3 34 1 Y 1 a ARG 4 ? D ARG 4 35 1 Y 1 a GLY 5 ? D GLY 5 36 1 Y 1 a GLY 6 ? D GLY 6 37 1 Y 1 a SER 7 ? D SER 7 38 1 Y 1 a LEU 8 ? D LEU 8 39 1 Y 1 a ASP 9 ? D ASP 9 40 1 Y 1 a GLN 10 ? D GLN 10 41 1 Y 1 a ILE 11 ? D ILE 11 42 1 Y 1 a LEU 42 ? D LEU 42 43 1 Y 1 a GLY 43 ? D GLY 43 44 1 Y 1 a GLY 44 ? D GLY 44 45 1 Y 1 b SER 1 ? E SER 1 46 1 Y 1 b GLY 2 ? E GLY 2 47 1 Y 1 b GLY 3 ? E GLY 3 48 1 Y 1 b ARG 4 ? E ARG 4 49 1 Y 1 b GLY 5 ? E GLY 5 50 1 Y 1 b GLY 6 ? E GLY 6 51 1 Y 1 b SER 7 ? E SER 7 52 1 Y 1 b LEU 8 ? E LEU 8 53 1 Y 1 b ASP 9 ? E ASP 9 54 1 Y 1 b GLU 41 ? E GLU 41 55 1 Y 1 b LEU 42 ? E LEU 42 56 1 Y 1 b GLY 43 ? E GLY 43 57 1 Y 1 b GLY 44 ? E GLY 44 58 1 Y 1 c SER 1 ? F SER 1 59 1 Y 1 c GLY 2 ? F GLY 2 60 1 Y 1 c GLY 3 ? F GLY 3 61 1 Y 1 c ARG 4 ? F ARG 4 62 1 Y 1 c GLY 5 ? F GLY 5 63 1 Y 1 c GLY 6 ? F GLY 6 64 1 Y 1 c SER 7 ? F SER 7 65 1 Y 1 c LEU 8 ? F LEU 8 66 1 Y 1 c ASP 9 ? F ASP 9 67 1 Y 1 c GLN 10 ? F GLN 10 68 1 Y 1 c GLU 41 ? F GLU 41 69 1 Y 1 c LEU 42 ? F LEU 42 70 1 Y 1 c GLY 43 ? F GLY 43 71 1 Y 1 c GLY 44 ? F GLY 44 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TYR N N N N 266 TYR CA C N S 267 TYR C C N N 268 TYR O O N N 269 TYR CB C N N 270 TYR CG C Y N 271 TYR CD1 C Y N 272 TYR CD2 C Y N 273 TYR CE1 C Y N 274 TYR CE2 C Y N 275 TYR CZ C Y N 276 TYR OH O N N 277 TYR OXT O N N 278 TYR H H N N 279 TYR H2 H N N 280 TYR HA H N N 281 TYR HB2 H N N 282 TYR HB3 H N N 283 TYR HD1 H N N 284 TYR HD2 H N N 285 TYR HE1 H N N 286 TYR HE2 H N N 287 TYR HH H N N 288 TYR HXT H N N 289 VAL N N N N 290 VAL CA C N S 291 VAL C C N N 292 VAL O O N N 293 VAL CB C N N 294 VAL CG1 C N N 295 VAL CG2 C N N 296 VAL OXT O N N 297 VAL H H N N 298 VAL H2 H N N 299 VAL HA H N N 300 VAL HB H N N 301 VAL HG11 H N N 302 VAL HG12 H N N 303 VAL HG13 H N N 304 VAL HG21 H N N 305 VAL HG22 H N N 306 VAL HG23 H N N 307 VAL HXT H N N 308 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TYR N CA sing N N 253 TYR N H sing N N 254 TYR N H2 sing N N 255 TYR CA C sing N N 256 TYR CA CB sing N N 257 TYR CA HA sing N N 258 TYR C O doub N N 259 TYR C OXT sing N N 260 TYR CB CG sing N N 261 TYR CB HB2 sing N N 262 TYR CB HB3 sing N N 263 TYR CG CD1 doub Y N 264 TYR CG CD2 sing Y N 265 TYR CD1 CE1 sing Y N 266 TYR CD1 HD1 sing N N 267 TYR CD2 CE2 doub Y N 268 TYR CD2 HD2 sing N N 269 TYR CE1 CZ doub Y N 270 TYR CE1 HE1 sing N N 271 TYR CE2 CZ sing Y N 272 TYR CE2 HE2 sing N N 273 TYR CZ OH sing N N 274 TYR OH HH sing N N 275 TYR OXT HXT sing N N 276 VAL N CA sing N N 277 VAL N H sing N N 278 VAL N H2 sing N N 279 VAL CA C sing N N 280 VAL CA CB sing N N 281 VAL CA HA sing N N 282 VAL C O doub N N 283 VAL C OXT sing N N 284 VAL CB CG1 sing N N 285 VAL CB CG2 sing N N 286 VAL CB HB sing N N 287 VAL CG1 HG11 sing N N 288 VAL CG1 HG12 sing N N 289 VAL CG1 HG13 sing N N 290 VAL CG2 HG21 sing N N 291 VAL CG2 HG22 sing N N 292 VAL CG2 HG23 sing N N 293 VAL OXT HXT sing N N 294 # _pdbx_audit_support.funding_organization 'National Science Foundation (China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31600619 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4MOD _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #