data_6A9X # _entry.id 6A9X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6A9X pdb_00006a9x 10.2210/pdb6a9x/pdb WWPDB D_1300007066 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6A9X _pdbx_database_status.recvd_initial_deposition_date 2018-07-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, C.' 1 ? 'Li, J.' 2 0000-0002-8921-1626 'Chen, K.' 3 0000-0003-0321-0604 'Zhang, M.' 4 0000-0001-9404-0190 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Psychiatry' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1476-5578 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Ankyrin-G regulates forebrain connectivity and network synchronization via interaction with GABARAP.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41380-018-0308-x _citation.pdbx_database_id_PubMed 30504823 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nelson, A.D.' 1 ? primary 'Caballero-Floran, R.N.' 2 ? primary 'Rodriguez Diaz, J.C.' 3 ? primary 'Hull, J.M.' 4 ? primary 'Yuan, Y.' 5 ? primary 'Li, J.' 6 0000-0002-8921-1626 primary 'Chen, K.' 7 ? primary 'Walder, K.K.' 8 ? primary 'Lopez-Santiago, L.F.' 9 ? primary 'Bennett, V.' 10 ? primary 'McInnis, M.G.' 11 0000-0002-0375-6247 primary 'Isom, L.L.' 12 ? primary 'Wang, C.' 13 0000-0003-3192-2780 primary 'Zhang, M.' 14 ? primary 'Jones, K.S.' 15 ? primary 'Jenkins, P.M.' 16 0000-0002-4207-5823 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6A9X _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.991 _cell.length_a_esd ? _cell.length_b 96.991 _cell.length_b_esd ? _cell.length_c 96.991 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6A9X _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gamma-aminobutyric acid receptor-associated protein' 13942.047 1 ? ? ? ? 2 polymer man Ankyrin-3 2693.770 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'GABARAP, GABA(A) receptor-associated protein' 2 'AnkG, ANK-3,Ankyrin-G' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; ;MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; D ? 2 'polypeptide(L)' no no DDWTEFSSEEIREARQAAASHAPS DDWTEFSSEEIREARQAAASHAPS A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PHE n 1 4 VAL n 1 5 TYR n 1 6 LYS n 1 7 GLU n 1 8 GLU n 1 9 HIS n 1 10 PRO n 1 11 PHE n 1 12 GLU n 1 13 LYS n 1 14 ARG n 1 15 ARG n 1 16 SER n 1 17 GLU n 1 18 GLY n 1 19 GLU n 1 20 LYS n 1 21 ILE n 1 22 ARG n 1 23 LYS n 1 24 LYS n 1 25 TYR n 1 26 PRO n 1 27 ASP n 1 28 ARG n 1 29 VAL n 1 30 PRO n 1 31 VAL n 1 32 ILE n 1 33 VAL n 1 34 GLU n 1 35 LYS n 1 36 ALA n 1 37 PRO n 1 38 LYS n 1 39 ALA n 1 40 ARG n 1 41 ILE n 1 42 GLY n 1 43 ASP n 1 44 LEU n 1 45 ASP n 1 46 LYS n 1 47 LYS n 1 48 LYS n 1 49 TYR n 1 50 LEU n 1 51 VAL n 1 52 PRO n 1 53 SER n 1 54 ASP n 1 55 LEU n 1 56 THR n 1 57 VAL n 1 58 GLY n 1 59 GLN n 1 60 PHE n 1 61 TYR n 1 62 PHE n 1 63 LEU n 1 64 ILE n 1 65 ARG n 1 66 LYS n 1 67 ARG n 1 68 ILE n 1 69 HIS n 1 70 LEU n 1 71 ARG n 1 72 ALA n 1 73 GLU n 1 74 ASP n 1 75 ALA n 1 76 LEU n 1 77 PHE n 1 78 PHE n 1 79 PHE n 1 80 VAL n 1 81 ASN n 1 82 ASN n 1 83 VAL n 1 84 ILE n 1 85 PRO n 1 86 PRO n 1 87 THR n 1 88 SER n 1 89 ALA n 1 90 THR n 1 91 MET n 1 92 GLY n 1 93 GLN n 1 94 LEU n 1 95 TYR n 1 96 GLN n 1 97 GLU n 1 98 HIS n 1 99 HIS n 1 100 GLU n 1 101 GLU n 1 102 ASP n 1 103 PHE n 1 104 PHE n 1 105 LEU n 1 106 TYR n 1 107 ILE n 1 108 ALA n 1 109 TYR n 1 110 SER n 1 111 ASP n 1 112 GLU n 1 113 SER n 1 114 VAL n 1 115 TYR n 1 116 GLY n 1 117 LEU n 2 1 ASP n 2 2 ASP n 2 3 TRP n 2 4 THR n 2 5 GLU n 2 6 PHE n 2 7 SER n 2 8 SER n 2 9 GLU n 2 10 GLU n 2 11 ILE n 2 12 ARG n 2 13 GLU n 2 14 ALA n 2 15 ARG n 2 16 GLN n 2 17 ALA n 2 18 ALA n 2 19 ALA n 2 20 SER n 2 21 HIS n 2 22 ALA n 2 23 PRO n 2 24 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 117 Mouse ? Gabarap ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 24 Rat ? Ank3 ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GBRAP_MOUSE Q9DCD6 ? 1 ;MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; 1 2 UNP ANK3_RAT O70511 ? 2 DDWTEFSSEEIREARQAAASHAPS 1987 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6A9X D 1 ? 117 ? Q9DCD6 1 ? 117 ? 1 117 2 2 6A9X A 1 ? 24 ? O70511 1987 ? 2010 ? 1987 2010 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6A9X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M ammonium citrate tribasic, 0.1 M BIS-TRIS propane buffer' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 26.930 _reflns.entry_id 6A9X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7843 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.600 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.993 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.200 2.240 ? ? ? ? ? ? 367 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 20.000 ? 0.976 ? ? ? 0.335 ? 1 1 0.792 ? 2.240 2.280 ? ? ? ? ? ? 400 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 20.600 ? 0.978 ? ? ? 0.302 ? 2 1 0.820 ? 2.280 2.320 ? ? ? ? ? ? 403 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 20.500 ? 0.980 ? ? ? 0.229 ? 3 1 0.888 ? 2.320 2.370 ? ? ? ? ? ? 379 100.000 ? ? ? ? 0.860 ? ? ? ? ? ? ? ? 20.400 ? 1.029 ? ? 0.882 0.195 ? 4 1 0.899 ? 2.370 2.420 ? ? ? ? ? ? 370 100.000 ? ? ? ? 0.755 ? ? ? ? ? ? ? ? 20.500 ? 0.980 ? ? 0.774 0.170 ? 5 1 0.925 ? 2.420 2.480 ? ? ? ? ? ? 384 100.000 ? ? ? ? 0.695 ? ? ? ? ? ? ? ? 20.100 ? 1.054 ? ? 0.713 0.158 ? 6 1 0.937 ? 2.480 2.540 ? ? ? ? ? ? 401 100.000 ? ? ? ? 0.527 ? ? ? ? ? ? ? ? 20.400 ? 1.021 ? ? 0.540 0.119 ? 7 1 0.963 ? 2.540 2.610 ? ? ? ? ? ? 393 100.000 ? ? ? ? 0.406 ? ? ? ? ? ? ? ? 20.000 ? 0.985 ? ? 0.417 0.093 ? 8 1 0.979 ? 2.610 2.690 ? ? ? ? ? ? 384 100.000 ? ? ? ? 0.323 ? ? ? ? ? ? ? ? 19.900 ? 1.001 ? ? 0.331 0.074 ? 9 1 0.985 ? 2.690 2.770 ? ? ? ? ? ? 393 100.000 ? ? ? ? 0.253 ? ? ? ? ? ? ? ? 18.500 ? 1.011 ? ? 0.260 0.060 ? 10 1 0.990 ? 2.770 2.870 ? ? ? ? ? ? 382 100.000 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 17.600 ? 1.034 ? ? 0.201 0.047 ? 11 1 0.993 ? 2.870 2.990 ? ? ? ? ? ? 399 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 21.000 ? 1.007 ? ? 0.148 0.032 ? 12 1 0.997 ? 2.990 3.120 ? ? ? ? ? ? 386 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 20.800 ? 0.991 ? ? 0.106 0.023 ? 13 1 0.998 ? 3.120 3.290 ? ? ? ? ? ? 384 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 20.400 ? 0.970 ? ? 0.082 0.018 ? 14 1 0.998 ? 3.290 3.490 ? ? ? ? ? ? 401 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 20.000 ? 0.975 ? ? 0.068 0.015 ? 15 1 0.998 ? 3.490 3.760 ? ? ? ? ? ? 391 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 19.400 ? 0.954 ? ? 0.060 0.014 ? 16 1 0.999 ? 3.760 4.140 ? ? ? ? ? ? 396 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 17.200 ? 1.015 ? ? 0.057 0.014 ? 17 1 0.999 ? 4.140 4.740 ? ? ? ? ? ? 399 99.500 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 19.000 ? 1.021 ? ? 0.055 0.013 ? 18 1 0.998 ? 4.740 5.970 ? ? ? ? ? ? 411 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 19.300 ? 0.913 ? ? 0.054 0.012 ? 19 1 0.999 ? 5.970 50.000 ? ? ? ? ? ? 420 98.800 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 17.500 ? 0.967 ? ? 0.060 0.014 ? 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 89.030 _refine.B_iso_mean 34.1556 _refine.B_iso_min 10.650 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6A9X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2020 _refine.ls_d_res_low 30.6710 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7745 _refine.ls_number_reflns_R_free 349 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7000 _refine.ls_percent_reflns_R_free 4.5100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2048 _refine.ls_R_factor_R_free 0.2489 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2027 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1KJT _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2020 _refine_hist.d_res_low 30.6710 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1102 _refine_hist.pdbx_number_residues_total 135 _refine_hist.pdbx_B_iso_mean_solvent 31.04 _refine_hist.pdbx_number_atoms_protein 1087 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1116 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.933 ? 1511 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 160 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 196 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.336 ? 404 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2021 2.7741 3785 . 174 3611 98.0000 . . . 0.3084 0.0000 0.2557 . . . . . . 2 . . . 'X-RAY DIFFRACTION' 2.7741 30.6742 3960 . 175 3785 100.0000 . . . 0.2247 0.0000 0.1819 . . . . . . 2 . . . # _struct.entry_id 6A9X _struct.title 'Crystal Structure of AnkG/GABARAP Complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6A9X _struct_keywords.text 'PROTEIN BINDING, STRUCTURAL PROTEIN, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 3 ? HIS A 9 ? PHE D 3 HIS D 9 1 ? 7 HELX_P HELX_P2 AA2 PRO A 10 ? TYR A 25 ? PRO D 10 TYR D 25 1 ? 16 HELX_P HELX_P3 AA3 THR A 56 ? HIS A 69 ? THR D 56 HIS D 69 1 ? 14 HELX_P HELX_P4 AA4 THR A 90 ? HIS A 99 ? THR D 90 HIS D 99 1 ? 10 HELX_P HELX_P5 AA5 SER B 7 ? ALA B 18 ? SER A 1993 ALA A 2004 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 48 ? PRO A 52 ? LYS D 48 PRO D 52 AA1 2 ARG A 28 ? LYS A 35 ? ARG D 28 LYS D 35 AA1 3 LEU A 105 ? SER A 110 ? LEU D 105 SER D 110 AA1 4 PHE A 77 ? PHE A 79 ? PHE D 77 PHE D 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 49 ? O TYR D 49 N VAL A 31 ? N VAL D 31 AA1 2 3 N ILE A 32 ? N ILE D 32 O LEU A 105 ? O LEU D 105 AA1 3 4 O ALA A 108 ? O ALA D 108 N PHE A 79 ? N PHE D 79 # _atom_sites.entry_id 6A9X _atom_sites.fract_transf_matrix[1][1] 0.010310 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010310 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010310 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET D . n A 1 2 LYS 2 2 2 LYS LYS D . n A 1 3 PHE 3 3 3 PHE PHE D . n A 1 4 VAL 4 4 4 VAL VAL D . n A 1 5 TYR 5 5 5 TYR TYR D . n A 1 6 LYS 6 6 6 LYS LYS D . n A 1 7 GLU 7 7 7 GLU GLU D . n A 1 8 GLU 8 8 8 GLU GLU D . n A 1 9 HIS 9 9 9 HIS HIS D . n A 1 10 PRO 10 10 10 PRO PRO D . n A 1 11 PHE 11 11 11 PHE PHE D . n A 1 12 GLU 12 12 12 GLU GLU D . n A 1 13 LYS 13 13 13 LYS LYS D . n A 1 14 ARG 14 14 14 ARG ARG D . n A 1 15 ARG 15 15 15 ARG ARG D . n A 1 16 SER 16 16 16 SER SER D . n A 1 17 GLU 17 17 17 GLU GLU D . n A 1 18 GLY 18 18 18 GLY GLY D . n A 1 19 GLU 19 19 19 GLU GLU D . n A 1 20 LYS 20 20 20 LYS LYS D . n A 1 21 ILE 21 21 21 ILE ILE D . n A 1 22 ARG 22 22 22 ARG ARG D . n A 1 23 LYS 23 23 23 LYS LYS D . n A 1 24 LYS 24 24 24 LYS LYS D . n A 1 25 TYR 25 25 25 TYR TYR D . n A 1 26 PRO 26 26 26 PRO PRO D . n A 1 27 ASP 27 27 27 ASP ASP D . n A 1 28 ARG 28 28 28 ARG ARG D . n A 1 29 VAL 29 29 29 VAL VAL D . n A 1 30 PRO 30 30 30 PRO PRO D . n A 1 31 VAL 31 31 31 VAL VAL D . n A 1 32 ILE 32 32 32 ILE ILE D . n A 1 33 VAL 33 33 33 VAL VAL D . n A 1 34 GLU 34 34 34 GLU GLU D . n A 1 35 LYS 35 35 35 LYS LYS D . n A 1 36 ALA 36 36 36 ALA ALA D . n A 1 37 PRO 37 37 37 PRO PRO D . n A 1 38 LYS 38 38 38 LYS LYS D . n A 1 39 ALA 39 39 39 ALA ALA D . n A 1 40 ARG 40 40 40 ARG ARG D . n A 1 41 ILE 41 41 41 ILE ILE D . n A 1 42 GLY 42 42 42 GLY GLY D . n A 1 43 ASP 43 43 43 ASP ASP D . n A 1 44 LEU 44 44 44 LEU LEU D . n A 1 45 ASP 45 45 45 ASP ASP D . n A 1 46 LYS 46 46 46 LYS LYS D . n A 1 47 LYS 47 47 47 LYS LYS D . n A 1 48 LYS 48 48 48 LYS LYS D . n A 1 49 TYR 49 49 49 TYR TYR D . n A 1 50 LEU 50 50 50 LEU LEU D . n A 1 51 VAL 51 51 51 VAL VAL D . n A 1 52 PRO 52 52 52 PRO PRO D . n A 1 53 SER 53 53 53 SER SER D . n A 1 54 ASP 54 54 54 ASP ASP D . n A 1 55 LEU 55 55 55 LEU LEU D . n A 1 56 THR 56 56 56 THR THR D . n A 1 57 VAL 57 57 57 VAL VAL D . n A 1 58 GLY 58 58 58 GLY GLY D . n A 1 59 GLN 59 59 59 GLN GLN D . n A 1 60 PHE 60 60 60 PHE PHE D . n A 1 61 TYR 61 61 61 TYR TYR D . n A 1 62 PHE 62 62 62 PHE PHE D . n A 1 63 LEU 63 63 63 LEU LEU D . n A 1 64 ILE 64 64 64 ILE ILE D . n A 1 65 ARG 65 65 65 ARG ARG D . n A 1 66 LYS 66 66 66 LYS LYS D . n A 1 67 ARG 67 67 67 ARG ARG D . n A 1 68 ILE 68 68 68 ILE ILE D . n A 1 69 HIS 69 69 69 HIS HIS D . n A 1 70 LEU 70 70 70 LEU LEU D . n A 1 71 ARG 71 71 71 ARG ARG D . n A 1 72 ALA 72 72 72 ALA ALA D . n A 1 73 GLU 73 73 73 GLU GLU D . n A 1 74 ASP 74 74 74 ASP ASP D . n A 1 75 ALA 75 75 75 ALA ALA D . n A 1 76 LEU 76 76 76 LEU LEU D . n A 1 77 PHE 77 77 77 PHE PHE D . n A 1 78 PHE 78 78 78 PHE PHE D . n A 1 79 PHE 79 79 79 PHE PHE D . n A 1 80 VAL 80 80 80 VAL VAL D . n A 1 81 ASN 81 81 81 ASN ASN D . n A 1 82 ASN 82 82 82 ASN ASN D . n A 1 83 VAL 83 83 83 VAL VAL D . n A 1 84 ILE 84 84 84 ILE ILE D . n A 1 85 PRO 85 85 85 PRO PRO D . n A 1 86 PRO 86 86 86 PRO PRO D . n A 1 87 THR 87 87 87 THR THR D . n A 1 88 SER 88 88 88 SER SER D . n A 1 89 ALA 89 89 89 ALA ALA D . n A 1 90 THR 90 90 90 THR THR D . n A 1 91 MET 91 91 91 MET MET D . n A 1 92 GLY 92 92 92 GLY GLY D . n A 1 93 GLN 93 93 93 GLN GLN D . n A 1 94 LEU 94 94 94 LEU LEU D . n A 1 95 TYR 95 95 95 TYR TYR D . n A 1 96 GLN 96 96 96 GLN GLN D . n A 1 97 GLU 97 97 97 GLU GLU D . n A 1 98 HIS 98 98 98 HIS HIS D . n A 1 99 HIS 99 99 99 HIS HIS D . n A 1 100 GLU 100 100 100 GLU GLU D . n A 1 101 GLU 101 101 101 GLU GLU D . n A 1 102 ASP 102 102 102 ASP ASP D . n A 1 103 PHE 103 103 103 PHE PHE D . n A 1 104 PHE 104 104 104 PHE PHE D . n A 1 105 LEU 105 105 105 LEU LEU D . n A 1 106 TYR 106 106 106 TYR TYR D . n A 1 107 ILE 107 107 107 ILE ILE D . n A 1 108 ALA 108 108 108 ALA ALA D . n A 1 109 TYR 109 109 109 TYR TYR D . n A 1 110 SER 110 110 110 SER SER D . n A 1 111 ASP 111 111 111 ASP ASP D . n A 1 112 GLU 112 112 112 GLU GLU D . n A 1 113 SER 113 113 113 SER SER D . n A 1 114 VAL 114 114 114 VAL VAL D . n A 1 115 TYR 115 115 115 TYR TYR D . n A 1 116 GLY 116 116 116 GLY GLY D . n A 1 117 LEU 117 117 117 LEU LEU D . n B 2 1 ASP 1 1987 1987 ASP ASP A . n B 2 2 ASP 2 1988 1988 ASP ASP A . n B 2 3 TRP 3 1989 1989 TRP TRP A . n B 2 4 THR 4 1990 1990 THR THR A . n B 2 5 GLU 5 1991 1991 GLU GLU A . n B 2 6 PHE 6 1992 1992 PHE PHE A . n B 2 7 SER 7 1993 1993 SER SER A . n B 2 8 SER 8 1994 1994 SER SER A . n B 2 9 GLU 9 1995 1995 GLU GLU A . n B 2 10 GLU 10 1996 1996 GLU GLU A . n B 2 11 ILE 11 1997 1997 ILE ILE A . n B 2 12 ARG 12 1998 1998 ARG ARG A . n B 2 13 GLU 13 1999 1999 GLU GLU A . n B 2 14 ALA 14 2000 2000 ALA ALA A . n B 2 15 ARG 15 2001 2001 ARG ARG A . n B 2 16 GLN 16 2002 2002 GLN GLN A . n B 2 17 ALA 17 2003 2003 ALA ALA A . n B 2 18 ALA 18 2004 2004 ALA ALA A . n B 2 19 ALA 19 2005 ? ? ? A . n B 2 20 SER 20 2006 ? ? ? A . n B 2 21 HIS 21 2007 ? ? ? A . n B 2 22 ALA 22 2008 ? ? ? A . n B 2 23 PRO 23 2009 ? ? ? A . n B 2 24 SER 24 2010 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 15 HOH HOH D . C 3 HOH 2 202 5 HOH HOH D . C 3 HOH 3 203 11 HOH HOH D . C 3 HOH 4 204 2 HOH HOH D . C 3 HOH 5 205 12 HOH HOH D . C 3 HOH 6 206 13 HOH HOH D . C 3 HOH 7 207 4 HOH HOH D . C 3 HOH 8 208 8 HOH HOH D . C 3 HOH 9 209 1 HOH HOH D . C 3 HOH 10 210 6 HOH HOH D . C 3 HOH 11 211 10 HOH HOH D . C 3 HOH 12 212 9 HOH HOH D . C 3 HOH 13 213 7 HOH HOH D . C 3 HOH 14 214 14 HOH HOH D . D 3 HOH 1 2101 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1580 ? 1 MORE -11 ? 1 'SSA (A^2)' 7200 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-26 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' database_2 5 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_database_2.pdbx_DOI' 3 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 4.6513 20.4539 114.9783 0.3638 0.1818 0.4334 -0.0529 0.0670 0.1028 4.2016 3.2845 1.5257 -1.6756 -1.1198 0.3464 0.0483 -0.2115 0.0826 -0.2310 -0.4587 -0.1748 -0.2137 0.3982 0.1436 'X-RAY DIFFRACTION' 2 ? refined 9.4056 32.1140 112.4756 0.1909 0.1748 0.2434 0.0115 0.0814 0.0723 1.6163 0.8107 0.9504 -0.7490 -0.2736 0.7744 -0.0151 -0.1871 0.1514 -0.1660 -0.2961 -0.5347 -0.3714 0.0998 0.1680 'X-RAY DIFFRACTION' 3 ? refined -4.7699 30.2998 115.4047 0.2188 0.2844 0.2413 -0.0690 0.0003 0.0125 4.9227 1.5659 2.6956 1.4305 -2.7960 -1.9399 -0.1999 0.3582 -0.1178 0.0937 0.2802 0.2200 -0.3571 0.2213 -0.2020 'X-RAY DIFFRACTION' 4 ? refined -9.0957 37.0099 116.8232 0.1445 0.3740 0.3391 0.0041 -0.0520 0.0824 4.9688 1.4744 1.9709 0.4837 -0.3482 1.0083 0.0524 0.0467 -0.0598 -0.2059 0.6487 0.2749 -0.1851 -0.0125 -0.3213 'X-RAY DIFFRACTION' 5 ? refined -14.2669 29.9266 120.4971 0.1574 0.4548 0.1540 -0.0823 -0.0212 0.0961 0.0509 0.4566 0.3108 0.1524 0.1256 0.3766 -0.0660 0.0101 -0.0614 0.0157 0.0695 0.0760 -0.1055 0.0768 -0.1585 'X-RAY DIFFRACTION' 6 ? refined -1.0637 33.9452 127.7662 0.2528 0.9376 0.2677 -0.0963 0.0164 -0.1199 1.5887 0.9478 0.3372 0.3999 -0.0336 -0.0823 0.0607 -0.0382 -0.0176 -0.4355 0.0605 -0.0641 0.0985 -0.0273 0.1190 'X-RAY DIFFRACTION' 7 ? refined 1.7175 29.7597 122.5070 0.1628 0.4235 0.2190 -0.0683 0.0439 0.1059 1.2076 0.1525 0.3810 0.1999 -0.6602 -0.1584 0.1209 -0.1077 -0.1172 -0.2348 0.0446 -0.0815 0.0516 -0.0590 0.1233 'X-RAY DIFFRACTION' 8 ? refined 0.9634 35.4044 106.2087 0.4907 0.3386 0.3394 0.0425 0.1303 0.1010 0.1691 0.0387 0.0543 0.0338 0.0887 0.0335 -0.1751 0.0127 0.1205 0.1967 0.0459 -0.1020 -0.2025 -0.0222 0.0555 'X-RAY DIFFRACTION' 9 ? refined -8.6612 46.2858 112.7272 0.4074 0.2865 0.5608 0.0862 0.0344 0.1044 2.0047 2.0138 8.4953 -1.6346 -0.4717 1.3437 0.3112 0.3244 -0.6251 0.0355 0.5990 0.3592 0.0991 -0.3895 -0.2693 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 D 1 D 10 ;chain 'D' and (resid 1 through 10 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 D 11 D 35 ;chain 'D' and (resid 11 through 35 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 D 36 D 56 ;chain 'D' and (resid 36 through 56 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 D 57 D 68 ;chain 'D' and (resid 57 through 68 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 D 69 D 79 ;chain 'D' and (resid 69 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 D 80 D 90 ;chain 'D' and (resid 80 through 90 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 D 91 D 117 ;chain 'D' and (resid 91 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 0 A 0 ;chain 'A' and (resid 1987 through 1993 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 0 A 0 ;chain 'A' and (resid 1994 through 2004 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 D _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 40 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD2 _pdbx_validate_symm_contact.auth_asym_id_2 D _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 74 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_656 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id D _pdbx_validate_torsion.auth_seq_id 69 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 66.61 _pdbx_validate_torsion.psi 92.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 D LYS 2 ? CG ? A LYS 2 CG 2 1 Y 1 D LYS 2 ? CD ? A LYS 2 CD 3 1 Y 1 D LYS 2 ? CE ? A LYS 2 CE 4 1 Y 1 D LYS 2 ? NZ ? A LYS 2 NZ 5 1 Y 1 D GLU 7 ? CG ? A GLU 7 CG 6 1 Y 1 D GLU 7 ? CD ? A GLU 7 CD 7 1 Y 1 D GLU 7 ? OE1 ? A GLU 7 OE1 8 1 Y 1 D GLU 7 ? OE2 ? A GLU 7 OE2 9 1 Y 1 D GLU 12 ? CG ? A GLU 12 CG 10 1 Y 1 D GLU 12 ? CD ? A GLU 12 CD 11 1 Y 1 D GLU 12 ? OE1 ? A GLU 12 OE1 12 1 Y 1 D GLU 12 ? OE2 ? A GLU 12 OE2 13 1 Y 1 D LYS 13 ? CE ? A LYS 13 CE 14 1 Y 1 D LYS 13 ? NZ ? A LYS 13 NZ 15 1 Y 1 D LYS 20 ? CG ? A LYS 20 CG 16 1 Y 1 D LYS 20 ? CD ? A LYS 20 CD 17 1 Y 1 D LYS 20 ? CE ? A LYS 20 CE 18 1 Y 1 D LYS 20 ? NZ ? A LYS 20 NZ 19 1 Y 1 D LYS 24 ? CD ? A LYS 24 CD 20 1 Y 1 D LYS 24 ? CE ? A LYS 24 CE 21 1 Y 1 D LYS 24 ? NZ ? A LYS 24 NZ 22 1 Y 1 D ASP 45 ? CG ? A ASP 45 CG 23 1 Y 1 D ASP 45 ? OD1 ? A ASP 45 OD1 24 1 Y 1 D ASP 45 ? OD2 ? A ASP 45 OD2 25 1 Y 1 D LYS 46 ? CE ? A LYS 46 CE 26 1 Y 1 D LYS 46 ? NZ ? A LYS 46 NZ 27 1 Y 1 D LYS 66 ? CE ? A LYS 66 CE 28 1 Y 1 D LYS 66 ? NZ ? A LYS 66 NZ 29 1 Y 1 D GLU 73 ? CG ? A GLU 73 CG 30 1 Y 1 D GLU 73 ? CD ? A GLU 73 CD 31 1 Y 1 D GLU 73 ? OE1 ? A GLU 73 OE1 32 1 Y 1 D GLU 73 ? OE2 ? A GLU 73 OE2 33 1 Y 1 D GLU 97 ? CG ? A GLU 97 CG 34 1 Y 1 D GLU 97 ? CD ? A GLU 97 CD 35 1 Y 1 D GLU 97 ? OE1 ? A GLU 97 OE1 36 1 Y 1 D GLU 97 ? OE2 ? A GLU 97 OE2 37 1 Y 1 D GLU 101 ? CG ? A GLU 101 CG 38 1 Y 1 D GLU 101 ? CD ? A GLU 101 CD 39 1 Y 1 D GLU 101 ? OE1 ? A GLU 101 OE1 40 1 Y 1 D GLU 101 ? OE2 ? A GLU 101 OE2 41 1 Y 1 A GLU 1995 ? CG ? B GLU 9 CG 42 1 Y 1 A GLU 1995 ? CD ? B GLU 9 CD 43 1 Y 1 A GLU 1995 ? OE1 ? B GLU 9 OE1 44 1 Y 1 A GLU 1995 ? OE2 ? B GLU 9 OE2 45 1 Y 1 A ARG 2001 ? CG ? B ARG 15 CG 46 1 Y 1 A ARG 2001 ? CD ? B ARG 15 CD 47 1 Y 1 A ARG 2001 ? NE ? B ARG 15 NE 48 1 Y 1 A ARG 2001 ? CZ ? B ARG 15 CZ 49 1 Y 1 A ARG 2001 ? NH1 ? B ARG 15 NH1 50 1 Y 1 A ARG 2001 ? NH2 ? B ARG 15 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 2005 ? B ALA 19 2 1 Y 1 A SER 2006 ? B SER 20 3 1 Y 1 A HIS 2007 ? B HIS 21 4 1 Y 1 A ALA 2008 ? B ALA 22 5 1 Y 1 A PRO 2009 ? B PRO 23 6 1 Y 1 A SER 2010 ? B SER 24 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Research Grants Council' _pdbx_audit_support.country 'Hong Kong' _pdbx_audit_support.grant_number AoE-M09-12 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KJT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #