data_6AAW # _entry.id 6AAW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AAW pdb_00006aaw 10.2210/pdb6aaw/pdb WWPDB D_1300008416 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 2 0 2023-04-05 3 'Structure model' 3 0 2023-11-15 4 'Structure model' 3 1 2023-11-29 5 'Structure model' 3 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' 'Polymer sequence' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Atomic model' 11 3 'Structure model' 'Data collection' 12 3 'Structure model' 'Derived calculations' 13 4 'Structure model' 'Refinement description' 14 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' database_2 4 2 'Structure model' entity 5 2 'Structure model' entity_poly 6 2 'Structure model' entity_poly_seq 7 2 'Structure model' entity_src_gen 8 2 'Structure model' pdbx_entity_src_syn 9 2 'Structure model' pdbx_poly_seq_scheme 10 2 'Structure model' pdbx_unobs_or_zero_occ_residues 11 2 'Structure model' pdbx_validate_close_contact 12 2 'Structure model' pdbx_validate_torsion 13 2 'Structure model' struct_conn 14 2 'Structure model' struct_ref_seq 15 3 'Structure model' atom_site 16 3 'Structure model' chem_comp_atom 17 3 'Structure model' chem_comp_bond 18 3 'Structure model' struct_conn 19 4 'Structure model' pdbx_initial_refinement_model 20 5 'Structure model' pdbx_entry_details 21 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_comp_id' 2 2 'Structure model' '_atom_site.label_comp_id' 3 2 'Structure model' '_chem_comp.formula' 4 2 'Structure model' '_chem_comp.formula_weight' 5 2 'Structure model' '_chem_comp.id' 6 2 'Structure model' '_chem_comp.name' 7 2 'Structure model' '_database_2.pdbx_DOI' 8 2 'Structure model' '_database_2.pdbx_database_accession' 9 2 'Structure model' '_entity.details' 10 2 'Structure model' '_entity.formula_weight' 11 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 12 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 13 2 'Structure model' '_entity_src_gen.gene_src_common_name' 14 2 'Structure model' '_pdbx_entity_src_syn.pdbx_end_seq_num' 15 2 'Structure model' '_struct_ref_seq.db_align_end' 16 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 17 2 'Structure model' '_struct_ref_seq.seq_align_end' 18 3 'Structure model' '_atom_site.auth_atom_id' 19 3 'Structure model' '_atom_site.label_atom_id' 20 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AAW _pdbx_database_status.recvd_initial_deposition_date 2018-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brown, C.J.' 1 ? 'Partridge, A.W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;A Model System to Explore Macrocyclic Peptide Structural and Chirality Relationships: Tolerance of helix-breaking residues within the context of a stapled peptide. ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Partridge, A.W.' 1 ? primary 'Hung, Y.K.K.' 2 ? primary 'Juang, Y.' 3 ? primary 'Sadruddin, A.' 4 ? primary 'Lim, S.' 5 ? primary 'Brown, C.J.' 6 ? primary 'Ng, S.' 7 ? primary 'Thean, D.' 8 ? primary 'Ferrer, F.' 9 ? primary 'Johannes, C.' 10 ? primary 'Yuen, T.Y.' 11 ? primary 'Kannan, S.' 12 ? primary 'Aronica, P.' 13 ? primary 'Tan, Y.S.' 14 ? primary 'Mohan, P.R.' 15 ? primary 'Verma, C.S.' 16 ? primary 'Hichman, J.' 17 ? primary 'Chen, S.' 18 ? primary 'Wan, H.' 19 ? primary 'Lane, D.P.' 20 ? primary 'Sawyer, T.K.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase Mdm2' 13749.694 1 2.3.2.27 ? 'UNP residues 6-125' ? 2 polymer syn ACE-LEU-THR-PHE-STQ-GLU-TYR-DTR-GLN-LEU-CBA-MK8-SER-ALA-ALA 1774.130 1 ? ? ? ;Chemically synthesized Helically Stabilized Peptide Designed to disrupt the Mdm2/p53 protein:protein interaction. Template sequence before incorporation of non natural amino acids was derived from M13 phage display. ; 3 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING-type E3 ubiquitin transferase Mdm2,p53-binding protein Mdm2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLG DLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; ;GPMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLG DLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; A ? 2 'polypeptide(L)' no yes '(ACE)LTF(0EH)EY(DTR)QL(2JH)(MK8)SAA(NH2)' XLTFXEYWQLXLSAAX B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 SER n 1 5 VAL n 1 6 PRO n 1 7 THR n 1 8 ASP n 1 9 GLY n 1 10 ALA n 1 11 VAL n 1 12 THR n 1 13 THR n 1 14 SER n 1 15 GLN n 1 16 ILE n 1 17 PRO n 1 18 ALA n 1 19 SER n 1 20 GLU n 1 21 GLN n 1 22 GLU n 1 23 THR n 1 24 LEU n 1 25 VAL n 1 26 ARG n 1 27 PRO n 1 28 LYS n 1 29 PRO n 1 30 LEU n 1 31 LEU n 1 32 LEU n 1 33 LYS n 1 34 LEU n 1 35 LEU n 1 36 LYS n 1 37 SER n 1 38 VAL n 1 39 GLY n 1 40 ALA n 1 41 GLN n 1 42 LYS n 1 43 ASP n 1 44 THR n 1 45 TYR n 1 46 THR n 1 47 MET n 1 48 LYS n 1 49 GLU n 1 50 VAL n 1 51 LEU n 1 52 PHE n 1 53 TYR n 1 54 LEU n 1 55 GLY n 1 56 GLN n 1 57 TYR n 1 58 ILE n 1 59 MET n 1 60 THR n 1 61 LYS n 1 62 ARG n 1 63 LEU n 1 64 TYR n 1 65 ASP n 1 66 GLU n 1 67 LYS n 1 68 GLN n 1 69 GLN n 1 70 HIS n 1 71 ILE n 1 72 VAL n 1 73 TYR n 1 74 CYS n 1 75 SER n 1 76 ASN n 1 77 ASP n 1 78 LEU n 1 79 LEU n 1 80 GLY n 1 81 ASP n 1 82 LEU n 1 83 PHE n 1 84 GLY n 1 85 VAL n 1 86 PRO n 1 87 SER n 1 88 PHE n 1 89 SER n 1 90 VAL n 1 91 LYS n 1 92 GLU n 1 93 HIS n 1 94 ARG n 1 95 LYS n 1 96 ILE n 1 97 TYR n 1 98 THR n 1 99 MET n 1 100 ILE n 1 101 TYR n 1 102 ARG n 1 103 ASN n 1 104 LEU n 1 105 VAL n 1 106 VAL n 1 107 VAL n 1 108 ASN n 1 109 GLN n 1 110 GLN n 1 111 GLU n 1 112 SER n 1 113 SER n 1 114 ASP n 1 115 SER n 1 116 GLY n 1 117 THR n 1 118 SER n 1 119 VAL n 1 120 SER n 1 121 GLU n 1 122 ASN n 2 1 ACE n 2 2 LEU n 2 3 THR n 2 4 PHE n 2 5 0EH n 2 6 GLU n 2 7 TYR n 2 8 DTR n 2 9 GLN n 2 10 LEU n 2 11 2JH n 2 12 MK8 n 2 13 SER n 2 14 ALA n 2 15 ALA n 2 16 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MDM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'Enterobacteria phage M13' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 10870 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0EH 'D-peptide linking' . '(2R)-2-amino-2-methylnonanoic acid' ? 'C10 H21 N O2' 187.279 2JH 'L-peptide linking' . 3-cyclobutyl-L-alanine ? 'C7 H13 N O2' 143.184 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTR 'D-peptide linking' . D-TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MK8 'L-peptide linking' n 2-methyl-L-norleucine ? 'C7 H15 N O2' 145.199 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 4 ? ? ? A . n A 1 2 PRO 2 5 ? ? ? A . n A 1 3 MET 3 6 ? ? ? A . n A 1 4 SER 4 7 ? ? ? A . n A 1 5 VAL 5 8 ? ? ? A . n A 1 6 PRO 6 9 ? ? ? A . n A 1 7 THR 7 10 ? ? ? A . n A 1 8 ASP 8 11 ? ? ? A . n A 1 9 GLY 9 12 ? ? ? A . n A 1 10 ALA 10 13 ? ? ? A . n A 1 11 VAL 11 14 ? ? ? A . n A 1 12 THR 12 15 ? ? ? A . n A 1 13 THR 13 16 ? ? ? A . n A 1 14 SER 14 17 ? ? ? A . n A 1 15 GLN 15 18 ? ? ? A . n A 1 16 ILE 16 19 ? ? ? A . n A 1 17 PRO 17 20 ? ? ? A . n A 1 18 ALA 18 21 ? ? ? A . n A 1 19 SER 19 22 ? ? ? A . n A 1 20 GLU 20 23 ? ? ? A . n A 1 21 GLN 21 24 ? ? ? A . n A 1 22 GLU 22 25 ? ? ? A . n A 1 23 THR 23 26 26 THR THR A . n A 1 24 LEU 24 27 27 LEU LEU A . n A 1 25 VAL 25 28 28 VAL VAL A . n A 1 26 ARG 26 29 29 ARG ARG A . n A 1 27 PRO 27 30 30 PRO PRO A . n A 1 28 LYS 28 31 31 LYS LYS A . n A 1 29 PRO 29 32 32 PRO PRO A . n A 1 30 LEU 30 33 33 LEU LEU A . n A 1 31 LEU 31 34 34 LEU LEU A . n A 1 32 LEU 32 35 35 LEU LEU A . n A 1 33 LYS 33 36 36 LYS LYS A . n A 1 34 LEU 34 37 37 LEU LEU A . n A 1 35 LEU 35 38 38 LEU LEU A . n A 1 36 LYS 36 39 39 LYS LYS A . n A 1 37 SER 37 40 40 SER SER A . n A 1 38 VAL 38 41 41 VAL VAL A . n A 1 39 GLY 39 42 42 GLY GLY A . n A 1 40 ALA 40 43 43 ALA ALA A . n A 1 41 GLN 41 44 44 GLN GLN A . n A 1 42 LYS 42 45 45 LYS LYS A . n A 1 43 ASP 43 46 46 ASP ASP A . n A 1 44 THR 44 47 47 THR THR A . n A 1 45 TYR 45 48 48 TYR TYR A . n A 1 46 THR 46 49 49 THR THR A . n A 1 47 MET 47 50 50 MET MET A . n A 1 48 LYS 48 51 51 LYS LYS A . n A 1 49 GLU 49 52 52 GLU GLU A . n A 1 50 VAL 50 53 53 VAL VAL A . n A 1 51 LEU 51 54 54 LEU LEU A . n A 1 52 PHE 52 55 55 PHE PHE A . n A 1 53 TYR 53 56 56 TYR TYR A . n A 1 54 LEU 54 57 57 LEU LEU A . n A 1 55 GLY 55 58 58 GLY GLY A . n A 1 56 GLN 56 59 59 GLN GLN A . n A 1 57 TYR 57 60 60 TYR TYR A . n A 1 58 ILE 58 61 61 ILE ILE A . n A 1 59 MET 59 62 62 MET MET A . n A 1 60 THR 60 63 63 THR THR A . n A 1 61 LYS 61 64 64 LYS LYS A . n A 1 62 ARG 62 65 65 ARG ARG A . n A 1 63 LEU 63 66 66 LEU LEU A . n A 1 64 TYR 64 67 67 TYR TYR A . n A 1 65 ASP 65 68 68 ASP ASP A . n A 1 66 GLU 66 69 69 GLU GLU A . n A 1 67 LYS 67 70 70 LYS LYS A . n A 1 68 GLN 68 71 71 GLN GLN A . n A 1 69 GLN 69 72 72 GLN GLN A . n A 1 70 HIS 70 73 73 HIS HIS A . n A 1 71 ILE 71 74 74 ILE ILE A . n A 1 72 VAL 72 75 75 VAL VAL A . n A 1 73 TYR 73 76 76 TYR TYR A . n A 1 74 CYS 74 77 77 CYS CYS A . n A 1 75 SER 75 78 78 SER SER A . n A 1 76 ASN 76 79 79 ASN ASN A . n A 1 77 ASP 77 80 80 ASP ASP A . n A 1 78 LEU 78 81 81 LEU LEU A . n A 1 79 LEU 79 82 82 LEU LEU A . n A 1 80 GLY 80 83 83 GLY GLY A . n A 1 81 ASP 81 84 84 ASP ASP A . n A 1 82 LEU 82 85 85 LEU LEU A . n A 1 83 PHE 83 86 86 PHE PHE A . n A 1 84 GLY 84 87 87 GLY GLY A . n A 1 85 VAL 85 88 88 VAL VAL A . n A 1 86 PRO 86 89 89 PRO PRO A . n A 1 87 SER 87 90 90 SER SER A . n A 1 88 PHE 88 91 91 PHE PHE A . n A 1 89 SER 89 92 92 SER SER A . n A 1 90 VAL 90 93 93 VAL VAL A . n A 1 91 LYS 91 94 94 LYS LYS A . n A 1 92 GLU 92 95 95 GLU GLU A . n A 1 93 HIS 93 96 96 HIS HIS A . n A 1 94 ARG 94 97 97 ARG ARG A . n A 1 95 LYS 95 98 98 LYS LYS A . n A 1 96 ILE 96 99 99 ILE ILE A . n A 1 97 TYR 97 100 100 TYR TYR A . n A 1 98 THR 98 101 101 THR THR A . n A 1 99 MET 99 102 102 MET MET A . n A 1 100 ILE 100 103 103 ILE ILE A . n A 1 101 TYR 101 104 104 TYR TYR A . n A 1 102 ARG 102 105 105 ARG ARG A . n A 1 103 ASN 103 106 106 ASN ASN A . n A 1 104 LEU 104 107 107 LEU LEU A . n A 1 105 VAL 105 108 108 VAL VAL A . n A 1 106 VAL 106 109 109 VAL VAL A . n A 1 107 VAL 107 110 110 VAL VAL A . n A 1 108 ASN 108 111 111 ASN ASN A . n A 1 109 GLN 109 112 ? ? ? A . n A 1 110 GLN 110 113 ? ? ? A . n A 1 111 GLU 111 114 ? ? ? A . n A 1 112 SER 112 115 ? ? ? A . n A 1 113 SER 113 116 ? ? ? A . n A 1 114 ASP 114 117 ? ? ? A . n A 1 115 SER 115 118 ? ? ? A . n A 1 116 GLY 116 119 ? ? ? A . n A 1 117 THR 117 120 ? ? ? A . n A 1 118 SER 118 121 ? ? ? A . n A 1 119 VAL 119 122 ? ? ? A . n A 1 120 SER 120 123 ? ? ? A . n A 1 121 GLU 121 124 ? ? ? A . n A 1 122 ASN 122 125 ? ? ? A . n B 2 1 ACE 1 0 0 ACE ACE B . n B 2 2 LEU 2 1 1 LEU LEU B . n B 2 3 THR 3 2 2 THR THR B . n B 2 4 PHE 4 3 3 PHE PHE B . n B 2 5 0EH 5 4 4 0EH STQ B . n B 2 6 GLU 6 5 5 GLU GLU B . n B 2 7 TYR 7 6 6 TYR TYR B . n B 2 8 DTR 8 7 7 DTR DTR B . n B 2 9 GLN 9 8 8 GLN GLN B . n B 2 10 LEU 10 9 9 LEU LEU B . n B 2 11 2JH 11 10 10 2JH CBA B . n B 2 12 MK8 12 11 11 MK8 MK8 B . n B 2 13 SER 13 12 12 SER SER B . n B 2 14 ALA 14 13 13 ALA ALA B . n B 2 15 ALA 15 14 14 ALA ALA B . n B 2 16 NH2 16 16 15 NH2 NME B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 35 HOH HOH A . C 3 HOH 2 202 21 HOH HOH A . C 3 HOH 3 203 6 HOH HOH A . C 3 HOH 4 204 13 HOH HOH A . C 3 HOH 5 205 7 HOH HOH A . C 3 HOH 6 206 14 HOH HOH A . C 3 HOH 7 207 23 HOH HOH A . C 3 HOH 8 208 15 HOH HOH A . C 3 HOH 9 209 22 HOH HOH A . C 3 HOH 10 210 32 HOH HOH A . C 3 HOH 11 211 11 HOH HOH A . C 3 HOH 12 212 16 HOH HOH A . C 3 HOH 13 213 29 HOH HOH A . C 3 HOH 14 214 2 HOH HOH A . C 3 HOH 15 215 34 HOH HOH A . C 3 HOH 16 216 20 HOH HOH A . C 3 HOH 17 217 17 HOH HOH A . C 3 HOH 18 218 40 HOH HOH A . C 3 HOH 19 219 18 HOH HOH A . C 3 HOH 20 220 28 HOH HOH A . C 3 HOH 21 221 33 HOH HOH A . C 3 HOH 22 222 5 HOH HOH A . C 3 HOH 23 223 8 HOH HOH A . C 3 HOH 24 224 3 HOH HOH A . C 3 HOH 25 225 10 HOH HOH A . C 3 HOH 26 226 19 HOH HOH A . C 3 HOH 27 227 27 HOH HOH A . C 3 HOH 28 228 24 HOH HOH A . C 3 HOH 29 229 37 HOH HOH A . C 3 HOH 30 230 30 HOH HOH A . C 3 HOH 31 231 38 HOH HOH A . D 3 HOH 1 101 26 HOH HOH B . D 3 HOH 2 102 36 HOH HOH B . D 3 HOH 3 103 12 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0189 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PARROT ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 94.82 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6AAW _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.946 _cell.length_a_esd ? _cell.length_b 43.378 _cell.length_b_esd ? _cell.length_c 34.542 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AAW _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AAW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 % w/v Polyethylene glycol 8,000, 100 mM HEPES pH 7.5, 200 mM Ammonium sulfate, 10 % v/v 2-Propanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-08-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95372 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95372 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6AAW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 40.33 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8132 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs 0.246 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.267 _reflns.pdbx_Rpim_I_all 0.105 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1118 _reflns_shell.percent_possible_all 95.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.211 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.324 _reflns_shell.pdbx_Rpim_I_all 0.528 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.55 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -1.40 _refine.aniso_B[2][2] 0.08 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.70 _refine.B_iso_max ? _refine.B_iso_mean 26.041 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AAW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 40.33 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7710 _refine.ls_number_reflns_R_free 422 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.27 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18637 _refine.ls_R_factor_R_free 0.22336 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18412 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4umn _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.172 _refine.pdbx_overall_ESU_R_Free 0.154 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.524 _refine.overall_SU_ML 0.125 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 839 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 873 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 40.33 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.020 864 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 852 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.202 2.062 1170 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.087 3.000 1973 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.947 5.000 95 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 43.023 23.529 34 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.541 15.000 157 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 24.467 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.347 0.200 133 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 902 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 172 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.753 2.436 395 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.747 2.427 393 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.794 3.627 491 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.793 3.626 491 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.126 2.680 469 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.124 2.683 470 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.608 3.922 676 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.768 27.625 961 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.701 27.582 960 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 536 _refine_ls_shell.percent_reflns_obs 90.47 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.268 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.209 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6AAW _struct.title 'Mdm2 in complex with a D amino Acid Containing Stapled Peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AAW _struct_keywords.text 'E3 ligase, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MDM2_HUMAN Q00987 ? 1 ;MSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDL FGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN ; 6 2 PDB 6AAW 6AAW ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6AAW A 3 ? 122 ? Q00987 6 ? 125 ? 6 125 2 2 6AAW B 1 ? 16 ? 6AAW 0 ? 16 ? 0 16 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AAW GLY A 1 ? UNP Q00987 ? ? 'expression tag' 4 1 1 6AAW PRO A 2 ? UNP Q00987 ? ? 'expression tag' 5 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1530 ? 1 MORE -11 ? 1 'SSA (A^2)' 5930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 28 ? VAL A 38 ? LYS A 31 VAL A 41 1 ? 11 HELX_P HELX_P2 AA2 MET A 47 ? LYS A 61 ? MET A 50 LYS A 64 1 ? 15 HELX_P HELX_P3 AA3 ASP A 77 ? GLY A 84 ? ASP A 80 GLY A 87 1 ? 8 HELX_P HELX_P4 AA4 GLU A 92 ? ARG A 102 ? GLU A 95 ARG A 105 1 ? 11 HELX_P HELX_P5 AA5 THR B 3 ? PHE B 4 ? THR B 2 PHE B 3 5 ? 2 HELX_P HELX_P6 AA6 GLU B 6 ? GLU B 6 ? GLU B 5 GLU B 5 5 ? 1 HELX_P HELX_P7 AA7 TYR B 7 ? 2JH B 11 ? TYR B 6 2JH B 10 1 ? 5 HELX_P HELX_P8 AA8 SER B 13 ? ALA B 14 ? SER B 12 ALA B 13 1 ? 2 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B LEU 2 N ? ? B ACE 0 B LEU 1 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale2 covale both ? B PHE 4 C ? ? ? 1_555 B 0EH 5 N ? ? B PHE 3 B 0EH 4 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale3 covale both ? B 0EH 5 C ? ? ? 1_555 B GLU 6 N ? ? B 0EH 4 B GLU 5 1_555 ? ? ? ? ? ? ? 1.281 ? ? covale4 covale both ? B TYR 7 C ? ? ? 1_555 B DTR 8 N ? ? B TYR 6 B DTR 7 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? B DTR 8 C ? ? ? 1_555 B GLN 9 N ? ? B DTR 7 B GLN 8 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale6 covale both ? B LEU 10 C ? ? ? 1_555 B 2JH 11 N ? ? B LEU 9 B 2JH 10 1_555 ? ? ? ? ? ? ? 1.276 ? ? covale7 covale both ? B 2JH 11 C ? ? ? 1_555 B MK8 12 N ? ? B 2JH 10 B MK8 11 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale8 covale both ? B MK8 12 C ? ? ? 1_555 B SER 13 N ? ? B MK8 11 B SER 12 1_555 ? ? ? ? ? ? ? 1.286 ? ? covale9 covale both ? B ALA 15 C ? ? ? 1_555 B NH2 16 N ? ? B ALA 14 B NH2 16 1_555 ? ? ? ? ? ? ? 1.432 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MK8 B 12 ? . . . . MK8 B 11 ? 1_555 . . . . . . . LEU 1 MK8 Norleucine 'Named protein modification' 2 MK8 B 12 ? . . . . MK8 B 11 ? 1_555 . . . . . . . LEU 2 MK8 Methylation 'Named protein modification' 3 0EH B 5 ? . . . . 0EH B 4 ? 1_555 . . . . . . . ? 1 0EH None 'Non-standard residue' 4 2JH B 11 ? . . . . 2JH B 10 ? 1_555 . . . . . . . ? 1 2JH None 'Non-standard residue' 5 ACE B 1 ? LEU B 2 ? ACE B 0 ? 1_555 LEU B 1 ? 1_555 . . LEU 14 ACE None 'Terminal acetylation' 6 NH2 B 16 ? ALA B 15 ? NH2 B 16 ? 1_555 ALA B 14 ? 1_555 . . ALA 1 NH2 None 'Terminal amidation' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 45 ? THR A 46 ? TYR A 48 THR A 49 AA1 2 LEU A 24 ? PRO A 27 ? LEU A 27 PRO A 30 AA1 3 LEU A 104 ? VAL A 106 ? LEU A 107 VAL A 109 AA2 1 ILE A 71 ? TYR A 73 ? ILE A 74 TYR A 76 AA2 2 SER A 87 ? SER A 89 ? SER A 90 SER A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 45 ? O TYR A 48 N VAL A 25 ? N VAL A 28 AA1 2 3 N ARG A 26 ? N ARG A 29 O VAL A 105 ? O VAL A 108 AA2 1 2 N VAL A 72 ? N VAL A 75 O PHE A 88 ? O PHE A 91 # _pdbx_entry_details.entry_id 6AAW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 CAT _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 0EH _pdbx_validate_close_contact.auth_seq_id_1 4 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CE _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 MK8 _pdbx_validate_close_contact.auth_seq_id_2 11 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 4 ? A GLY 1 2 1 Y 1 A PRO 5 ? A PRO 2 3 1 Y 1 A MET 6 ? A MET 3 4 1 Y 1 A SER 7 ? A SER 4 5 1 Y 1 A VAL 8 ? A VAL 5 6 1 Y 1 A PRO 9 ? A PRO 6 7 1 Y 1 A THR 10 ? A THR 7 8 1 Y 1 A ASP 11 ? A ASP 8 9 1 Y 1 A GLY 12 ? A GLY 9 10 1 Y 1 A ALA 13 ? A ALA 10 11 1 Y 1 A VAL 14 ? A VAL 11 12 1 Y 1 A THR 15 ? A THR 12 13 1 Y 1 A THR 16 ? A THR 13 14 1 Y 1 A SER 17 ? A SER 14 15 1 Y 1 A GLN 18 ? A GLN 15 16 1 Y 1 A ILE 19 ? A ILE 16 17 1 Y 1 A PRO 20 ? A PRO 17 18 1 Y 1 A ALA 21 ? A ALA 18 19 1 Y 1 A SER 22 ? A SER 19 20 1 Y 1 A GLU 23 ? A GLU 20 21 1 Y 1 A GLN 24 ? A GLN 21 22 1 Y 1 A GLU 25 ? A GLU 22 23 1 Y 1 A GLN 112 ? A GLN 109 24 1 Y 1 A GLN 113 ? A GLN 110 25 1 Y 1 A GLU 114 ? A GLU 111 26 1 Y 1 A SER 115 ? A SER 112 27 1 Y 1 A SER 116 ? A SER 113 28 1 Y 1 A ASP 117 ? A ASP 114 29 1 Y 1 A SER 118 ? A SER 115 30 1 Y 1 A GLY 119 ? A GLY 116 31 1 Y 1 A THR 120 ? A THR 117 32 1 Y 1 A SER 121 ? A SER 118 33 1 Y 1 A VAL 122 ? A VAL 119 34 1 Y 1 A SER 123 ? A SER 120 35 1 Y 1 A GLU 124 ? A GLU 121 36 1 Y 1 A ASN 125 ? A ASN 122 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0EH O O N N 1 0EH C C N N 2 0EH CA C N R 3 0EH CAA C N N 4 0EH CAB C N N 5 0EH N N N N 6 0EH CAO C N N 7 0EH CAP C N N 8 0EH CAQ C N N 9 0EH CAR C N N 10 0EH CAS C N N 11 0EH CAT C N N 12 0EH H1 H N N 13 0EH H3 H N N 14 0EH H4 H N N 15 0EH H5 H N N 16 0EH H6 H N N 17 0EH H H N N 18 0EH H2 H N N 19 0EH H10 H N N 20 0EH H11 H N N 21 0EH H12 H N N 22 0EH H13 H N N 23 0EH H14 H N N 24 0EH H15 H N N 25 0EH H16 H N N 26 0EH H17 H N N 27 0EH H18 H N N 28 0EH H19 H N N 29 0EH H20 H N N 30 0EH H21 H N N 31 0EH H22 H N N 32 0EH OXT O N N 33 0EH HXT H N N 34 2JH N N N N 35 2JH CA C N S 36 2JH CB C N N 37 2JH C C N N 38 2JH O O N N 39 2JH CG C N N 40 2JH CD1 C N N 41 2JH CD2 C N N 42 2JH CE C N N 43 2JH H H N N 44 2JH H2 H N N 45 2JH HA H N N 46 2JH H5 H N N 47 2JH H6 H N N 48 2JH H8 H N N 49 2JH H9 H N N 50 2JH H10 H N N 51 2JH H11 H N N 52 2JH H12 H N N 53 2JH H13 H N N 54 2JH H14 H N N 55 2JH OXT O N N 56 2JH HXT H N N 57 ACE C C N N 58 ACE O O N N 59 ACE CH3 C N N 60 ACE H H N N 61 ACE H1 H N N 62 ACE H2 H N N 63 ACE H3 H N N 64 ALA N N N N 65 ALA CA C N S 66 ALA C C N N 67 ALA O O N N 68 ALA CB C N N 69 ALA OXT O N N 70 ALA H H N N 71 ALA H2 H N N 72 ALA HA H N N 73 ALA HB1 H N N 74 ALA HB2 H N N 75 ALA HB3 H N N 76 ALA HXT H N N 77 ARG N N N N 78 ARG CA C N S 79 ARG C C N N 80 ARG O O N N 81 ARG CB C N N 82 ARG CG C N N 83 ARG CD C N N 84 ARG NE N N N 85 ARG CZ C N N 86 ARG NH1 N N N 87 ARG NH2 N N N 88 ARG OXT O N N 89 ARG H H N N 90 ARG H2 H N N 91 ARG HA H N N 92 ARG HB2 H N N 93 ARG HB3 H N N 94 ARG HG2 H N N 95 ARG HG3 H N N 96 ARG HD2 H N N 97 ARG HD3 H N N 98 ARG HE H N N 99 ARG HH11 H N N 100 ARG HH12 H N N 101 ARG HH21 H N N 102 ARG HH22 H N N 103 ARG HXT H N N 104 ASN N N N N 105 ASN CA C N S 106 ASN C C N N 107 ASN O O N N 108 ASN CB C N N 109 ASN CG C N N 110 ASN OD1 O N N 111 ASN ND2 N N N 112 ASN OXT O N N 113 ASN H H N N 114 ASN H2 H N N 115 ASN HA H N N 116 ASN HB2 H N N 117 ASN HB3 H N N 118 ASN HD21 H N N 119 ASN HD22 H N N 120 ASN HXT H N N 121 ASP N N N N 122 ASP CA C N S 123 ASP C C N N 124 ASP O O N N 125 ASP CB C N N 126 ASP CG C N N 127 ASP OD1 O N N 128 ASP OD2 O N N 129 ASP OXT O N N 130 ASP H H N N 131 ASP H2 H N N 132 ASP HA H N N 133 ASP HB2 H N N 134 ASP HB3 H N N 135 ASP HD2 H N N 136 ASP HXT H N N 137 CYS N N N N 138 CYS CA C N R 139 CYS C C N N 140 CYS O O N N 141 CYS CB C N N 142 CYS SG S N N 143 CYS OXT O N N 144 CYS H H N N 145 CYS H2 H N N 146 CYS HA H N N 147 CYS HB2 H N N 148 CYS HB3 H N N 149 CYS HG H N N 150 CYS HXT H N N 151 DTR N N N N 152 DTR CA C N R 153 DTR CB C N N 154 DTR CG C Y N 155 DTR CD1 C Y N 156 DTR NE1 N Y N 157 DTR CE2 C Y N 158 DTR CZ2 C Y N 159 DTR CH2 C Y N 160 DTR CZ3 C Y N 161 DTR CE3 C Y N 162 DTR CD2 C Y N 163 DTR C C N N 164 DTR O O N N 165 DTR OXT O N N 166 DTR H H N N 167 DTR H2 H N N 168 DTR HA H N N 169 DTR HB2 H N N 170 DTR HB3 H N N 171 DTR HD1 H N N 172 DTR HE1 H N N 173 DTR HZ2 H N N 174 DTR HH2 H N N 175 DTR HZ3 H N N 176 DTR HE3 H N N 177 DTR HXT H N N 178 GLN N N N N 179 GLN CA C N S 180 GLN C C N N 181 GLN O O N N 182 GLN CB C N N 183 GLN CG C N N 184 GLN CD C N N 185 GLN OE1 O N N 186 GLN NE2 N N N 187 GLN OXT O N N 188 GLN H H N N 189 GLN H2 H N N 190 GLN HA H N N 191 GLN HB2 H N N 192 GLN HB3 H N N 193 GLN HG2 H N N 194 GLN HG3 H N N 195 GLN HE21 H N N 196 GLN HE22 H N N 197 GLN HXT H N N 198 GLU N N N N 199 GLU CA C N S 200 GLU C C N N 201 GLU O O N N 202 GLU CB C N N 203 GLU CG C N N 204 GLU CD C N N 205 GLU OE1 O N N 206 GLU OE2 O N N 207 GLU OXT O N N 208 GLU H H N N 209 GLU H2 H N N 210 GLU HA H N N 211 GLU HB2 H N N 212 GLU HB3 H N N 213 GLU HG2 H N N 214 GLU HG3 H N N 215 GLU HE2 H N N 216 GLU HXT H N N 217 GLY N N N N 218 GLY CA C N N 219 GLY C C N N 220 GLY O O N N 221 GLY OXT O N N 222 GLY H H N N 223 GLY H2 H N N 224 GLY HA2 H N N 225 GLY HA3 H N N 226 GLY HXT H N N 227 HIS N N N N 228 HIS CA C N S 229 HIS C C N N 230 HIS O O N N 231 HIS CB C N N 232 HIS CG C Y N 233 HIS ND1 N Y N 234 HIS CD2 C Y N 235 HIS CE1 C Y N 236 HIS NE2 N Y N 237 HIS OXT O N N 238 HIS H H N N 239 HIS H2 H N N 240 HIS HA H N N 241 HIS HB2 H N N 242 HIS HB3 H N N 243 HIS HD1 H N N 244 HIS HD2 H N N 245 HIS HE1 H N N 246 HIS HE2 H N N 247 HIS HXT H N N 248 HOH O O N N 249 HOH H1 H N N 250 HOH H2 H N N 251 ILE N N N N 252 ILE CA C N S 253 ILE C C N N 254 ILE O O N N 255 ILE CB C N S 256 ILE CG1 C N N 257 ILE CG2 C N N 258 ILE CD1 C N N 259 ILE OXT O N N 260 ILE H H N N 261 ILE H2 H N N 262 ILE HA H N N 263 ILE HB H N N 264 ILE HG12 H N N 265 ILE HG13 H N N 266 ILE HG21 H N N 267 ILE HG22 H N N 268 ILE HG23 H N N 269 ILE HD11 H N N 270 ILE HD12 H N N 271 ILE HD13 H N N 272 ILE HXT H N N 273 LEU N N N N 274 LEU CA C N S 275 LEU C C N N 276 LEU O O N N 277 LEU CB C N N 278 LEU CG C N N 279 LEU CD1 C N N 280 LEU CD2 C N N 281 LEU OXT O N N 282 LEU H H N N 283 LEU H2 H N N 284 LEU HA H N N 285 LEU HB2 H N N 286 LEU HB3 H N N 287 LEU HG H N N 288 LEU HD11 H N N 289 LEU HD12 H N N 290 LEU HD13 H N N 291 LEU HD21 H N N 292 LEU HD22 H N N 293 LEU HD23 H N N 294 LEU HXT H N N 295 LYS N N N N 296 LYS CA C N S 297 LYS C C N N 298 LYS O O N N 299 LYS CB C N N 300 LYS CG C N N 301 LYS CD C N N 302 LYS CE C N N 303 LYS NZ N N N 304 LYS OXT O N N 305 LYS H H N N 306 LYS H2 H N N 307 LYS HA H N N 308 LYS HB2 H N N 309 LYS HB3 H N N 310 LYS HG2 H N N 311 LYS HG3 H N N 312 LYS HD2 H N N 313 LYS HD3 H N N 314 LYS HE2 H N N 315 LYS HE3 H N N 316 LYS HZ1 H N N 317 LYS HZ2 H N N 318 LYS HZ3 H N N 319 LYS HXT H N N 320 MET N N N N 321 MET CA C N S 322 MET C C N N 323 MET O O N N 324 MET CB C N N 325 MET CG C N N 326 MET SD S N N 327 MET CE C N N 328 MET OXT O N N 329 MET H H N N 330 MET H2 H N N 331 MET HA H N N 332 MET HB2 H N N 333 MET HB3 H N N 334 MET HG2 H N N 335 MET HG3 H N N 336 MET HE1 H N N 337 MET HE2 H N N 338 MET HE3 H N N 339 MET HXT H N N 340 MK8 C C N N 341 MK8 N N N N 342 MK8 O O N N 343 MK8 CA C N S 344 MK8 CB C N N 345 MK8 CD C N N 346 MK8 CE C N N 347 MK8 CG C N N 348 MK8 CB1 C N N 349 MK8 OXT O N N 350 MK8 H H N N 351 MK8 H2 H N N 352 MK8 HB H N N 353 MK8 HBA H N N 354 MK8 HD H N N 355 MK8 HDA H N N 356 MK8 HE H N N 357 MK8 HEA H N N 358 MK8 HEB H N N 359 MK8 HG H N N 360 MK8 HGA H N N 361 MK8 HB1 H N N 362 MK8 HB1A H N N 363 MK8 HB1B H N N 364 MK8 HXT H N N 365 NH2 N N N N 366 NH2 HN1 H N N 367 NH2 HN2 H N N 368 PHE N N N N 369 PHE CA C N S 370 PHE C C N N 371 PHE O O N N 372 PHE CB C N N 373 PHE CG C Y N 374 PHE CD1 C Y N 375 PHE CD2 C Y N 376 PHE CE1 C Y N 377 PHE CE2 C Y N 378 PHE CZ C Y N 379 PHE OXT O N N 380 PHE H H N N 381 PHE H2 H N N 382 PHE HA H N N 383 PHE HB2 H N N 384 PHE HB3 H N N 385 PHE HD1 H N N 386 PHE HD2 H N N 387 PHE HE1 H N N 388 PHE HE2 H N N 389 PHE HZ H N N 390 PHE HXT H N N 391 PRO N N N N 392 PRO CA C N S 393 PRO C C N N 394 PRO O O N N 395 PRO CB C N N 396 PRO CG C N N 397 PRO CD C N N 398 PRO OXT O N N 399 PRO H H N N 400 PRO HA H N N 401 PRO HB2 H N N 402 PRO HB3 H N N 403 PRO HG2 H N N 404 PRO HG3 H N N 405 PRO HD2 H N N 406 PRO HD3 H N N 407 PRO HXT H N N 408 SER N N N N 409 SER CA C N S 410 SER C C N N 411 SER O O N N 412 SER CB C N N 413 SER OG O N N 414 SER OXT O N N 415 SER H H N N 416 SER H2 H N N 417 SER HA H N N 418 SER HB2 H N N 419 SER HB3 H N N 420 SER HG H N N 421 SER HXT H N N 422 THR N N N N 423 THR CA C N S 424 THR C C N N 425 THR O O N N 426 THR CB C N R 427 THR OG1 O N N 428 THR CG2 C N N 429 THR OXT O N N 430 THR H H N N 431 THR H2 H N N 432 THR HA H N N 433 THR HB H N N 434 THR HG1 H N N 435 THR HG21 H N N 436 THR HG22 H N N 437 THR HG23 H N N 438 THR HXT H N N 439 TYR N N N N 440 TYR CA C N S 441 TYR C C N N 442 TYR O O N N 443 TYR CB C N N 444 TYR CG C Y N 445 TYR CD1 C Y N 446 TYR CD2 C Y N 447 TYR CE1 C Y N 448 TYR CE2 C Y N 449 TYR CZ C Y N 450 TYR OH O N N 451 TYR OXT O N N 452 TYR H H N N 453 TYR H2 H N N 454 TYR HA H N N 455 TYR HB2 H N N 456 TYR HB3 H N N 457 TYR HD1 H N N 458 TYR HD2 H N N 459 TYR HE1 H N N 460 TYR HE2 H N N 461 TYR HH H N N 462 TYR HXT H N N 463 VAL N N N N 464 VAL CA C N S 465 VAL C C N N 466 VAL O O N N 467 VAL CB C N N 468 VAL CG1 C N N 469 VAL CG2 C N N 470 VAL OXT O N N 471 VAL H H N N 472 VAL H2 H N N 473 VAL HA H N N 474 VAL HB H N N 475 VAL HG11 H N N 476 VAL HG12 H N N 477 VAL HG13 H N N 478 VAL HG21 H N N 479 VAL HG22 H N N 480 VAL HG23 H N N 481 VAL HXT H N N 482 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0EH CAT CAS sing N N 1 0EH O C doub N N 2 0EH CAR CAS sing N N 3 0EH CAR CAQ sing N N 4 0EH C CA sing N N 5 0EH CAA CA sing N N 6 0EH CAO CAP sing N N 7 0EH CAO CAB sing N N 8 0EH CAQ CAP sing N N 9 0EH CA CAB sing N N 10 0EH CA N sing N N 11 0EH CAA H1 sing N N 12 0EH CAA H3 sing N N 13 0EH CAA H4 sing N N 14 0EH CAB H5 sing N N 15 0EH CAB H6 sing N N 16 0EH N H sing N N 17 0EH N H2 sing N N 18 0EH CAO H10 sing N N 19 0EH CAO H11 sing N N 20 0EH CAP H12 sing N N 21 0EH CAP H13 sing N N 22 0EH CAQ H14 sing N N 23 0EH CAQ H15 sing N N 24 0EH CAR H16 sing N N 25 0EH CAR H17 sing N N 26 0EH CAS H18 sing N N 27 0EH CAS H19 sing N N 28 0EH CAT H20 sing N N 29 0EH CAT H21 sing N N 30 0EH CAT H22 sing N N 31 0EH C OXT sing N N 32 0EH OXT HXT sing N N 33 2JH N CA sing N N 34 2JH CA C sing N N 35 2JH CA CB sing N N 36 2JH O C doub N N 37 2JH CB CG sing N N 38 2JH CG CD2 sing N N 39 2JH CG CD1 sing N N 40 2JH CD2 CE sing N N 41 2JH CD1 CE sing N N 42 2JH N H sing N N 43 2JH N H2 sing N N 44 2JH CA HA sing N N 45 2JH CB H5 sing N N 46 2JH CB H6 sing N N 47 2JH CG H8 sing N N 48 2JH CD1 H9 sing N N 49 2JH CD1 H10 sing N N 50 2JH CD2 H11 sing N N 51 2JH CD2 H12 sing N N 52 2JH CE H13 sing N N 53 2JH CE H14 sing N N 54 2JH C OXT sing N N 55 2JH OXT HXT sing N N 56 ACE C O doub N N 57 ACE C CH3 sing N N 58 ACE C H sing N N 59 ACE CH3 H1 sing N N 60 ACE CH3 H2 sing N N 61 ACE CH3 H3 sing N N 62 ALA N CA sing N N 63 ALA N H sing N N 64 ALA N H2 sing N N 65 ALA CA C sing N N 66 ALA CA CB sing N N 67 ALA CA HA sing N N 68 ALA C O doub N N 69 ALA C OXT sing N N 70 ALA CB HB1 sing N N 71 ALA CB HB2 sing N N 72 ALA CB HB3 sing N N 73 ALA OXT HXT sing N N 74 ARG N CA sing N N 75 ARG N H sing N N 76 ARG N H2 sing N N 77 ARG CA C sing N N 78 ARG CA CB sing N N 79 ARG CA HA sing N N 80 ARG C O doub N N 81 ARG C OXT sing N N 82 ARG CB CG sing N N 83 ARG CB HB2 sing N N 84 ARG CB HB3 sing N N 85 ARG CG CD sing N N 86 ARG CG HG2 sing N N 87 ARG CG HG3 sing N N 88 ARG CD NE sing N N 89 ARG CD HD2 sing N N 90 ARG CD HD3 sing N N 91 ARG NE CZ sing N N 92 ARG NE HE sing N N 93 ARG CZ NH1 sing N N 94 ARG CZ NH2 doub N N 95 ARG NH1 HH11 sing N N 96 ARG NH1 HH12 sing N N 97 ARG NH2 HH21 sing N N 98 ARG NH2 HH22 sing N N 99 ARG OXT HXT sing N N 100 ASN N CA sing N N 101 ASN N H sing N N 102 ASN N H2 sing N N 103 ASN CA C sing N N 104 ASN CA CB sing N N 105 ASN CA HA sing N N 106 ASN C O doub N N 107 ASN C OXT sing N N 108 ASN CB CG sing N N 109 ASN CB HB2 sing N N 110 ASN CB HB3 sing N N 111 ASN CG OD1 doub N N 112 ASN CG ND2 sing N N 113 ASN ND2 HD21 sing N N 114 ASN ND2 HD22 sing N N 115 ASN OXT HXT sing N N 116 ASP N CA sing N N 117 ASP N H sing N N 118 ASP N H2 sing N N 119 ASP CA C sing N N 120 ASP CA CB sing N N 121 ASP CA HA sing N N 122 ASP C O doub N N 123 ASP C OXT sing N N 124 ASP CB CG sing N N 125 ASP CB HB2 sing N N 126 ASP CB HB3 sing N N 127 ASP CG OD1 doub N N 128 ASP CG OD2 sing N N 129 ASP OD2 HD2 sing N N 130 ASP OXT HXT sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 DTR N CA sing N N 145 DTR N H sing N N 146 DTR N H2 sing N N 147 DTR CA CB sing N N 148 DTR CA C sing N N 149 DTR CA HA sing N N 150 DTR CB CG sing N N 151 DTR CB HB2 sing N N 152 DTR CB HB3 sing N N 153 DTR CG CD1 doub Y N 154 DTR CG CD2 sing Y N 155 DTR CD1 NE1 sing Y N 156 DTR CD1 HD1 sing N N 157 DTR NE1 CE2 sing Y N 158 DTR NE1 HE1 sing N N 159 DTR CE2 CZ2 doub Y N 160 DTR CE2 CD2 sing Y N 161 DTR CZ2 CH2 sing Y N 162 DTR CZ2 HZ2 sing N N 163 DTR CH2 CZ3 doub Y N 164 DTR CH2 HH2 sing N N 165 DTR CZ3 CE3 sing Y N 166 DTR CZ3 HZ3 sing N N 167 DTR CE3 CD2 doub Y N 168 DTR CE3 HE3 sing N N 169 DTR C O doub N N 170 DTR C OXT sing N N 171 DTR OXT HXT sing N N 172 GLN N CA sing N N 173 GLN N H sing N N 174 GLN N H2 sing N N 175 GLN CA C sing N N 176 GLN CA CB sing N N 177 GLN CA HA sing N N 178 GLN C O doub N N 179 GLN C OXT sing N N 180 GLN CB CG sing N N 181 GLN CB HB2 sing N N 182 GLN CB HB3 sing N N 183 GLN CG CD sing N N 184 GLN CG HG2 sing N N 185 GLN CG HG3 sing N N 186 GLN CD OE1 doub N N 187 GLN CD NE2 sing N N 188 GLN NE2 HE21 sing N N 189 GLN NE2 HE22 sing N N 190 GLN OXT HXT sing N N 191 GLU N CA sing N N 192 GLU N H sing N N 193 GLU N H2 sing N N 194 GLU CA C sing N N 195 GLU CA CB sing N N 196 GLU CA HA sing N N 197 GLU C O doub N N 198 GLU C OXT sing N N 199 GLU CB CG sing N N 200 GLU CB HB2 sing N N 201 GLU CB HB3 sing N N 202 GLU CG CD sing N N 203 GLU CG HG2 sing N N 204 GLU CG HG3 sing N N 205 GLU CD OE1 doub N N 206 GLU CD OE2 sing N N 207 GLU OE2 HE2 sing N N 208 GLU OXT HXT sing N N 209 GLY N CA sing N N 210 GLY N H sing N N 211 GLY N H2 sing N N 212 GLY CA C sing N N 213 GLY CA HA2 sing N N 214 GLY CA HA3 sing N N 215 GLY C O doub N N 216 GLY C OXT sing N N 217 GLY OXT HXT sing N N 218 HIS N CA sing N N 219 HIS N H sing N N 220 HIS N H2 sing N N 221 HIS CA C sing N N 222 HIS CA CB sing N N 223 HIS CA HA sing N N 224 HIS C O doub N N 225 HIS C OXT sing N N 226 HIS CB CG sing N N 227 HIS CB HB2 sing N N 228 HIS CB HB3 sing N N 229 HIS CG ND1 sing Y N 230 HIS CG CD2 doub Y N 231 HIS ND1 CE1 doub Y N 232 HIS ND1 HD1 sing N N 233 HIS CD2 NE2 sing Y N 234 HIS CD2 HD2 sing N N 235 HIS CE1 NE2 sing Y N 236 HIS CE1 HE1 sing N N 237 HIS NE2 HE2 sing N N 238 HIS OXT HXT sing N N 239 HOH O H1 sing N N 240 HOH O H2 sing N N 241 ILE N CA sing N N 242 ILE N H sing N N 243 ILE N H2 sing N N 244 ILE CA C sing N N 245 ILE CA CB sing N N 246 ILE CA HA sing N N 247 ILE C O doub N N 248 ILE C OXT sing N N 249 ILE CB CG1 sing N N 250 ILE CB CG2 sing N N 251 ILE CB HB sing N N 252 ILE CG1 CD1 sing N N 253 ILE CG1 HG12 sing N N 254 ILE CG1 HG13 sing N N 255 ILE CG2 HG21 sing N N 256 ILE CG2 HG22 sing N N 257 ILE CG2 HG23 sing N N 258 ILE CD1 HD11 sing N N 259 ILE CD1 HD12 sing N N 260 ILE CD1 HD13 sing N N 261 ILE OXT HXT sing N N 262 LEU N CA sing N N 263 LEU N H sing N N 264 LEU N H2 sing N N 265 LEU CA C sing N N 266 LEU CA CB sing N N 267 LEU CA HA sing N N 268 LEU C O doub N N 269 LEU C OXT sing N N 270 LEU CB CG sing N N 271 LEU CB HB2 sing N N 272 LEU CB HB3 sing N N 273 LEU CG CD1 sing N N 274 LEU CG CD2 sing N N 275 LEU CG HG sing N N 276 LEU CD1 HD11 sing N N 277 LEU CD1 HD12 sing N N 278 LEU CD1 HD13 sing N N 279 LEU CD2 HD21 sing N N 280 LEU CD2 HD22 sing N N 281 LEU CD2 HD23 sing N N 282 LEU OXT HXT sing N N 283 LYS N CA sing N N 284 LYS N H sing N N 285 LYS N H2 sing N N 286 LYS CA C sing N N 287 LYS CA CB sing N N 288 LYS CA HA sing N N 289 LYS C O doub N N 290 LYS C OXT sing N N 291 LYS CB CG sing N N 292 LYS CB HB2 sing N N 293 LYS CB HB3 sing N N 294 LYS CG CD sing N N 295 LYS CG HG2 sing N N 296 LYS CG HG3 sing N N 297 LYS CD CE sing N N 298 LYS CD HD2 sing N N 299 LYS CD HD3 sing N N 300 LYS CE NZ sing N N 301 LYS CE HE2 sing N N 302 LYS CE HE3 sing N N 303 LYS NZ HZ1 sing N N 304 LYS NZ HZ2 sing N N 305 LYS NZ HZ3 sing N N 306 LYS OXT HXT sing N N 307 MET N CA sing N N 308 MET N H sing N N 309 MET N H2 sing N N 310 MET CA C sing N N 311 MET CA CB sing N N 312 MET CA HA sing N N 313 MET C O doub N N 314 MET C OXT sing N N 315 MET CB CG sing N N 316 MET CB HB2 sing N N 317 MET CB HB3 sing N N 318 MET CG SD sing N N 319 MET CG HG2 sing N N 320 MET CG HG3 sing N N 321 MET SD CE sing N N 322 MET CE HE1 sing N N 323 MET CE HE2 sing N N 324 MET CE HE3 sing N N 325 MET OXT HXT sing N N 326 MK8 C CA sing N N 327 MK8 C OXT sing N N 328 MK8 N H sing N N 329 MK8 N H2 sing N N 330 MK8 O C doub N N 331 MK8 CA N sing N N 332 MK8 CA CB sing N N 333 MK8 CB HB sing N N 334 MK8 CB HBA sing N N 335 MK8 CD CG sing N N 336 MK8 CD HD sing N N 337 MK8 CD HDA sing N N 338 MK8 CE CD sing N N 339 MK8 CE HE sing N N 340 MK8 CE HEA sing N N 341 MK8 CE HEB sing N N 342 MK8 CG CB sing N N 343 MK8 CG HG sing N N 344 MK8 CG HGA sing N N 345 MK8 CB1 CA sing N N 346 MK8 CB1 HB1 sing N N 347 MK8 CB1 HB1A sing N N 348 MK8 CB1 HB1B sing N N 349 MK8 OXT HXT sing N N 350 NH2 N HN1 sing N N 351 NH2 N HN2 sing N N 352 PHE N CA sing N N 353 PHE N H sing N N 354 PHE N H2 sing N N 355 PHE CA C sing N N 356 PHE CA CB sing N N 357 PHE CA HA sing N N 358 PHE C O doub N N 359 PHE C OXT sing N N 360 PHE CB CG sing N N 361 PHE CB HB2 sing N N 362 PHE CB HB3 sing N N 363 PHE CG CD1 doub Y N 364 PHE CG CD2 sing Y N 365 PHE CD1 CE1 sing Y N 366 PHE CD1 HD1 sing N N 367 PHE CD2 CE2 doub Y N 368 PHE CD2 HD2 sing N N 369 PHE CE1 CZ doub Y N 370 PHE CE1 HE1 sing N N 371 PHE CE2 CZ sing Y N 372 PHE CE2 HE2 sing N N 373 PHE CZ HZ sing N N 374 PHE OXT HXT sing N N 375 PRO N CA sing N N 376 PRO N CD sing N N 377 PRO N H sing N N 378 PRO CA C sing N N 379 PRO CA CB sing N N 380 PRO CA HA sing N N 381 PRO C O doub N N 382 PRO C OXT sing N N 383 PRO CB CG sing N N 384 PRO CB HB2 sing N N 385 PRO CB HB3 sing N N 386 PRO CG CD sing N N 387 PRO CG HG2 sing N N 388 PRO CG HG3 sing N N 389 PRO CD HD2 sing N N 390 PRO CD HD3 sing N N 391 PRO OXT HXT sing N N 392 SER N CA sing N N 393 SER N H sing N N 394 SER N H2 sing N N 395 SER CA C sing N N 396 SER CA CB sing N N 397 SER CA HA sing N N 398 SER C O doub N N 399 SER C OXT sing N N 400 SER CB OG sing N N 401 SER CB HB2 sing N N 402 SER CB HB3 sing N N 403 SER OG HG sing N N 404 SER OXT HXT sing N N 405 THR N CA sing N N 406 THR N H sing N N 407 THR N H2 sing N N 408 THR CA C sing N N 409 THR CA CB sing N N 410 THR CA HA sing N N 411 THR C O doub N N 412 THR C OXT sing N N 413 THR CB OG1 sing N N 414 THR CB CG2 sing N N 415 THR CB HB sing N N 416 THR OG1 HG1 sing N N 417 THR CG2 HG21 sing N N 418 THR CG2 HG22 sing N N 419 THR CG2 HG23 sing N N 420 THR OXT HXT sing N N 421 TYR N CA sing N N 422 TYR N H sing N N 423 TYR N H2 sing N N 424 TYR CA C sing N N 425 TYR CA CB sing N N 426 TYR CA HA sing N N 427 TYR C O doub N N 428 TYR C OXT sing N N 429 TYR CB CG sing N N 430 TYR CB HB2 sing N N 431 TYR CB HB3 sing N N 432 TYR CG CD1 doub Y N 433 TYR CG CD2 sing Y N 434 TYR CD1 CE1 sing Y N 435 TYR CD1 HD1 sing N N 436 TYR CD2 CE2 doub Y N 437 TYR CD2 HD2 sing N N 438 TYR CE1 CZ doub Y N 439 TYR CE1 HE1 sing N N 440 TYR CE2 CZ sing Y N 441 TYR CE2 HE2 sing N N 442 TYR CZ OH sing N N 443 TYR OH HH sing N N 444 TYR OXT HXT sing N N 445 VAL N CA sing N N 446 VAL N H sing N N 447 VAL N H2 sing N N 448 VAL CA C sing N N 449 VAL CA CB sing N N 450 VAL CA HA sing N N 451 VAL C O doub N N 452 VAL C OXT sing N N 453 VAL CB CG1 sing N N 454 VAL CB CG2 sing N N 455 VAL CB HB sing N N 456 VAL CG1 HG11 sing N N 457 VAL CG1 HG12 sing N N 458 VAL CG1 HG13 sing N N 459 VAL CG2 HG21 sing N N 460 VAL CG2 HG22 sing N N 461 VAL CG2 HG23 sing N N 462 VAL OXT HXT sing N N 463 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4UMN _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6AAW _atom_sites.fract_transf_matrix[1][1] 0.012354 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001042 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023053 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029053 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ #