data_6AFJ # _entry.id 6AFJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AFJ pdb_00006afj 10.2210/pdb6afj/pdb WWPDB D_1300008687 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-29 2 'Structure model' 1 1 2018-10-03 3 'Structure model' 1 2 2023-11-22 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AFJ _pdbx_database_status.recvd_initial_deposition_date 2018-08-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Caaveiro, J.M.M.' 1 ? 'Tashiro, S.' 2 ? 'Tsumoto, K.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'ACS Chem. Biol.' ? ? 1554-8937 ? ? 13 ? 2783 2793 ;Discovery and Optimization of Inhibitors of the Parkinson's Disease Associated Protein DJ-1. ; 2018 ? 10.1021/acschembio.8b00701 30063823 ? ? ? ? ? ? ? ? US ? ? 1 Biochemistry BICHAW 0033 1520-4995 ? ? 53 ? 2218 2220 'Thermodynamic and structural characterization of the specific binding of Zn(II) to human protein DJ-1.' 2014 ? 10.1021/bi500294h 24697266 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tashiro, S.' 1 ? primary 'Caaveiro, J.M.M.' 2 0000-0001-5568-2369 primary 'Nakakido, M.' 3 ? primary 'Tanabe, A.' 4 ? primary 'Nagatoishi, S.' 5 ? primary 'Tamura, Y.' 6 ? primary 'Matsuda, N.' 7 ? primary 'Liu, D.' 8 0000-0002-7587-703X primary 'Hoang, Q.Q.' 9 ? primary 'Tsumoto, K.' 10 ? 1 'Tashiro, S.' 11 ? 1 'Caaveiro, J.M.M.' 12 ? 1 'Wu, C.X.' 13 ? 1 'Hoang, Q.Q.' 14 ? 1 'Tsumoto, K.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein/nucleic acid deglycase DJ-1' 19917.051 1 3.1.2.-,3.5.1.-,3.5.1.124 ? ? ? 2 non-polymer syn 'butyl 2-[2,3-bis(oxidanylidene)indol-1-yl]ethanoate' 261.273 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 172 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Maillard deglycase,Oncogene DJ1,Parkinson disease protein 7,Parkinsonism-associated deglycase,Protein DJ-1,DJ-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'butyl 2-[2,3-bis(oxidanylidene)indol-1-yl]ethanoate' 73G 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 LYS n 1 5 ARG n 1 6 ALA n 1 7 LEU n 1 8 VAL n 1 9 ILE n 1 10 LEU n 1 11 ALA n 1 12 LYS n 1 13 GLY n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 MET n 1 18 GLU n 1 19 THR n 1 20 VAL n 1 21 ILE n 1 22 PRO n 1 23 VAL n 1 24 ASP n 1 25 VAL n 1 26 MET n 1 27 ARG n 1 28 ARG n 1 29 ALA n 1 30 GLY n 1 31 ILE n 1 32 LYS n 1 33 VAL n 1 34 THR n 1 35 VAL n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ALA n 1 40 GLY n 1 41 LYS n 1 42 ASP n 1 43 PRO n 1 44 VAL n 1 45 GLN n 1 46 CYS n 1 47 SER n 1 48 ARG n 1 49 ASP n 1 50 VAL n 1 51 VAL n 1 52 ILE n 1 53 CYS n 1 54 PRO n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LEU n 1 59 GLU n 1 60 ASP n 1 61 ALA n 1 62 LYS n 1 63 LYS n 1 64 GLU n 1 65 GLY n 1 66 PRO n 1 67 TYR n 1 68 ASP n 1 69 VAL n 1 70 VAL n 1 71 VAL n 1 72 LEU n 1 73 PRO n 1 74 GLY n 1 75 GLY n 1 76 ASN n 1 77 LEU n 1 78 GLY n 1 79 ALA n 1 80 GLN n 1 81 ASN n 1 82 LEU n 1 83 SER n 1 84 GLU n 1 85 SER n 1 86 ALA n 1 87 ALA n 1 88 VAL n 1 89 LYS n 1 90 GLU n 1 91 ILE n 1 92 LEU n 1 93 LYS n 1 94 GLU n 1 95 GLN n 1 96 GLU n 1 97 ASN n 1 98 ARG n 1 99 LYS n 1 100 GLY n 1 101 LEU n 1 102 ILE n 1 103 ALA n 1 104 ALA n 1 105 ILE n 1 106 CYS n 1 107 ALA n 1 108 GLY n 1 109 PRO n 1 110 THR n 1 111 ALA n 1 112 LEU n 1 113 LEU n 1 114 ALA n 1 115 HIS n 1 116 GLU n 1 117 ILE n 1 118 GLY n 1 119 PHE n 1 120 GLY n 1 121 SER n 1 122 LYS n 1 123 VAL n 1 124 THR n 1 125 THR n 1 126 HIS n 1 127 PRO n 1 128 LEU n 1 129 ALA n 1 130 LYS n 1 131 ASP n 1 132 LYS n 1 133 MET n 1 134 MET n 1 135 ASN n 1 136 GLY n 1 137 GLY n 1 138 HIS n 1 139 TYR n 1 140 THR n 1 141 TYR n 1 142 SER n 1 143 GLU n 1 144 ASN n 1 145 ARG n 1 146 VAL n 1 147 GLU n 1 148 LYS n 1 149 ASP n 1 150 GLY n 1 151 LEU n 1 152 ILE n 1 153 LEU n 1 154 THR n 1 155 SER n 1 156 ARG n 1 157 GLY n 1 158 PRO n 1 159 GLY n 1 160 THR n 1 161 SER n 1 162 PHE n 1 163 GLU n 1 164 PHE n 1 165 ALA n 1 166 LEU n 1 167 ALA n 1 168 ILE n 1 169 VAL n 1 170 GLU n 1 171 ALA n 1 172 LEU n 1 173 ASN n 1 174 GLY n 1 175 LYS n 1 176 GLU n 1 177 VAL n 1 178 ALA n 1 179 ALA n 1 180 GLN n 1 181 VAL n 1 182 LYS n 1 183 ALA n 1 184 PRO n 1 185 LEU n 1 186 VAL n 1 187 LEU n 1 188 LYS n 1 189 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PARK7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 73G non-polymer . 'butyl 2-[2,3-bis(oxidanylidene)indol-1-yl]ethanoate' ? 'C14 H15 N O4' 261.273 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 ASP 189 189 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 73G 1 201 201 73G 73G A . C 3 CL 1 202 202 CL CL A . D 4 HOH 1 301 301 HOH HOH A . D 4 HOH 2 302 302 HOH HOH A . D 4 HOH 3 303 303 HOH HOH A . D 4 HOH 4 304 304 HOH HOH A . D 4 HOH 5 305 305 HOH HOH A . D 4 HOH 6 306 306 HOH HOH A . D 4 HOH 7 307 307 HOH HOH A . D 4 HOH 8 308 308 HOH HOH A . D 4 HOH 9 309 309 HOH HOH A . D 4 HOH 10 310 310 HOH HOH A . D 4 HOH 11 311 311 HOH HOH A . D 4 HOH 12 312 312 HOH HOH A . D 4 HOH 13 313 313 HOH HOH A . D 4 HOH 14 314 314 HOH HOH A . D 4 HOH 15 315 315 HOH HOH A . D 4 HOH 16 316 316 HOH HOH A . D 4 HOH 17 317 317 HOH HOH A . D 4 HOH 18 318 318 HOH HOH A . D 4 HOH 19 319 319 HOH HOH A . D 4 HOH 20 320 320 HOH HOH A . D 4 HOH 21 321 321 HOH HOH A . D 4 HOH 22 322 322 HOH HOH A . D 4 HOH 23 323 323 HOH HOH A . D 4 HOH 24 324 324 HOH HOH A . D 4 HOH 25 325 325 HOH HOH A . D 4 HOH 26 326 326 HOH HOH A . D 4 HOH 27 327 327 HOH HOH A . D 4 HOH 28 328 328 HOH HOH A . D 4 HOH 29 329 329 HOH HOH A . D 4 HOH 30 330 330 HOH HOH A . D 4 HOH 31 331 331 HOH HOH A . D 4 HOH 32 332 332 HOH HOH A . D 4 HOH 33 333 333 HOH HOH A . D 4 HOH 34 334 334 HOH HOH A . D 4 HOH 35 335 335 HOH HOH A . D 4 HOH 36 336 336 HOH HOH A . D 4 HOH 37 337 337 HOH HOH A . D 4 HOH 38 338 338 HOH HOH A . D 4 HOH 39 339 339 HOH HOH A . D 4 HOH 40 340 340 HOH HOH A . D 4 HOH 41 341 341 HOH HOH A . D 4 HOH 42 342 342 HOH HOH A . D 4 HOH 43 343 343 HOH HOH A . D 4 HOH 44 344 344 HOH HOH A . D 4 HOH 45 345 345 HOH HOH A . D 4 HOH 46 346 346 HOH HOH A . D 4 HOH 47 347 347 HOH HOH A . D 4 HOH 48 348 348 HOH HOH A . D 4 HOH 49 349 349 HOH HOH A . D 4 HOH 50 350 350 HOH HOH A . D 4 HOH 51 351 351 HOH HOH A . D 4 HOH 52 352 352 HOH HOH A . D 4 HOH 53 353 353 HOH HOH A . D 4 HOH 54 354 354 HOH HOH A . D 4 HOH 55 355 355 HOH HOH A . D 4 HOH 56 356 356 HOH HOH A . D 4 HOH 57 357 357 HOH HOH A . D 4 HOH 58 358 358 HOH HOH A . D 4 HOH 59 359 359 HOH HOH A . D 4 HOH 60 360 360 HOH HOH A . D 4 HOH 61 361 361 HOH HOH A . D 4 HOH 62 362 362 HOH HOH A . D 4 HOH 63 363 363 HOH HOH A . D 4 HOH 64 364 364 HOH HOH A . D 4 HOH 65 365 365 HOH HOH A . D 4 HOH 66 366 366 HOH HOH A . D 4 HOH 67 367 367 HOH HOH A . D 4 HOH 68 368 368 HOH HOH A . D 4 HOH 69 369 369 HOH HOH A . D 4 HOH 70 370 370 HOH HOH A . D 4 HOH 71 371 371 HOH HOH A . D 4 HOH 72 372 372 HOH HOH A . D 4 HOH 73 373 373 HOH HOH A . D 4 HOH 74 374 374 HOH HOH A . D 4 HOH 75 375 375 HOH HOH A . D 4 HOH 76 376 376 HOH HOH A . D 4 HOH 77 377 377 HOH HOH A . D 4 HOH 78 378 378 HOH HOH A . D 4 HOH 79 379 379 HOH HOH A . D 4 HOH 80 380 380 HOH HOH A . D 4 HOH 81 381 381 HOH HOH A . D 4 HOH 82 382 382 HOH HOH A . D 4 HOH 83 383 383 HOH HOH A . D 4 HOH 84 384 384 HOH HOH A . D 4 HOH 85 385 385 HOH HOH A . D 4 HOH 86 386 386 HOH HOH A . D 4 HOH 87 387 387 HOH HOH A . D 4 HOH 88 388 388 HOH HOH A . D 4 HOH 89 389 389 HOH HOH A . D 4 HOH 90 390 390 HOH HOH A . D 4 HOH 91 391 391 HOH HOH A . D 4 HOH 92 392 392 HOH HOH A . D 4 HOH 93 393 393 HOH HOH A . D 4 HOH 94 394 394 HOH HOH A . D 4 HOH 95 395 395 HOH HOH A . D 4 HOH 96 396 396 HOH HOH A . D 4 HOH 97 397 397 HOH HOH A . D 4 HOH 98 398 398 HOH HOH A . D 4 HOH 99 399 399 HOH HOH A . D 4 HOH 100 400 400 HOH HOH A . D 4 HOH 101 401 401 HOH HOH A . D 4 HOH 102 402 402 HOH HOH A . D 4 HOH 103 403 403 HOH HOH A . D 4 HOH 104 404 404 HOH HOH A . D 4 HOH 105 405 405 HOH HOH A . D 4 HOH 106 406 406 HOH HOH A . D 4 HOH 107 407 407 HOH HOH A . D 4 HOH 108 408 408 HOH HOH A . D 4 HOH 109 409 409 HOH HOH A . D 4 HOH 110 410 410 HOH HOH A . D 4 HOH 111 411 411 HOH HOH A . D 4 HOH 112 412 412 HOH HOH A . D 4 HOH 113 413 413 HOH HOH A . D 4 HOH 114 414 414 HOH HOH A . D 4 HOH 115 415 415 HOH HOH A . D 4 HOH 116 416 416 HOH HOH A . D 4 HOH 117 417 417 HOH HOH A . D 4 HOH 118 418 418 HOH HOH A . D 4 HOH 119 419 419 HOH HOH A . D 4 HOH 120 420 420 HOH HOH A . D 4 HOH 121 421 421 HOH HOH A . D 4 HOH 122 422 422 HOH HOH A . D 4 HOH 123 423 423 HOH HOH A . D 4 HOH 124 424 424 HOH HOH A . D 4 HOH 125 425 425 HOH HOH A . D 4 HOH 126 426 426 HOH HOH A . D 4 HOH 127 427 427 HOH HOH A . D 4 HOH 128 428 428 HOH HOH A . D 4 HOH 129 429 429 HOH HOH A . D 4 HOH 130 430 430 HOH HOH A . D 4 HOH 131 431 431 HOH HOH A . D 4 HOH 132 432 432 HOH HOH A . D 4 HOH 133 433 433 HOH HOH A . D 4 HOH 134 434 434 HOH HOH A . D 4 HOH 135 435 435 HOH HOH A . D 4 HOH 136 436 436 HOH HOH A . D 4 HOH 137 437 437 HOH HOH A . D 4 HOH 138 438 438 HOH HOH A . D 4 HOH 139 439 439 HOH HOH A . D 4 HOH 140 440 440 HOH HOH A . D 4 HOH 141 441 441 HOH HOH A . D 4 HOH 142 442 442 HOH HOH A . D 4 HOH 143 443 443 HOH HOH A . D 4 HOH 144 444 444 HOH HOH A . D 4 HOH 145 445 445 HOH HOH A . D 4 HOH 146 446 446 HOH HOH A . D 4 HOH 147 447 447 HOH HOH A . D 4 HOH 148 448 448 HOH HOH A . D 4 HOH 149 449 449 HOH HOH A . D 4 HOH 150 450 450 HOH HOH A . D 4 HOH 151 451 451 HOH HOH A . D 4 HOH 152 452 452 HOH HOH A . D 4 HOH 153 453 453 HOH HOH A . D 4 HOH 154 454 454 HOH HOH A . D 4 HOH 155 455 455 HOH HOH A . D 4 HOH 156 456 456 HOH HOH A . D 4 HOH 157 457 457 HOH HOH A . D 4 HOH 158 458 458 HOH HOH A . D 4 HOH 159 459 459 HOH HOH A . D 4 HOH 160 460 460 HOH HOH A . D 4 HOH 161 461 461 HOH HOH A . D 4 HOH 162 462 462 HOH HOH A . D 4 HOH 163 463 463 HOH HOH A . D 4 HOH 164 464 464 HOH HOH A . D 4 HOH 165 465 465 HOH HOH A . D 4 HOH 166 466 466 HOH HOH A . D 4 HOH 167 467 467 HOH HOH A . D 4 HOH 168 468 468 HOH HOH A . D 4 HOH 169 469 469 HOH HOH A . D 4 HOH 170 470 470 HOH HOH A . D 4 HOH 171 471 471 HOH HOH A . D 4 HOH 172 472 472 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.21 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6AFJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.140 _cell.length_a_esd ? _cell.length_b 75.140 _cell.length_b_esd ? _cell.length_c 75.910 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AFJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AFJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM TRIS-HCl, 200mM sodium citrate, 30% PEG 400, 5mM DTT' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6AFJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.48 _reflns.d_resolution_low 33.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 41703 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.48 _reflns_shell.d_res_low 1.56 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.797 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.749 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.18 _refine.aniso_B[1][2] 0.09 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.18 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.58 _refine.B_iso_max ? _refine.B_iso_mean 22.364 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.977 _refine.correlation_coeff_Fo_to_Fc_free 0.965 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AFJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.48 _refine.ls_d_res_low 33.7 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 39996 _refine.ls_number_reflns_R_free 1682 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 4.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.14073 _refine.ls_R_factor_R_free 0.17168 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.13948 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1SOA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.052 _refine.pdbx_overall_ESU_R_Free 0.051 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.170 _refine.overall_SU_ML 0.035 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1376 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 172 _refine_hist.number_atoms_total 1568 _refine_hist.d_res_high 1.48 _refine_hist.d_res_low 33.7 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 1424 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1439 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.664 2.009 1923 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.980 3.004 3324 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.173 5.000 188 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.108 25.400 50 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.309 15.000 255 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.246 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.096 0.200 226 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.021 1599 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 272 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.663 1.905 755 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.632 1.898 751 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.094 2.858 942 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.083 2.860 941 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.486 2.322 669 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.483 2.325 670 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.967 3.289 982 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.483 16.858 1711 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.332 16.167 1634 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 3.712 3.000 2862 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 27.604 5.000 58 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 14.138 5.000 2961 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.480 _refine_ls_shell.d_res_low 1.518 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 150 _refine_ls_shell.number_reflns_R_work 2868 _refine_ls_shell.percent_reflns_obs 99.34 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.320 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.265 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6AFJ _struct.title 'DJ-1 with compound 13' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AFJ _struct_keywords.text ;DJ-1, Parkinson's disease, Drug discovery, Fragment-based drug discovery, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARK7_HUMAN _struct_ref.pdbx_db_accession Q99497 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AFJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99497 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3080 ? 1 MORE -36 ? 1 'SSA (A^2)' 14520 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_554 x-y,-y,-z-1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -25.3033333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? ALA A 29 ? GLU A 15 ALA A 29 1 ? 15 HELX_P HELX_P2 AA2 LEU A 58 ? GLU A 64 ? LEU A 58 GLU A 64 1 ? 7 HELX_P HELX_P3 AA3 GLY A 75 ? SER A 85 ? GLY A 75 SER A 85 1 ? 11 HELX_P HELX_P4 AA4 SER A 85 ? ARG A 98 ? SER A 85 ARG A 98 1 ? 14 HELX_P HELX_P5 AA5 PRO A 109 ? HIS A 115 ? PRO A 109 HIS A 115 1 ? 7 HELX_P HELX_P6 AA6 HIS A 126 ? LEU A 128 ? HIS A 126 LEU A 128 5 ? 3 HELX_P HELX_P7 AA7 ALA A 129 ? MET A 134 ? ALA A 129 MET A 134 1 ? 6 HELX_P HELX_P8 AA8 GLY A 157 ? GLY A 159 ? GLY A 157 GLY A 159 5 ? 3 HELX_P HELX_P9 AA9 THR A 160 ? GLY A 174 ? THR A 160 GLY A 174 1 ? 15 HELX_P HELX_P10 AB1 GLY A 174 ? ALA A 183 ? GLY A 174 ALA A 183 1 ? 10 HELX_P HELX_P11 AB2 PRO A 184 ? VAL A 186 ? PRO A 184 VAL A 186 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 106 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 73G _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C9 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 106 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 73G _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.954 _struct_conn.pdbx_value_order sing _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 73G _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 106 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 73G _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 106 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C9 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id 73G _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 65 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 65 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 66 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 66 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 56 ? SER A 57 ? ALA A 56 SER A 57 AA1 2 LYS A 32 ? GLY A 37 ? LYS A 32 GLY A 37 AA1 3 ARG A 5 ? LEU A 10 ? ARG A 5 LEU A 10 AA1 4 VAL A 69 ? LEU A 72 ? VAL A 69 LEU A 72 AA1 5 LEU A 101 ? ILE A 105 ? LEU A 101 ILE A 105 AA1 6 ILE A 152 ? SER A 155 ? ILE A 152 SER A 155 AA1 7 VAL A 146 ? ASP A 149 ? VAL A 146 ASP A 149 AA2 1 VAL A 44 ? GLN A 45 ? VAL A 44 GLN A 45 AA2 2 VAL A 51 ? ILE A 52 ? VAL A 51 ILE A 52 AA3 1 LYS A 122 ? VAL A 123 ? LYS A 122 VAL A 123 AA3 2 THR A 140 ? TYR A 141 ? THR A 140 TYR A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 56 ? O ALA A 56 N GLY A 37 ? N GLY A 37 AA1 2 3 O ALA A 36 ? O ALA A 36 N LEU A 10 ? N LEU A 10 AA1 3 4 N LEU A 7 ? N LEU A 7 O VAL A 71 ? O VAL A 71 AA1 4 5 N LEU A 72 ? N LEU A 72 O ALA A 103 ? O ALA A 103 AA1 5 6 N ILE A 102 ? N ILE A 102 O LEU A 153 ? O LEU A 153 AA1 6 7 O THR A 154 ? O THR A 154 N GLU A 147 ? N GLU A 147 AA2 1 2 N VAL A 44 ? N VAL A 44 O ILE A 52 ? O ILE A 52 AA3 1 2 N VAL A 123 ? N VAL A 123 O THR A 140 ? O THR A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 73G 201 ? 12 'binding site for residue 73G A 201' AC2 Software A CL 202 ? 7 'binding site for residue CL A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 GLU A 15 ? GLU A 15 . ? 1_555 ? 2 AC1 12 GLU A 18 ? GLU A 18 . ? 1_555 ? 3 AC1 12 GLY A 75 ? GLY A 75 . ? 1_555 ? 4 AC1 12 ASN A 76 ? ASN A 76 . ? 1_555 ? 5 AC1 12 CYS A 106 ? CYS A 106 . ? 1_555 ? 6 AC1 12 ALA A 107 ? ALA A 107 . ? 1_555 ? 7 AC1 12 HIS A 126 ? HIS A 126 . ? 1_555 ? 8 AC1 12 LEU A 128 ? LEU A 128 . ? 1_555 ? 9 AC1 12 ALA A 129 ? ALA A 129 . ? 1_555 ? 10 AC1 12 LYS A 132 ? LYS A 132 . ? 1_555 ? 11 AC1 12 PRO A 184 ? PRO A 184 . ? 5_554 ? 12 AC1 12 HOH D . ? HOH A 404 . ? 5_554 ? 13 AC2 7 ARG A 48 ? ARG A 48 . ? 1_555 ? 14 AC2 7 GLY A 75 ? GLY A 75 . ? 1_555 ? 15 AC2 7 ASN A 76 ? ASN A 76 . ? 1_555 ? 16 AC2 7 GLY A 120 ? GLY A 120 . ? 3_454 ? 17 AC2 7 HOH D . ? HOH A 381 . ? 1_555 ? 18 AC2 7 HOH D . ? HOH A 404 . ? 5_554 ? 19 AC2 7 HOH D . ? HOH A 438 . ? 1_555 ? # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 6AFJ _pdbx_entry_details.nonpolymer_details '73G(201) is bonded with Cys106 through a double bond opening.' _pdbx_entry_details.sequence_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.78 118.30 -5.52 0.90 N 2 1 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.96 120.30 3.66 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 106 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 74.25 _pdbx_validate_torsion.psi -112.95 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 458 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 471 ? 5.92 . 2 1 O ? A HOH 472 ? 6.87 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 189 ? A ASP 189 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 73G O10 O N N 1 73G C8 C N N 2 73G C9 C N N 3 73G O11 O N N 4 73G C1 C Y N 5 73G C2 C Y N 6 73G C3 C Y N 7 73G C4 C Y N 8 73G C5 C Y N 9 73G C6 C Y N 10 73G N7 N N N 11 73G CA C N N 12 73G C C N N 13 73G O O N N 14 73G O12 O N N 15 73G C13 C N N 16 73G C14 C N N 17 73G C15 C N N 18 73G C16 C N N 19 73G H3 H N N 20 73G H4 H N N 21 73G H5 H N N 22 73G H6 H N N 23 73G H7 H N N 24 73G H8 H N N 25 73G H9 H N N 26 73G H10 H N N 27 73G H11 H N N 28 73G H12 H N N 29 73G H13 H N N 30 73G H14 H N N 31 73G H15 H N N 32 73G H16 H N N 33 73G H17 H N N 34 ALA N N N N 35 ALA CA C N S 36 ALA C C N N 37 ALA O O N N 38 ALA CB C N N 39 ALA OXT O N N 40 ALA H H N N 41 ALA H2 H N N 42 ALA HA H N N 43 ALA HB1 H N N 44 ALA HB2 H N N 45 ALA HB3 H N N 46 ALA HXT H N N 47 ARG N N N N 48 ARG CA C N S 49 ARG C C N N 50 ARG O O N N 51 ARG CB C N N 52 ARG CG C N N 53 ARG CD C N N 54 ARG NE N N N 55 ARG CZ C N N 56 ARG NH1 N N N 57 ARG NH2 N N N 58 ARG OXT O N N 59 ARG H H N N 60 ARG H2 H N N 61 ARG HA H N N 62 ARG HB2 H N N 63 ARG HB3 H N N 64 ARG HG2 H N N 65 ARG HG3 H N N 66 ARG HD2 H N N 67 ARG HD3 H N N 68 ARG HE H N N 69 ARG HH11 H N N 70 ARG HH12 H N N 71 ARG HH21 H N N 72 ARG HH22 H N N 73 ARG HXT H N N 74 ASN N N N N 75 ASN CA C N S 76 ASN C C N N 77 ASN O O N N 78 ASN CB C N N 79 ASN CG C N N 80 ASN OD1 O N N 81 ASN ND2 N N N 82 ASN OXT O N N 83 ASN H H N N 84 ASN H2 H N N 85 ASN HA H N N 86 ASN HB2 H N N 87 ASN HB3 H N N 88 ASN HD21 H N N 89 ASN HD22 H N N 90 ASN HXT H N N 91 ASP N N N N 92 ASP CA C N S 93 ASP C C N N 94 ASP O O N N 95 ASP CB C N N 96 ASP CG C N N 97 ASP OD1 O N N 98 ASP OD2 O N N 99 ASP OXT O N N 100 ASP H H N N 101 ASP H2 H N N 102 ASP HA H N N 103 ASP HB2 H N N 104 ASP HB3 H N N 105 ASP HD2 H N N 106 ASP HXT H N N 107 CL CL CL N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 73G C4 C3 doub Y N 1 73G C4 C5 sing Y N 2 73G C3 C2 sing Y N 3 73G C5 C6 doub Y N 4 73G C2 C1 doub Y N 5 73G C6 C1 sing Y N 6 73G C6 N7 sing N N 7 73G C1 C9 sing N N 8 73G N7 CA sing N N 9 73G N7 C8 sing N N 10 73G O12 C sing N N 11 73G O12 C13 sing N N 12 73G CA C sing N N 13 73G O11 C9 doub N N 14 73G C9 C8 sing N N 15 73G C O doub N N 16 73G C13 C14 sing N N 17 73G C8 O10 doub N N 18 73G C14 C15 sing N N 19 73G C15 C16 sing N N 20 73G C2 H3 sing N N 21 73G C3 H4 sing N N 22 73G C4 H5 sing N N 23 73G C5 H6 sing N N 24 73G CA H7 sing N N 25 73G CA H8 sing N N 26 73G C13 H9 sing N N 27 73G C13 H10 sing N N 28 73G C14 H11 sing N N 29 73G C14 H12 sing N N 30 73G C15 H13 sing N N 31 73G C15 H14 sing N N 32 73G C16 H15 sing N N 33 73G C16 H16 sing N N 34 73G C16 H17 sing N N 35 ALA N CA sing N N 36 ALA N H sing N N 37 ALA N H2 sing N N 38 ALA CA C sing N N 39 ALA CA CB sing N N 40 ALA CA HA sing N N 41 ALA C O doub N N 42 ALA C OXT sing N N 43 ALA CB HB1 sing N N 44 ALA CB HB2 sing N N 45 ALA CB HB3 sing N N 46 ALA OXT HXT sing N N 47 ARG N CA sing N N 48 ARG N H sing N N 49 ARG N H2 sing N N 50 ARG CA C sing N N 51 ARG CA CB sing N N 52 ARG CA HA sing N N 53 ARG C O doub N N 54 ARG C OXT sing N N 55 ARG CB CG sing N N 56 ARG CB HB2 sing N N 57 ARG CB HB3 sing N N 58 ARG CG CD sing N N 59 ARG CG HG2 sing N N 60 ARG CG HG3 sing N N 61 ARG CD NE sing N N 62 ARG CD HD2 sing N N 63 ARG CD HD3 sing N N 64 ARG NE CZ sing N N 65 ARG NE HE sing N N 66 ARG CZ NH1 sing N N 67 ARG CZ NH2 doub N N 68 ARG NH1 HH11 sing N N 69 ARG NH1 HH12 sing N N 70 ARG NH2 HH21 sing N N 71 ARG NH2 HH22 sing N N 72 ARG OXT HXT sing N N 73 ASN N CA sing N N 74 ASN N H sing N N 75 ASN N H2 sing N N 76 ASN CA C sing N N 77 ASN CA CB sing N N 78 ASN CA HA sing N N 79 ASN C O doub N N 80 ASN C OXT sing N N 81 ASN CB CG sing N N 82 ASN CB HB2 sing N N 83 ASN CB HB3 sing N N 84 ASN CG OD1 doub N N 85 ASN CG ND2 sing N N 86 ASN ND2 HD21 sing N N 87 ASN ND2 HD22 sing N N 88 ASN OXT HXT sing N N 89 ASP N CA sing N N 90 ASP N H sing N N 91 ASP N H2 sing N N 92 ASP CA C sing N N 93 ASP CA CB sing N N 94 ASP CA HA sing N N 95 ASP C O doub N N 96 ASP C OXT sing N N 97 ASP CB CG sing N N 98 ASP CB HB2 sing N N 99 ASP CB HB3 sing N N 100 ASP CG OD1 doub N N 101 ASP CG OD2 sing N N 102 ASP OD2 HD2 sing N N 103 ASP OXT HXT sing N N 104 CYS N CA sing N N 105 CYS N H sing N N 106 CYS N H2 sing N N 107 CYS CA C sing N N 108 CYS CA CB sing N N 109 CYS CA HA sing N N 110 CYS C O doub N N 111 CYS C OXT sing N N 112 CYS CB SG sing N N 113 CYS CB HB2 sing N N 114 CYS CB HB3 sing N N 115 CYS SG HG sing N N 116 CYS OXT HXT sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HIS N CA sing N N 164 HIS N H sing N N 165 HIS N H2 sing N N 166 HIS CA C sing N N 167 HIS CA CB sing N N 168 HIS CA HA sing N N 169 HIS C O doub N N 170 HIS C OXT sing N N 171 HIS CB CG sing N N 172 HIS CB HB2 sing N N 173 HIS CB HB3 sing N N 174 HIS CG ND1 sing Y N 175 HIS CG CD2 doub Y N 176 HIS ND1 CE1 doub Y N 177 HIS ND1 HD1 sing N N 178 HIS CD2 NE2 sing Y N 179 HIS CD2 HD2 sing N N 180 HIS CE1 NE2 sing Y N 181 HIS CE1 HE1 sing N N 182 HIS NE2 HE2 sing N N 183 HIS OXT HXT sing N N 184 HOH O H1 sing N N 185 HOH O H2 sing N N 186 ILE N CA sing N N 187 ILE N H sing N N 188 ILE N H2 sing N N 189 ILE CA C sing N N 190 ILE CA CB sing N N 191 ILE CA HA sing N N 192 ILE C O doub N N 193 ILE C OXT sing N N 194 ILE CB CG1 sing N N 195 ILE CB CG2 sing N N 196 ILE CB HB sing N N 197 ILE CG1 CD1 sing N N 198 ILE CG1 HG12 sing N N 199 ILE CG1 HG13 sing N N 200 ILE CG2 HG21 sing N N 201 ILE CG2 HG22 sing N N 202 ILE CG2 HG23 sing N N 203 ILE CD1 HD11 sing N N 204 ILE CD1 HD12 sing N N 205 ILE CD1 HD13 sing N N 206 ILE OXT HXT sing N N 207 LEU N CA sing N N 208 LEU N H sing N N 209 LEU N H2 sing N N 210 LEU CA C sing N N 211 LEU CA CB sing N N 212 LEU CA HA sing N N 213 LEU C O doub N N 214 LEU C OXT sing N N 215 LEU CB CG sing N N 216 LEU CB HB2 sing N N 217 LEU CB HB3 sing N N 218 LEU CG CD1 sing N N 219 LEU CG CD2 sing N N 220 LEU CG HG sing N N 221 LEU CD1 HD11 sing N N 222 LEU CD1 HD12 sing N N 223 LEU CD1 HD13 sing N N 224 LEU CD2 HD21 sing N N 225 LEU CD2 HD22 sing N N 226 LEU CD2 HD23 sing N N 227 LEU OXT HXT sing N N 228 LYS N CA sing N N 229 LYS N H sing N N 230 LYS N H2 sing N N 231 LYS CA C sing N N 232 LYS CA CB sing N N 233 LYS CA HA sing N N 234 LYS C O doub N N 235 LYS C OXT sing N N 236 LYS CB CG sing N N 237 LYS CB HB2 sing N N 238 LYS CB HB3 sing N N 239 LYS CG CD sing N N 240 LYS CG HG2 sing N N 241 LYS CG HG3 sing N N 242 LYS CD CE sing N N 243 LYS CD HD2 sing N N 244 LYS CD HD3 sing N N 245 LYS CE NZ sing N N 246 LYS CE HE2 sing N N 247 LYS CE HE3 sing N N 248 LYS NZ HZ1 sing N N 249 LYS NZ HZ2 sing N N 250 LYS NZ HZ3 sing N N 251 LYS OXT HXT sing N N 252 MET N CA sing N N 253 MET N H sing N N 254 MET N H2 sing N N 255 MET CA C sing N N 256 MET CA CB sing N N 257 MET CA HA sing N N 258 MET C O doub N N 259 MET C OXT sing N N 260 MET CB CG sing N N 261 MET CB HB2 sing N N 262 MET CB HB3 sing N N 263 MET CG SD sing N N 264 MET CG HG2 sing N N 265 MET CG HG3 sing N N 266 MET SD CE sing N N 267 MET CE HE1 sing N N 268 MET CE HE2 sing N N 269 MET CE HE3 sing N N 270 MET OXT HXT sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TYR N CA sing N N 341 TYR N H sing N N 342 TYR N H2 sing N N 343 TYR CA C sing N N 344 TYR CA CB sing N N 345 TYR CA HA sing N N 346 TYR C O doub N N 347 TYR C OXT sing N N 348 TYR CB CG sing N N 349 TYR CB HB2 sing N N 350 TYR CB HB3 sing N N 351 TYR CG CD1 doub Y N 352 TYR CG CD2 sing Y N 353 TYR CD1 CE1 sing Y N 354 TYR CD1 HD1 sing N N 355 TYR CD2 CE2 doub Y N 356 TYR CD2 HD2 sing N N 357 TYR CE1 CZ doub Y N 358 TYR CE1 HE1 sing N N 359 TYR CE2 CZ sing Y N 360 TYR CE2 HE2 sing N N 361 TYR CZ OH sing N N 362 TYR OH HH sing N N 363 TYR OXT HXT sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan 'Platform for Drug Discovery, Informatics and Structural Life Science' 1 'Japan Society for the Promotion of Science' Japan 25249115 2 'Japan Society for the Promotion of Science' Japan 16H02420 3 'Japan Society for the Promotion of Science' Japan 15K06962 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SOA _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6AFJ _atom_sites.fract_transf_matrix[1][1] 0.013308 _atom_sites.fract_transf_matrix[1][2] 0.007684 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015367 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013173 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_