data_6ANZ # _entry.id 6ANZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ANZ pdb_00006anz 10.2210/pdb6anz/pdb WWPDB D_1000229532 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-30 2 'Structure model' 1 1 2019-07-17 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.classification' 2 2 'Structure model' '_software.name' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ANZ _pdbx_database_status.recvd_initial_deposition_date 2017-08-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . _pdbx_database_related.db_id NegoA.19190.a _pdbx_database_related.content_type unspecified # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a hypothetical protein from Neisseria gonorrhoeae' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bowatte, K.' 1 ? primary 'Abendroth, J.' 2 ? primary 'Lorimer, D.D.' 3 ? primary 'Edwards, T.E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 16855.375 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 103 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name NegoA.19190.a.B1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMKTSTIVFGGFFITDNGERIQIPILENPNIKEINNFFSVSNFEKKAGVLVFRIIPEPEFGNTELTIYFEKGY YLPIIQTILEDGDIEVKNLKTENYSGNTMEILGDVYPIEHISKNISIIQDIISEFIMKNKPITIMI ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMKTSTIVFGGFFITDNGERIQIPILENPNIKEINNFFSVSNFEKKAGVLVFRIIPEPEFGNTELTIYFEKGY YLPIIQTILEDGDIEVKNLKTENYSGNTMEILGDVYPIEHISKNISIIQDIISEFIMKNKPITIMI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NegoA.19190.a # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 LYS n 1 11 THR n 1 12 SER n 1 13 THR n 1 14 ILE n 1 15 VAL n 1 16 PHE n 1 17 GLY n 1 18 GLY n 1 19 PHE n 1 20 PHE n 1 21 ILE n 1 22 THR n 1 23 ASP n 1 24 ASN n 1 25 GLY n 1 26 GLU n 1 27 ARG n 1 28 ILE n 1 29 GLN n 1 30 ILE n 1 31 PRO n 1 32 ILE n 1 33 LEU n 1 34 GLU n 1 35 ASN n 1 36 PRO n 1 37 ASN n 1 38 ILE n 1 39 LYS n 1 40 GLU n 1 41 ILE n 1 42 ASN n 1 43 ASN n 1 44 PHE n 1 45 PHE n 1 46 SER n 1 47 VAL n 1 48 SER n 1 49 ASN n 1 50 PHE n 1 51 GLU n 1 52 LYS n 1 53 LYS n 1 54 ALA n 1 55 GLY n 1 56 VAL n 1 57 LEU n 1 58 VAL n 1 59 PHE n 1 60 ARG n 1 61 ILE n 1 62 ILE n 1 63 PRO n 1 64 GLU n 1 65 PRO n 1 66 GLU n 1 67 PHE n 1 68 GLY n 1 69 ASN n 1 70 THR n 1 71 GLU n 1 72 LEU n 1 73 THR n 1 74 ILE n 1 75 TYR n 1 76 PHE n 1 77 GLU n 1 78 LYS n 1 79 GLY n 1 80 TYR n 1 81 TYR n 1 82 LEU n 1 83 PRO n 1 84 ILE n 1 85 ILE n 1 86 GLN n 1 87 THR n 1 88 ILE n 1 89 LEU n 1 90 GLU n 1 91 ASP n 1 92 GLY n 1 93 ASP n 1 94 ILE n 1 95 GLU n 1 96 VAL n 1 97 LYS n 1 98 ASN n 1 99 LEU n 1 100 LYS n 1 101 THR n 1 102 GLU n 1 103 ASN n 1 104 TYR n 1 105 SER n 1 106 GLY n 1 107 ASN n 1 108 THR n 1 109 MET n 1 110 GLU n 1 111 ILE n 1 112 LEU n 1 113 GLY n 1 114 ASP n 1 115 VAL n 1 116 TYR n 1 117 PRO n 1 118 ILE n 1 119 GLU n 1 120 HIS n 1 121 ILE n 1 122 SER n 1 123 LYS n 1 124 ASN n 1 125 ILE n 1 126 SER n 1 127 ILE n 1 128 ILE n 1 129 GLN n 1 130 ASP n 1 131 ILE n 1 132 ILE n 1 133 SER n 1 134 GLU n 1 135 PHE n 1 136 ILE n 1 137 MET n 1 138 LYS n 1 139 ASN n 1 140 LYS n 1 141 PRO n 1 142 ILE n 1 143 THR n 1 144 ILE n 1 145 MET n 1 146 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NGK_1889 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain NCCP11945 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria gonorrhoeae (strain NCCP11945)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 521006 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name NegoA.19190.a.B1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 -5 HIS HIS A . n A 1 4 HIS 4 -4 -4 HIS HIS A . n A 1 5 HIS 5 -3 -3 HIS HIS A . n A 1 6 HIS 6 -2 -2 HIS HIS A . n A 1 7 HIS 7 -1 -1 HIS HIS A . n A 1 8 HIS 8 0 0 HIS HIS A . n A 1 9 MET 9 1 1 MET MET A . n A 1 10 LYS 10 2 2 LYS LYS A . n A 1 11 THR 11 3 3 THR THR A . n A 1 12 SER 12 4 4 SER SER A . n A 1 13 THR 13 5 5 THR THR A . n A 1 14 ILE 14 6 6 ILE ILE A . n A 1 15 VAL 15 7 7 VAL VAL A . n A 1 16 PHE 16 8 8 PHE PHE A . n A 1 17 GLY 17 9 9 GLY GLY A . n A 1 18 GLY 18 10 10 GLY GLY A . n A 1 19 PHE 19 11 11 PHE PHE A . n A 1 20 PHE 20 12 12 PHE PHE A . n A 1 21 ILE 21 13 13 ILE ILE A . n A 1 22 THR 22 14 14 THR THR A . n A 1 23 ASP 23 15 15 ASP ASP A . n A 1 24 ASN 24 16 16 ASN ASN A . n A 1 25 GLY 25 17 17 GLY GLY A . n A 1 26 GLU 26 18 18 GLU GLU A . n A 1 27 ARG 27 19 19 ARG ARG A . n A 1 28 ILE 28 20 20 ILE ILE A . n A 1 29 GLN 29 21 21 GLN GLN A . n A 1 30 ILE 30 22 22 ILE ILE A . n A 1 31 PRO 31 23 23 PRO PRO A . n A 1 32 ILE 32 24 24 ILE ILE A . n A 1 33 LEU 33 25 25 LEU LEU A . n A 1 34 GLU 34 26 26 GLU GLU A . n A 1 35 ASN 35 27 27 ASN ASN A . n A 1 36 PRO 36 28 28 PRO PRO A . n A 1 37 ASN 37 29 29 ASN ASN A . n A 1 38 ILE 38 30 30 ILE ILE A . n A 1 39 LYS 39 31 31 LYS LYS A . n A 1 40 GLU 40 32 32 GLU GLU A . n A 1 41 ILE 41 33 33 ILE ILE A . n A 1 42 ASN 42 34 34 ASN ASN A . n A 1 43 ASN 43 35 35 ASN ASN A . n A 1 44 PHE 44 36 36 PHE PHE A . n A 1 45 PHE 45 37 37 PHE PHE A . n A 1 46 SER 46 38 38 SER SER A . n A 1 47 VAL 47 39 39 VAL VAL A . n A 1 48 SER 48 40 40 SER SER A . n A 1 49 ASN 49 41 41 ASN ASN A . n A 1 50 PHE 50 42 42 PHE PHE A . n A 1 51 GLU 51 43 43 GLU GLU A . n A 1 52 LYS 52 44 44 LYS LYS A . n A 1 53 LYS 53 45 45 LYS LYS A . n A 1 54 ALA 54 46 46 ALA ALA A . n A 1 55 GLY 55 47 47 GLY GLY A . n A 1 56 VAL 56 48 48 VAL VAL A . n A 1 57 LEU 57 49 49 LEU LEU A . n A 1 58 VAL 58 50 50 VAL VAL A . n A 1 59 PHE 59 51 51 PHE PHE A . n A 1 60 ARG 60 52 52 ARG ARG A . n A 1 61 ILE 61 53 53 ILE ILE A . n A 1 62 ILE 62 54 54 ILE ILE A . n A 1 63 PRO 63 55 55 PRO PRO A . n A 1 64 GLU 64 56 56 GLU GLU A . n A 1 65 PRO 65 57 57 PRO PRO A . n A 1 66 GLU 66 58 58 GLU GLU A . n A 1 67 PHE 67 59 59 PHE PHE A . n A 1 68 GLY 68 60 60 GLY GLY A . n A 1 69 ASN 69 61 61 ASN ASN A . n A 1 70 THR 70 62 62 THR THR A . n A 1 71 GLU 71 63 63 GLU GLU A . n A 1 72 LEU 72 64 64 LEU LEU A . n A 1 73 THR 73 65 65 THR THR A . n A 1 74 ILE 74 66 66 ILE ILE A . n A 1 75 TYR 75 67 67 TYR TYR A . n A 1 76 PHE 76 68 68 PHE PHE A . n A 1 77 GLU 77 69 69 GLU GLU A . n A 1 78 LYS 78 70 70 LYS LYS A . n A 1 79 GLY 79 71 71 GLY GLY A . n A 1 80 TYR 80 72 72 TYR TYR A . n A 1 81 TYR 81 73 73 TYR TYR A . n A 1 82 LEU 82 74 74 LEU LEU A . n A 1 83 PRO 83 75 75 PRO PRO A . n A 1 84 ILE 84 76 76 ILE ILE A . n A 1 85 ILE 85 77 77 ILE ILE A . n A 1 86 GLN 86 78 78 GLN GLN A . n A 1 87 THR 87 79 79 THR THR A . n A 1 88 ILE 88 80 80 ILE ILE A . n A 1 89 LEU 89 81 81 LEU LEU A . n A 1 90 GLU 90 82 82 GLU GLU A . n A 1 91 ASP 91 83 83 ASP ASP A . n A 1 92 GLY 92 84 84 GLY GLY A . n A 1 93 ASP 93 85 85 ASP ASP A . n A 1 94 ILE 94 86 86 ILE ILE A . n A 1 95 GLU 95 87 87 GLU GLU A . n A 1 96 VAL 96 88 88 VAL VAL A . n A 1 97 LYS 97 89 89 LYS LYS A . n A 1 98 ASN 98 90 90 ASN ASN A . n A 1 99 LEU 99 91 91 LEU LEU A . n A 1 100 LYS 100 92 92 LYS LYS A . n A 1 101 THR 101 93 93 THR THR A . n A 1 102 GLU 102 94 94 GLU GLU A . n A 1 103 ASN 103 95 95 ASN ASN A . n A 1 104 TYR 104 96 96 TYR TYR A . n A 1 105 SER 105 97 97 SER SER A . n A 1 106 GLY 106 98 98 GLY GLY A . n A 1 107 ASN 107 99 99 ASN ASN A . n A 1 108 THR 108 100 100 THR THR A . n A 1 109 MET 109 101 101 MET MET A . n A 1 110 GLU 110 102 102 GLU GLU A . n A 1 111 ILE 111 103 103 ILE ILE A . n A 1 112 LEU 112 104 104 LEU LEU A . n A 1 113 GLY 113 105 105 GLY GLY A . n A 1 114 ASP 114 106 106 ASP ASP A . n A 1 115 VAL 115 107 107 VAL VAL A . n A 1 116 TYR 116 108 108 TYR TYR A . n A 1 117 PRO 117 109 109 PRO PRO A . n A 1 118 ILE 118 110 110 ILE ILE A . n A 1 119 GLU 119 111 111 GLU GLU A . n A 1 120 HIS 120 112 112 HIS HIS A . n A 1 121 ILE 121 113 113 ILE ILE A . n A 1 122 SER 122 114 114 SER SER A . n A 1 123 LYS 123 115 115 LYS LYS A . n A 1 124 ASN 124 116 116 ASN ASN A . n A 1 125 ILE 125 117 117 ILE ILE A . n A 1 126 SER 126 118 118 SER SER A . n A 1 127 ILE 127 119 119 ILE ILE A . n A 1 128 ILE 128 120 120 ILE ILE A . n A 1 129 GLN 129 121 121 GLN GLN A . n A 1 130 ASP 130 122 122 ASP ASP A . n A 1 131 ILE 131 123 123 ILE ILE A . n A 1 132 ILE 132 124 124 ILE ILE A . n A 1 133 SER 133 125 125 SER SER A . n A 1 134 GLU 134 126 126 GLU GLU A . n A 1 135 PHE 135 127 127 PHE PHE A . n A 1 136 ILE 136 128 128 ILE ILE A . n A 1 137 MET 137 129 129 MET MET A . n A 1 138 LYS 138 130 130 LYS LYS A . n A 1 139 ASN 139 131 131 ASN ASN A . n A 1 140 LYS 140 132 132 LYS LYS A . n A 1 141 PRO 141 133 133 PRO PRO A . n A 1 142 ILE 142 134 134 ILE ILE A . n A 1 143 THR 143 135 135 THR THR A . n A 1 144 ILE 144 136 136 ILE ILE A . n A 1 145 MET 145 137 137 MET MET A . n A 1 146 ILE 146 138 138 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 140 SO4 SO4 A . C 2 SO4 1 202 141 SO4 SO4 A . D 3 HOH 1 301 39 HOH HOH A . D 3 HOH 2 302 104 HOH HOH A . D 3 HOH 3 303 94 HOH HOH A . D 3 HOH 4 304 73 HOH HOH A . D 3 HOH 5 305 42 HOH HOH A . D 3 HOH 6 306 120 HOH HOH A . D 3 HOH 7 307 3 HOH HOH A . D 3 HOH 8 308 85 HOH HOH A . D 3 HOH 9 309 72 HOH HOH A . D 3 HOH 10 310 88 HOH HOH A . D 3 HOH 11 311 50 HOH HOH A . D 3 HOH 12 312 56 HOH HOH A . D 3 HOH 13 313 44 HOH HOH A . D 3 HOH 14 314 98 HOH HOH A . D 3 HOH 15 315 16 HOH HOH A . D 3 HOH 16 316 127 HOH HOH A . D 3 HOH 17 317 12 HOH HOH A . D 3 HOH 18 318 91 HOH HOH A . D 3 HOH 19 319 99 HOH HOH A . D 3 HOH 20 320 45 HOH HOH A . D 3 HOH 21 321 32 HOH HOH A . D 3 HOH 22 322 7 HOH HOH A . D 3 HOH 23 323 86 HOH HOH A . D 3 HOH 24 324 21 HOH HOH A . D 3 HOH 25 325 80 HOH HOH A . D 3 HOH 26 326 1 HOH HOH A . D 3 HOH 27 327 19 HOH HOH A . D 3 HOH 28 328 25 HOH HOH A . D 3 HOH 29 329 17 HOH HOH A . D 3 HOH 30 330 41 HOH HOH A . D 3 HOH 31 331 129 HOH HOH A . D 3 HOH 32 332 24 HOH HOH A . D 3 HOH 33 333 36 HOH HOH A . D 3 HOH 34 334 93 HOH HOH A . D 3 HOH 35 335 63 HOH HOH A . D 3 HOH 36 336 89 HOH HOH A . D 3 HOH 37 337 69 HOH HOH A . D 3 HOH 38 338 15 HOH HOH A . D 3 HOH 39 339 40 HOH HOH A . D 3 HOH 40 340 13 HOH HOH A . D 3 HOH 41 341 14 HOH HOH A . D 3 HOH 42 342 4 HOH HOH A . D 3 HOH 43 343 81 HOH HOH A . D 3 HOH 44 344 34 HOH HOH A . D 3 HOH 45 345 26 HOH HOH A . D 3 HOH 46 346 43 HOH HOH A . D 3 HOH 47 347 57 HOH HOH A . D 3 HOH 48 348 97 HOH HOH A . D 3 HOH 49 349 124 HOH HOH A . D 3 HOH 50 350 6 HOH HOH A . D 3 HOH 51 351 30 HOH HOH A . D 3 HOH 52 352 8 HOH HOH A . D 3 HOH 53 353 20 HOH HOH A . D 3 HOH 54 354 9 HOH HOH A . D 3 HOH 55 355 2 HOH HOH A . D 3 HOH 56 356 55 HOH HOH A . D 3 HOH 57 357 10 HOH HOH A . D 3 HOH 58 358 33 HOH HOH A . D 3 HOH 59 359 46 HOH HOH A . D 3 HOH 60 360 92 HOH HOH A . D 3 HOH 61 361 22 HOH HOH A . D 3 HOH 62 362 49 HOH HOH A . D 3 HOH 63 363 67 HOH HOH A . D 3 HOH 64 364 11 HOH HOH A . D 3 HOH 65 365 59 HOH HOH A . D 3 HOH 66 366 31 HOH HOH A . D 3 HOH 67 367 65 HOH HOH A . D 3 HOH 68 368 35 HOH HOH A . D 3 HOH 69 369 83 HOH HOH A . D 3 HOH 70 370 102 HOH HOH A . D 3 HOH 71 371 51 HOH HOH A . D 3 HOH 72 372 117 HOH HOH A . D 3 HOH 73 373 118 HOH HOH A . D 3 HOH 74 374 75 HOH HOH A . D 3 HOH 75 375 125 HOH HOH A . D 3 HOH 76 376 54 HOH HOH A . D 3 HOH 77 377 53 HOH HOH A . D 3 HOH 78 378 78 HOH HOH A . D 3 HOH 79 379 77 HOH HOH A . D 3 HOH 80 380 38 HOH HOH A . D 3 HOH 81 381 95 HOH HOH A . D 3 HOH 82 382 108 HOH HOH A . D 3 HOH 83 383 128 HOH HOH A . D 3 HOH 84 384 103 HOH HOH A . D 3 HOH 85 385 60 HOH HOH A . D 3 HOH 86 386 5 HOH HOH A . D 3 HOH 87 387 76 HOH HOH A . D 3 HOH 88 388 66 HOH HOH A . D 3 HOH 89 389 82 HOH HOH A . D 3 HOH 90 390 37 HOH HOH A . D 3 HOH 91 391 64 HOH HOH A . D 3 HOH 92 392 121 HOH HOH A . D 3 HOH 93 393 122 HOH HOH A . D 3 HOH 94 394 115 HOH HOH A . D 3 HOH 95 395 68 HOH HOH A . D 3 HOH 96 396 23 HOH HOH A . D 3 HOH 97 397 74 HOH HOH A . D 3 HOH 98 398 112 HOH HOH A . D 3 HOH 99 399 48 HOH HOH A . D 3 HOH 100 400 116 HOH HOH A . D 3 HOH 101 401 62 HOH HOH A . D 3 HOH 102 402 113 HOH HOH A . D 3 HOH 103 403 47 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS -5 ? CG ? A HIS 3 CG 2 1 Y 1 A HIS -5 ? ND1 ? A HIS 3 ND1 3 1 Y 1 A HIS -5 ? CD2 ? A HIS 3 CD2 4 1 Y 1 A HIS -5 ? CE1 ? A HIS 3 CE1 5 1 Y 1 A HIS -5 ? NE2 ? A HIS 3 NE2 6 1 Y 1 A HIS -4 ? CG ? A HIS 4 CG 7 1 Y 1 A HIS -4 ? ND1 ? A HIS 4 ND1 8 1 Y 1 A HIS -4 ? CD2 ? A HIS 4 CD2 9 1 Y 1 A HIS -4 ? CE1 ? A HIS 4 CE1 10 1 Y 1 A HIS -4 ? NE2 ? A HIS 4 NE2 11 1 Y 1 A HIS -2 ? CG ? A HIS 6 CG 12 1 Y 1 A HIS -2 ? ND1 ? A HIS 6 ND1 13 1 Y 1 A HIS -2 ? CD2 ? A HIS 6 CD2 14 1 Y 1 A HIS -2 ? CE1 ? A HIS 6 CE1 15 1 Y 1 A HIS -2 ? NE2 ? A HIS 6 NE2 16 1 Y 1 A LYS 2 ? CG ? A LYS 10 CG 17 1 Y 1 A LYS 2 ? CD ? A LYS 10 CD 18 1 Y 1 A LYS 2 ? CE ? A LYS 10 CE 19 1 Y 1 A LYS 2 ? NZ ? A LYS 10 NZ 20 1 Y 1 A GLU 43 ? CG ? A GLU 51 CG 21 1 Y 1 A GLU 43 ? CD ? A GLU 51 CD 22 1 Y 1 A GLU 43 ? OE1 ? A GLU 51 OE1 23 1 Y 1 A GLU 43 ? OE2 ? A GLU 51 OE2 24 1 Y 1 A LYS 44 ? CG ? A LYS 52 CG 25 1 Y 1 A LYS 44 ? CD ? A LYS 52 CD 26 1 Y 1 A LYS 44 ? CE ? A LYS 52 CE 27 1 Y 1 A LYS 44 ? NZ ? A LYS 52 NZ 28 1 Y 1 A GLU 82 ? CG ? A GLU 90 CG 29 1 Y 1 A GLU 82 ? CD ? A GLU 90 CD 30 1 Y 1 A GLU 82 ? OE1 ? A GLU 90 OE1 31 1 Y 1 A GLU 82 ? OE2 ? A GLU 90 OE2 32 1 Y 1 A LYS 92 ? CG ? A LYS 100 CG 33 1 Y 1 A LYS 92 ? CD ? A LYS 100 CD 34 1 Y 1 A LYS 92 ? CE ? A LYS 100 CE 35 1 Y 1 A LYS 92 ? NZ ? A LYS 100 NZ 36 1 Y 1 A ILE 134 ? CG1 ? A ILE 142 CG1 37 1 Y 1 A ILE 134 ? CG2 ? A ILE 142 CG2 38 1 Y 1 A ILE 134 ? CD1 ? A ILE 142 CD1 39 1 Y 1 A THR 135 ? OG1 ? A THR 143 OG1 40 1 Y 1 A THR 135 ? CG2 ? A THR 143 CG2 41 1 Y 1 A ILE 136 ? CG1 ? A ILE 144 CG1 42 1 Y 1 A ILE 136 ? CG2 ? A ILE 144 CG2 43 1 Y 1 A ILE 136 ? CD1 ? A ILE 144 CD1 44 1 Y 1 A ILE 138 ? CG1 ? A ILE 146 CG1 45 1 Y 1 A ILE 138 ? CG2 ? A ILE 146 CG2 46 1 Y 1 A ILE 138 ? CD1 ? A ILE 146 CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.17 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 6 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 7 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 8 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ANZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.930 _cell.length_a_esd ? _cell.length_b 74.400 _cell.length_b_esd ? _cell.length_c 78.560 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ANZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ANZ _exptl.crystals_number 2 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # loop_ _exptl_crystal.colour _exptl_crystal.density_diffrn _exptl_crystal.density_Matthews _exptl_crystal.density_method _exptl_crystal.density_percent_sol _exptl_crystal.description _exptl_crystal.F_000 _exptl_crystal.id _exptl_crystal.preparation _exptl_crystal.size_max _exptl_crystal.size_mid _exptl_crystal.size_min _exptl_crystal.size_rad _exptl_crystal.colour_lustre _exptl_crystal.colour_modifier _exptl_crystal.colour_primary _exptl_crystal.density_meas _exptl_crystal.density_meas_esd _exptl_crystal.density_meas_gt _exptl_crystal.density_meas_lt _exptl_crystal.density_meas_temp _exptl_crystal.density_meas_temp_esd _exptl_crystal.density_meas_temp_gt _exptl_crystal.density_meas_temp_lt _exptl_crystal.pdbx_crystal_image_url _exptl_crystal.pdbx_crystal_image_format _exptl_crystal.pdbx_mosaicity _exptl_crystal.pdbx_mosaicity_esd ? ? 2.17 ? 43 ? ? 1 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.04 ? 40 ? ? 2 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _exptl_crystal_grow.apparatus _exptl_crystal_grow.atmosphere _exptl_crystal_grow.crystal_id _exptl_crystal_grow.details _exptl_crystal_grow.method _exptl_crystal_grow.method_ref _exptl_crystal_grow.pH _exptl_crystal_grow.pressure _exptl_crystal_grow.pressure_esd _exptl_crystal_grow.seeding _exptl_crystal_grow.seeding_ref _exptl_crystal_grow.temp _exptl_crystal_grow.temp_details _exptl_crystal_grow.temp_esd _exptl_crystal_grow.time _exptl_crystal_grow.pdbx_details _exptl_crystal_grow.pdbx_pH_range ? ? 1 ? 'VAPOR DIFFUSION, SITTING DROP' ? ? ? ? ? ? 290 ? ? ? ;Native protein: Micolytic MCSG1 D8 (1.5 M ammonium sulfate, 100 mM sodium chloride, 100 mM Bis-Tris/HCl, pH 6.5), 25.6 mg/mL NegoA.19190.a.B1.PS38056, cryoprotectant: 25% ethylene glycol, puck MXK4-1, tray 285291d8, I222 crystal form ; ? ? ? 2 ? 'VAPOR DIFFUSION, SITTING DROP' ? 9 ? ? ? ? 289 ? ? ? ;Iodide soak for phasing: RigakuReagents JCSG+ C10 (10% PEG20000, 2% dioxane, 100 mM Bicine/NaOH, pH 9.0), 25.6 mg/mL NegoA.19190.a.B1.PS38056, crystal soaked in 20% ethylene glycol and 2.5 M sodium iodide, then flash frozen, puck ZDJ2-5, tray 285290 c10, P212121 crystal form ; ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 100 ? ? 2 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? CCD 1 'RAYONIX MX-300' ? ? ? ? 2017-06-23 ? CCD 2 'RIGAKU SATURN 944+' ? ? ? ? 2017-07-21 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? 'diamond(111)' ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? 'Rigaku Varimax' ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97872 1.0 2 1.5418 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'APS BEAMLINE 21-ID-F' ? ? 0.97872 ? 21-ID-F APS ? ? 2 ? ? 'ROTATING ANODE' ? 'RIGAKU FR-E+ SUPERBRIGHT' ? ? 1.5418 ? ? ? # _reflns.B_iso_Wilson_estimate 21.120 _reflns.entry_id 6ANZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.600 _reflns.d_resolution_low 41.459 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19646 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.056 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.017 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.600 1.640 ? 2.780 ? ? ? ? 1411 98.700 ? ? ? ? 0.592 ? ? ? ? ? ? ? ? 5.905 ? ? ? ? 0.649 ? ? 1 1 0.873 ? 1.640 1.690 ? 3.530 ? ? ? ? 1392 99.500 ? ? ? ? 0.483 ? ? ? ? ? ? ? ? 6.154 ? ? ? ? 0.528 ? ? 2 1 0.883 ? 1.690 1.740 ? 4.520 ? ? ? ? 1350 99.600 ? ? ? ? 0.379 ? ? ? ? ? ? ? ? 6.092 ? ? ? ? 0.415 ? ? 3 1 0.926 ? 1.740 1.790 ? 5.710 ? ? ? ? 1340 99.700 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? 6.106 ? ? ? ? 0.323 ? ? 4 1 0.956 ? 1.790 1.850 ? 7.670 ? ? ? ? 1277 99.900 ? ? ? ? 0.215 ? ? ? ? ? ? ? ? 6.153 ? ? ? ? 0.235 ? ? 5 1 0.981 ? 1.850 1.910 ? 9.600 ? ? ? ? 1245 99.800 ? ? ? ? 0.172 ? ? ? ? ? ? ? ? 6.133 ? ? ? ? 0.188 ? ? 6 1 0.983 ? 1.910 1.980 ? 12.750 ? ? ? ? 1185 99.900 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.130 ? ? ? ? 0.137 ? ? 7 1 0.991 ? 1.980 2.070 ? 15.330 ? ? ? ? 1181 99.800 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 6.127 ? ? ? ? 0.111 ? ? 8 1 0.994 ? 2.070 2.160 ? 17.600 ? ? ? ? 1092 99.700 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 6.109 ? ? ? ? 0.096 ? ? 9 1 0.994 ? 2.160 2.260 ? 20.210 ? ? ? ? 1069 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 6.083 ? ? ? ? 0.083 ? ? 10 1 0.995 ? 2.260 2.390 ? 22.120 ? ? ? ? 1024 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 6.132 ? ? ? ? 0.073 ? ? 11 1 0.996 ? 2.390 2.530 ? 24.160 ? ? ? ? 946 99.900 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 6.113 ? ? ? ? 0.066 ? ? 12 1 0.997 ? 2.530 2.700 ? 26.030 ? ? ? ? 917 99.800 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 6.113 ? ? ? ? 0.061 ? ? 13 1 0.997 ? 2.700 2.920 ? 28.290 ? ? ? ? 841 99.900 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 5.999 ? ? ? ? 0.054 ? ? 14 1 0.998 ? 2.920 3.200 ? 30.570 ? ? ? ? 788 99.700 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 6.028 ? ? ? ? 0.051 ? ? 15 1 0.998 ? 3.200 3.580 ? 33.370 ? ? ? ? 723 100.000 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 5.992 ? ? ? ? 0.048 ? ? 16 1 0.997 ? 3.580 4.130 ? 34.550 ? ? ? ? 630 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 5.933 ? ? ? ? 0.047 ? ? 17 1 0.998 ? 4.130 5.060 ? 35.410 ? ? ? ? 547 99.800 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 5.916 ? ? ? ? 0.045 ? ? 18 1 0.998 ? 5.060 7.160 ? 34.090 ? ? ? ? 435 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 5.630 ? ? ? ? 0.044 ? ? 19 1 0.998 ? 7.160 41.459 ? 33.680 ? ? ? ? 253 96.900 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 5.123 ? ? ? ? 0.049 ? ? 20 1 0.994 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 94.810 _refine.B_iso_mean 30.8044 _refine.B_iso_min 13.050 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ANZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6000 _refine.ls_d_res_low 41.4590 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19645 _refine.ls_number_reflns_R_free 1900 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7000 _refine.ls_percent_reflns_R_free 9.6700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1842 _refine.ls_R_factor_R_free 0.2102 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1813 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 0 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.1300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.6000 _refine_hist.d_res_low 41.4590 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 1245 _refine_hist.pdbx_number_residues_total 144 _refine_hist.pdbx_B_iso_mean_ligand 36.99 _refine_hist.pdbx_B_iso_mean_solvent 40.30 _refine_hist.pdbx_number_atoms_protein 1129 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1232 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.081 ? 1694 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 195 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 221 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.049 ? 761 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6000 1.6400 . . 114 1251 99.0000 . . . 0.3015 0.0000 0.2411 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6400 1.6844 . . 122 1247 99.0000 . . . 0.2932 0.0000 0.2307 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6844 1.7339 . . 129 1255 100.0000 . . . 0.2863 0.0000 0.2163 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7339 1.7899 . . 138 1269 100.0000 . . . 0.2264 0.0000 0.2185 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7899 1.8539 . . 131 1235 100.0000 . . . 0.2534 0.0000 0.2007 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8539 1.9281 . . 125 1273 100.0000 . . . 0.2365 0.0000 0.1926 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9281 2.0158 . . 148 1233 100.0000 . . . 0.2056 0.0000 0.1881 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0158 2.1221 . . 126 1282 100.0000 . . . 0.2378 0.0000 0.1789 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1221 2.2551 . . 155 1237 100.0000 . . . 0.2144 0.0000 0.1768 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2551 2.4292 . . 130 1267 100.0000 . . . 0.2128 0.0000 0.1872 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4292 2.6736 . . 113 1298 100.0000 . . . 0.2307 0.0000 0.1917 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6736 3.0603 . . 153 1264 100.0000 . . . 0.2073 0.0000 0.1900 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0603 3.8553 . . 169 1272 100.0000 . . . 0.1918 0.0000 0.1626 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8553 41.4590 . . 147 1362 99.0000 . . . 0.1855 0.0000 0.1663 . . . . . . . . . . # _struct.entry_id 6ANZ _struct.title 'Crystal structure of a hypothetical protein from Neisseria gonorrhoeae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ANZ _struct_keywords.text ;SSGCID, Neisseria gonorrhoeae, hypothetical protein, uncharacterized protein, iodide phasing, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4RQJ2_NEIG2 _struct_ref.pdbx_db_accession B4RQJ2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTSTIVFGGFFITDNGERIQIPILENPNIKEINNFFSVSNFEKKAGVLVFRIIPEPEFGNTELTIYFEKGYYLPIIQTI LEDGDIEVKNLKTENYSGNTMEILGDVYPIEHISKNISIIQDIISEFIMKNKPITIMI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ANZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B4RQJ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ANZ MET A 1 ? UNP B4RQJ2 ? ? 'expression tag' -7 1 1 6ANZ ALA A 2 ? UNP B4RQJ2 ? ? 'expression tag' -6 2 1 6ANZ HIS A 3 ? UNP B4RQJ2 ? ? 'expression tag' -5 3 1 6ANZ HIS A 4 ? UNP B4RQJ2 ? ? 'expression tag' -4 4 1 6ANZ HIS A 5 ? UNP B4RQJ2 ? ? 'expression tag' -3 5 1 6ANZ HIS A 6 ? UNP B4RQJ2 ? ? 'expression tag' -2 6 1 6ANZ HIS A 7 ? UNP B4RQJ2 ? ? 'expression tag' -1 7 1 6ANZ HIS A 8 ? UNP B4RQJ2 ? ? 'expression tag' 0 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3880 ? 1 MORE -56 ? 1 'SSA (A^2)' 14780 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details dimeric # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 99.8600000000 0.0000000000 -1.0000000000 0.0000000000 148.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 8 ? SER A 12 ? HIS A 0 SER A 4 5 ? 5 HELX_P HELX_P2 AA2 ASN A 37 ? SER A 48 ? ASN A 29 SER A 40 1 ? 12 HELX_P HELX_P3 AA3 ASN A 49 ? LYS A 52 ? ASN A 41 LYS A 44 5 ? 4 HELX_P HELX_P4 AA4 GLU A 119 ? ILE A 121 ? GLU A 111 ILE A 113 5 ? 3 HELX_P HELX_P5 AA5 ASN A 124 ? LYS A 140 ? ASN A 116 LYS A 132 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 62 A . ? ILE 54 A PRO 63 A ? PRO 55 A 1 -6.40 2 ILE 62 A . ? ILE 54 A PRO 63 A ? PRO 55 A 1 -5.55 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 27 ? GLU A 34 ? ARG A 19 GLU A 26 AA1 2 THR A 13 ? ILE A 21 ? THR A 5 ILE A 13 AA1 3 ALA A 54 ? ILE A 62 ? ALA A 46 ILE A 54 AA1 4 GLY A 68 ? GLU A 77 ? GLY A 60 GLU A 69 AA1 5 TYR A 80 ? ILE A 88 ? TYR A 72 ILE A 80 AA1 6 ILE A 94 ? LYS A 97 ? ILE A 86 LYS A 89 AA2 1 THR A 108 ? ILE A 111 ? THR A 100 ILE A 103 AA2 2 ASP A 114 ? PRO A 117 ? ASP A 106 PRO A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 33 ? O LEU A 25 N PHE A 16 ? N PHE A 8 AA1 2 3 N THR A 13 ? N THR A 5 O ILE A 62 ? O ILE A 54 AA1 3 4 N LEU A 57 ? N LEU A 49 O ILE A 74 ? O ILE A 66 AA1 4 5 N TYR A 75 ? N TYR A 67 O LEU A 82 ? O LEU A 74 AA1 5 6 N ILE A 85 ? N ILE A 77 O LYS A 97 ? O LYS A 89 AA2 1 2 N MET A 109 ? N MET A 101 O TYR A 116 ? O TYR A 108 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 10 'binding site for residue SO4 A 201' AC2 Software A SO4 202 ? 4 'binding site for residue SO4 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 THR A 22 ? THR A 14 . ? 1_555 ? 2 AC1 10 THR A 22 ? THR A 14 . ? 4_576 ? 3 AC1 10 ASP A 23 ? ASP A 15 . ? 1_555 ? 4 AC1 10 ASP A 23 ? ASP A 15 . ? 4_576 ? 5 AC1 10 ASN A 24 ? ASN A 16 . ? 1_555 ? 6 AC1 10 ASN A 24 ? ASN A 16 . ? 4_576 ? 7 AC1 10 GLU A 26 ? GLU A 18 . ? 4_576 ? 8 AC1 10 GLU A 26 ? GLU A 18 . ? 1_555 ? 9 AC1 10 HOH D . ? HOH A 324 . ? 4_576 ? 10 AC1 10 HOH D . ? HOH A 324 . ? 1_555 ? 11 AC2 4 HIS A 8 ? HIS A 0 . ? 1_555 ? 12 AC2 4 MET A 9 ? MET A 1 . ? 1_555 ? 13 AC2 4 LYS A 10 ? LYS A 2 . ? 1_555 ? 14 AC2 4 HOH D . ? HOH A 349 . ? 1_555 ? # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 201 ? B SO4 . 2 1 A HOH 310 ? D HOH . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 48.9129 76.9755 26.5294 0.2331 0.1291 0.1825 -0.0235 0.0324 0.0451 4.0657 2.5112 3.9808 0.7099 1.6134 0.2910 0.0006 0.0004 -0.0426 -0.0296 -0.0746 0.2282 -0.2627 0.1932 -0.1789 'X-RAY DIFFRACTION' 2 ? refined 52.3072 87.4652 33.1827 0.2776 0.2165 0.1492 -0.0042 -0.0472 -0.0178 6.4139 4.9741 3.0978 -3.9294 -2.2145 -1.0108 -0.3613 0.3077 0.0573 -0.2679 0.2952 -0.0978 0.3019 -0.3786 -0.0630 'X-RAY DIFFRACTION' 3 ? refined 49.4788 79.8440 20.4596 0.1308 0.1130 0.1439 -0.0056 0.0102 0.0045 9.3163 2.5616 4.1693 0.7448 4.7085 0.1649 0.0543 0.0163 -0.1292 0.1828 -0.2341 0.1846 -0.1196 0.1601 -0.0117 'X-RAY DIFFRACTION' 4 ? refined 54.5998 82.0478 14.3724 0.2007 0.2824 0.1482 -0.0101 0.0167 0.0208 4.8125 3.8696 3.8927 2.5913 3.7961 1.4555 -0.3795 0.2624 0.1389 0.7919 -0.0883 -0.0244 -0.5550 -0.2388 0.3246 'X-RAY DIFFRACTION' 5 ? refined 60.8634 87.6202 17.0339 0.1916 0.1659 0.1782 -0.0135 0.0245 0.0517 4.9543 1.9506 1.4139 0.2102 -1.4528 0.4284 -0.0728 0.0530 0.0076 0.3705 0.1772 -0.3300 -0.2362 -0.0911 0.1011 'X-RAY DIFFRACTION' 6 ? refined 33.5090 92.3248 25.1269 0.3972 0.4460 0.5658 0.0226 -0.0177 0.1336 3.4740 2.8787 3.0461 0.7813 -2.3885 1.4365 -0.2656 -0.2979 0.4938 -0.7097 -0.8009 0.2570 0.8634 -0.1858 -0.1327 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -5 A 21 ;chain 'A' and (resid -5 through 21 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 22 A 45 ;chain 'A' and (resid 22 through 45 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 46 A 69 ;chain 'A' and (resid 46 through 69 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 70 A 89 ;chain 'A' and (resid 70 through 89 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 90 A 131 ;chain 'A' and (resid 90 through 131 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 132 A 138 ;chain 'A' and (resid 132 through 138 ) ; ? ? ? ? ? # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _atom_sites.entry_id 6ANZ _atom_sites.fract_transf_matrix[1][1] 0.020028 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013441 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012729 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_