data_6AOC # _entry.id 6AOC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AOC pdb_00006aoc 10.2210/pdb6aoc/pdb WWPDB D_1000229563 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AOC _pdbx_database_status.recvd_initial_deposition_date 2017-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kirby, K.A.' 1 0000-0003-2468-4796 'Sarafianos, S.G.' 2 0000-0002-5840-154X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Eur J Med Chem' _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 1768-3254 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 141 _citation.language ? _citation.page_first 149 _citation.page_last 161 _citation.title ;Design, synthesis and biological evaluations of N-Hydroxy thienopyrimidine-2,4-diones as inhibitors of HIV reverse transcriptase-associated RNase H. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2017.09.054 _citation.pdbx_database_id_PubMed 29031062 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kankanala, J.' 1 ? primary 'Kirby, K.A.' 2 ? primary 'Huber, A.D.' 3 ? primary 'Casey, M.C.' 4 ? primary 'Wilson, D.J.' 5 ? primary 'Sarafianos, S.G.' 6 ? primary 'Wang, Z.' 7 ? # _cell.angle_alpha 105.720 _cell.angle_alpha_esd ? _cell.angle_beta 95.030 _cell.angle_beta_esd ? _cell.angle_gamma 110.720 _cell.angle_gamma_esd ? _cell.entry_id 6AOC _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.370 _cell.length_a_esd ? _cell.length_b 89.120 _cell.length_b_esd ? _cell.length_c 112.730 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AOC _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Reverse transcriptase/ribonuclease H' 64105.441 2 2.7.7.49,2.7.7.7,3.1.26.13 C280S 'p66 domain residues 168-722' ? 2 polymer man 'p51 RT' 50096.539 2 ? C280S 'p51 domain residues 168-595' ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 4 ? ? ? ? 4 non-polymer syn '6-benzyl-3-hydroxythieno[2,3-d]pyrimidine-2,4(1H,3H)-dione' 274.295 2 ? ? ? ? 5 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 7 ? ? ? ? 6 non-polymer syn 1,2-ETHANEDIOL 62.068 68 ? ? ? ? 7 water nat water 18.015 1147 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Exoribonuclease H, p66 RT' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK WTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE LQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG ; ;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK WTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE LQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG ; A,C ? 2 'polypeptide(L)' no no ;GPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI FQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW TVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE TWWTEYWQATWIPEWEFVNTPPLVKLWYQ ; ;GPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI FQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW TVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE TWWTEYWQATWIPEWEFVNTPPLVKLWYQ ; B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 PRO n 1 4 ILE n 1 5 SER n 1 6 PRO n 1 7 ILE n 1 8 GLU n 1 9 THR n 1 10 VAL n 1 11 PRO n 1 12 VAL n 1 13 LYS n 1 14 LEU n 1 15 LYS n 1 16 PRO n 1 17 GLY n 1 18 MET n 1 19 ASP n 1 20 GLY n 1 21 PRO n 1 22 LYS n 1 23 VAL n 1 24 LYS n 1 25 GLN n 1 26 TRP n 1 27 PRO n 1 28 LEU n 1 29 THR n 1 30 GLU n 1 31 GLU n 1 32 LYS n 1 33 ILE n 1 34 LYS n 1 35 ALA n 1 36 LEU n 1 37 VAL n 1 38 GLU n 1 39 ILE n 1 40 CYS n 1 41 THR n 1 42 GLU n 1 43 MET n 1 44 GLU n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 LYS n 1 49 ILE n 1 50 SER n 1 51 LYS n 1 52 ILE n 1 53 GLY n 1 54 PRO n 1 55 GLU n 1 56 ASN n 1 57 PRO n 1 58 TYR n 1 59 ASN n 1 60 THR n 1 61 PRO n 1 62 VAL n 1 63 PHE n 1 64 ALA n 1 65 ILE n 1 66 LYS n 1 67 LYS n 1 68 LYS n 1 69 ASP n 1 70 SER n 1 71 THR n 1 72 LYS n 1 73 TRP n 1 74 ARG n 1 75 LYS n 1 76 LEU n 1 77 VAL n 1 78 ASP n 1 79 PHE n 1 80 ARG n 1 81 GLU n 1 82 LEU n 1 83 ASN n 1 84 LYS n 1 85 ARG n 1 86 THR n 1 87 GLN n 1 88 ASP n 1 89 PHE n 1 90 TRP n 1 91 GLU n 1 92 VAL n 1 93 GLN n 1 94 LEU n 1 95 GLY n 1 96 ILE n 1 97 PRO n 1 98 HIS n 1 99 PRO n 1 100 ALA n 1 101 GLY n 1 102 LEU n 1 103 LYS n 1 104 LYS n 1 105 LYS n 1 106 LYS n 1 107 SER n 1 108 VAL n 1 109 THR n 1 110 VAL n 1 111 LEU n 1 112 ASP n 1 113 VAL n 1 114 GLY n 1 115 ASP n 1 116 ALA n 1 117 TYR n 1 118 PHE n 1 119 SER n 1 120 VAL n 1 121 PRO n 1 122 LEU n 1 123 ASP n 1 124 GLU n 1 125 ASP n 1 126 PHE n 1 127 ARG n 1 128 LYS n 1 129 TYR n 1 130 THR n 1 131 ALA n 1 132 PHE n 1 133 THR n 1 134 ILE n 1 135 PRO n 1 136 SER n 1 137 ILE n 1 138 ASN n 1 139 ASN n 1 140 GLU n 1 141 THR n 1 142 PRO n 1 143 GLY n 1 144 ILE n 1 145 ARG n 1 146 TYR n 1 147 GLN n 1 148 TYR n 1 149 ASN n 1 150 VAL n 1 151 LEU n 1 152 PRO n 1 153 GLN n 1 154 GLY n 1 155 TRP n 1 156 LYS n 1 157 GLY n 1 158 SER n 1 159 PRO n 1 160 ALA n 1 161 ILE n 1 162 PHE n 1 163 GLN n 1 164 SER n 1 165 SER n 1 166 MET n 1 167 THR n 1 168 LYS n 1 169 ILE n 1 170 LEU n 1 171 GLU n 1 172 PRO n 1 173 PHE n 1 174 LYS n 1 175 LYS n 1 176 GLN n 1 177 ASN n 1 178 PRO n 1 179 ASP n 1 180 ILE n 1 181 VAL n 1 182 ILE n 1 183 TYR n 1 184 GLN n 1 185 TYR n 1 186 MET n 1 187 ASP n 1 188 ASP n 1 189 LEU n 1 190 TYR n 1 191 VAL n 1 192 GLY n 1 193 SER n 1 194 ASP n 1 195 LEU n 1 196 GLU n 1 197 ILE n 1 198 GLY n 1 199 GLN n 1 200 HIS n 1 201 ARG n 1 202 THR n 1 203 LYS n 1 204 ILE n 1 205 GLU n 1 206 GLU n 1 207 LEU n 1 208 ARG n 1 209 GLN n 1 210 HIS n 1 211 LEU n 1 212 LEU n 1 213 ARG n 1 214 TRP n 1 215 GLY n 1 216 LEU n 1 217 THR n 1 218 THR n 1 219 PRO n 1 220 ASP n 1 221 LYS n 1 222 LYS n 1 223 HIS n 1 224 GLN n 1 225 LYS n 1 226 GLU n 1 227 PRO n 1 228 PRO n 1 229 PHE n 1 230 LEU n 1 231 TRP n 1 232 MET n 1 233 GLY n 1 234 TYR n 1 235 GLU n 1 236 LEU n 1 237 HIS n 1 238 PRO n 1 239 ASP n 1 240 LYS n 1 241 TRP n 1 242 THR n 1 243 VAL n 1 244 GLN n 1 245 PRO n 1 246 ILE n 1 247 VAL n 1 248 LEU n 1 249 PRO n 1 250 GLU n 1 251 LYS n 1 252 ASP n 1 253 SER n 1 254 TRP n 1 255 THR n 1 256 VAL n 1 257 ASN n 1 258 ASP n 1 259 ILE n 1 260 GLN n 1 261 LYS n 1 262 LEU n 1 263 VAL n 1 264 GLY n 1 265 LYS n 1 266 LEU n 1 267 ASN n 1 268 TRP n 1 269 ALA n 1 270 SER n 1 271 GLN n 1 272 ILE n 1 273 TYR n 1 274 PRO n 1 275 GLY n 1 276 ILE n 1 277 LYS n 1 278 VAL n 1 279 ARG n 1 280 GLN n 1 281 LEU n 1 282 SER n 1 283 LYS n 1 284 LEU n 1 285 LEU n 1 286 ARG n 1 287 GLY n 1 288 THR n 1 289 LYS n 1 290 ALA n 1 291 LEU n 1 292 THR n 1 293 GLU n 1 294 VAL n 1 295 ILE n 1 296 PRO n 1 297 LEU n 1 298 THR n 1 299 GLU n 1 300 GLU n 1 301 ALA n 1 302 GLU n 1 303 LEU n 1 304 GLU n 1 305 LEU n 1 306 ALA n 1 307 GLU n 1 308 ASN n 1 309 ARG n 1 310 GLU n 1 311 ILE n 1 312 LEU n 1 313 LYS n 1 314 GLU n 1 315 PRO n 1 316 VAL n 1 317 HIS n 1 318 GLY n 1 319 VAL n 1 320 TYR n 1 321 TYR n 1 322 ASP n 1 323 PRO n 1 324 SER n 1 325 LYS n 1 326 ASP n 1 327 LEU n 1 328 ILE n 1 329 ALA n 1 330 GLU n 1 331 ILE n 1 332 GLN n 1 333 LYS n 1 334 GLN n 1 335 GLY n 1 336 GLN n 1 337 GLY n 1 338 GLN n 1 339 TRP n 1 340 THR n 1 341 TYR n 1 342 GLN n 1 343 ILE n 1 344 TYR n 1 345 GLN n 1 346 GLU n 1 347 PRO n 1 348 PHE n 1 349 LYS n 1 350 ASN n 1 351 LEU n 1 352 LYS n 1 353 THR n 1 354 GLY n 1 355 LYS n 1 356 TYR n 1 357 ALA n 1 358 ARG n 1 359 MET n 1 360 ARG n 1 361 GLY n 1 362 ALA n 1 363 HIS n 1 364 THR n 1 365 ASN n 1 366 ASP n 1 367 VAL n 1 368 LYS n 1 369 GLN n 1 370 LEU n 1 371 THR n 1 372 GLU n 1 373 ALA n 1 374 VAL n 1 375 GLN n 1 376 LYS n 1 377 ILE n 1 378 THR n 1 379 THR n 1 380 GLU n 1 381 SER n 1 382 ILE n 1 383 VAL n 1 384 ILE n 1 385 TRP n 1 386 GLY n 1 387 LYS n 1 388 THR n 1 389 PRO n 1 390 LYS n 1 391 PHE n 1 392 LYS n 1 393 LEU n 1 394 PRO n 1 395 ILE n 1 396 GLN n 1 397 LYS n 1 398 GLU n 1 399 THR n 1 400 TRP n 1 401 GLU n 1 402 THR n 1 403 TRP n 1 404 TRP n 1 405 THR n 1 406 GLU n 1 407 TYR n 1 408 TRP n 1 409 GLN n 1 410 ALA n 1 411 THR n 1 412 TRP n 1 413 ILE n 1 414 PRO n 1 415 GLU n 1 416 TRP n 1 417 GLU n 1 418 PHE n 1 419 VAL n 1 420 ASN n 1 421 THR n 1 422 PRO n 1 423 PRO n 1 424 LEU n 1 425 VAL n 1 426 LYS n 1 427 LEU n 1 428 TRP n 1 429 TYR n 1 430 GLN n 1 431 LEU n 1 432 GLU n 1 433 LYS n 1 434 GLU n 1 435 PRO n 1 436 ILE n 1 437 VAL n 1 438 GLY n 1 439 ALA n 1 440 GLU n 1 441 THR n 1 442 PHE n 1 443 TYR n 1 444 VAL n 1 445 ASP n 1 446 GLY n 1 447 ALA n 1 448 ALA n 1 449 ASN n 1 450 ARG n 1 451 GLU n 1 452 THR n 1 453 LYS n 1 454 LEU n 1 455 GLY n 1 456 LYS n 1 457 ALA n 1 458 GLY n 1 459 TYR n 1 460 VAL n 1 461 THR n 1 462 ASN n 1 463 LYS n 1 464 GLY n 1 465 ARG n 1 466 GLN n 1 467 LYS n 1 468 VAL n 1 469 VAL n 1 470 PRO n 1 471 LEU n 1 472 THR n 1 473 ASN n 1 474 THR n 1 475 THR n 1 476 ASN n 1 477 GLN n 1 478 LYS n 1 479 THR n 1 480 GLU n 1 481 LEU n 1 482 GLN n 1 483 ALA n 1 484 ILE n 1 485 TYR n 1 486 LEU n 1 487 ALA n 1 488 LEU n 1 489 GLN n 1 490 ASP n 1 491 SER n 1 492 GLY n 1 493 LEU n 1 494 GLU n 1 495 VAL n 1 496 ASN n 1 497 ILE n 1 498 VAL n 1 499 THR n 1 500 ASP n 1 501 SER n 1 502 GLN n 1 503 TYR n 1 504 ALA n 1 505 LEU n 1 506 GLY n 1 507 ILE n 1 508 ILE n 1 509 GLN n 1 510 ALA n 1 511 GLN n 1 512 PRO n 1 513 ASP n 1 514 LYS n 1 515 SER n 1 516 GLU n 1 517 SER n 1 518 GLU n 1 519 LEU n 1 520 VAL n 1 521 ASN n 1 522 GLN n 1 523 ILE n 1 524 ILE n 1 525 GLU n 1 526 GLN n 1 527 LEU n 1 528 ILE n 1 529 LYS n 1 530 LYS n 1 531 GLU n 1 532 LYS n 1 533 VAL n 1 534 TYR n 1 535 LEU n 1 536 ALA n 1 537 TRP n 1 538 VAL n 1 539 PRO n 1 540 ALA n 1 541 HIS n 1 542 LYS n 1 543 GLY n 1 544 ILE n 1 545 GLY n 1 546 GLY n 1 547 ASN n 1 548 GLU n 1 549 GLN n 1 550 VAL n 1 551 ASP n 1 552 LYS n 1 553 LEU n 1 554 VAL n 1 555 SER n 1 556 ALA n 1 557 GLY n 2 1 GLY n 2 2 PRO n 2 3 ILE n 2 4 SER n 2 5 PRO n 2 6 ILE n 2 7 GLU n 2 8 THR n 2 9 VAL n 2 10 PRO n 2 11 VAL n 2 12 LYS n 2 13 LEU n 2 14 LYS n 2 15 PRO n 2 16 GLY n 2 17 MET n 2 18 ASP n 2 19 GLY n 2 20 PRO n 2 21 LYS n 2 22 VAL n 2 23 LYS n 2 24 GLN n 2 25 TRP n 2 26 PRO n 2 27 LEU n 2 28 THR n 2 29 GLU n 2 30 GLU n 2 31 LYS n 2 32 ILE n 2 33 LYS n 2 34 ALA n 2 35 LEU n 2 36 VAL n 2 37 GLU n 2 38 ILE n 2 39 CYS n 2 40 THR n 2 41 GLU n 2 42 MET n 2 43 GLU n 2 44 LYS n 2 45 GLU n 2 46 GLY n 2 47 LYS n 2 48 ILE n 2 49 SER n 2 50 LYS n 2 51 ILE n 2 52 GLY n 2 53 PRO n 2 54 GLU n 2 55 ASN n 2 56 PRO n 2 57 TYR n 2 58 ASN n 2 59 THR n 2 60 PRO n 2 61 VAL n 2 62 PHE n 2 63 ALA n 2 64 ILE n 2 65 LYS n 2 66 LYS n 2 67 LYS n 2 68 ASP n 2 69 SER n 2 70 THR n 2 71 LYS n 2 72 TRP n 2 73 ARG n 2 74 LYS n 2 75 LEU n 2 76 VAL n 2 77 ASP n 2 78 PHE n 2 79 ARG n 2 80 GLU n 2 81 LEU n 2 82 ASN n 2 83 LYS n 2 84 ARG n 2 85 THR n 2 86 GLN n 2 87 ASP n 2 88 PHE n 2 89 TRP n 2 90 GLU n 2 91 VAL n 2 92 GLN n 2 93 LEU n 2 94 GLY n 2 95 ILE n 2 96 PRO n 2 97 HIS n 2 98 PRO n 2 99 ALA n 2 100 GLY n 2 101 LEU n 2 102 LYS n 2 103 LYS n 2 104 LYS n 2 105 LYS n 2 106 SER n 2 107 VAL n 2 108 THR n 2 109 VAL n 2 110 LEU n 2 111 ASP n 2 112 VAL n 2 113 GLY n 2 114 ASP n 2 115 ALA n 2 116 TYR n 2 117 PHE n 2 118 SER n 2 119 VAL n 2 120 PRO n 2 121 LEU n 2 122 ASP n 2 123 GLU n 2 124 ASP n 2 125 PHE n 2 126 ARG n 2 127 LYS n 2 128 TYR n 2 129 THR n 2 130 ALA n 2 131 PHE n 2 132 THR n 2 133 ILE n 2 134 PRO n 2 135 SER n 2 136 ILE n 2 137 ASN n 2 138 ASN n 2 139 GLU n 2 140 THR n 2 141 PRO n 2 142 GLY n 2 143 ILE n 2 144 ARG n 2 145 TYR n 2 146 GLN n 2 147 TYR n 2 148 ASN n 2 149 VAL n 2 150 LEU n 2 151 PRO n 2 152 GLN n 2 153 GLY n 2 154 TRP n 2 155 LYS n 2 156 GLY n 2 157 SER n 2 158 PRO n 2 159 ALA n 2 160 ILE n 2 161 PHE n 2 162 GLN n 2 163 SER n 2 164 SER n 2 165 MET n 2 166 THR n 2 167 LYS n 2 168 ILE n 2 169 LEU n 2 170 GLU n 2 171 PRO n 2 172 PHE n 2 173 LYS n 2 174 LYS n 2 175 GLN n 2 176 ASN n 2 177 PRO n 2 178 ASP n 2 179 ILE n 2 180 VAL n 2 181 ILE n 2 182 TYR n 2 183 GLN n 2 184 TYR n 2 185 MET n 2 186 ASP n 2 187 ASP n 2 188 LEU n 2 189 TYR n 2 190 VAL n 2 191 GLY n 2 192 SER n 2 193 ASP n 2 194 LEU n 2 195 GLU n 2 196 ILE n 2 197 GLY n 2 198 GLN n 2 199 HIS n 2 200 ARG n 2 201 THR n 2 202 LYS n 2 203 ILE n 2 204 GLU n 2 205 GLU n 2 206 LEU n 2 207 ARG n 2 208 GLN n 2 209 HIS n 2 210 LEU n 2 211 LEU n 2 212 ARG n 2 213 TRP n 2 214 GLY n 2 215 LEU n 2 216 THR n 2 217 THR n 2 218 PRO n 2 219 ASP n 2 220 LYS n 2 221 LYS n 2 222 HIS n 2 223 GLN n 2 224 LYS n 2 225 GLU n 2 226 PRO n 2 227 PRO n 2 228 PHE n 2 229 LEU n 2 230 TRP n 2 231 MET n 2 232 GLY n 2 233 TYR n 2 234 GLU n 2 235 LEU n 2 236 HIS n 2 237 PRO n 2 238 ASP n 2 239 LYS n 2 240 TRP n 2 241 THR n 2 242 VAL n 2 243 GLN n 2 244 PRO n 2 245 ILE n 2 246 VAL n 2 247 LEU n 2 248 PRO n 2 249 GLU n 2 250 LYS n 2 251 ASP n 2 252 SER n 2 253 TRP n 2 254 THR n 2 255 VAL n 2 256 ASN n 2 257 ASP n 2 258 ILE n 2 259 GLN n 2 260 LYS n 2 261 LEU n 2 262 VAL n 2 263 GLY n 2 264 LYS n 2 265 LEU n 2 266 ASN n 2 267 TRP n 2 268 ALA n 2 269 SER n 2 270 GLN n 2 271 ILE n 2 272 TYR n 2 273 PRO n 2 274 GLY n 2 275 ILE n 2 276 LYS n 2 277 VAL n 2 278 ARG n 2 279 GLN n 2 280 LEU n 2 281 SER n 2 282 LYS n 2 283 LEU n 2 284 LEU n 2 285 ARG n 2 286 GLY n 2 287 THR n 2 288 LYS n 2 289 ALA n 2 290 LEU n 2 291 THR n 2 292 GLU n 2 293 VAL n 2 294 ILE n 2 295 PRO n 2 296 LEU n 2 297 THR n 2 298 GLU n 2 299 GLU n 2 300 ALA n 2 301 GLU n 2 302 LEU n 2 303 GLU n 2 304 LEU n 2 305 ALA n 2 306 GLU n 2 307 ASN n 2 308 ARG n 2 309 GLU n 2 310 ILE n 2 311 LEU n 2 312 LYS n 2 313 GLU n 2 314 PRO n 2 315 VAL n 2 316 HIS n 2 317 GLY n 2 318 VAL n 2 319 TYR n 2 320 TYR n 2 321 ASP n 2 322 PRO n 2 323 SER n 2 324 LYS n 2 325 ASP n 2 326 LEU n 2 327 ILE n 2 328 ALA n 2 329 GLU n 2 330 ILE n 2 331 GLN n 2 332 LYS n 2 333 GLN n 2 334 GLY n 2 335 GLN n 2 336 GLY n 2 337 GLN n 2 338 TRP n 2 339 THR n 2 340 TYR n 2 341 GLN n 2 342 ILE n 2 343 TYR n 2 344 GLN n 2 345 GLU n 2 346 PRO n 2 347 PHE n 2 348 LYS n 2 349 ASN n 2 350 LEU n 2 351 LYS n 2 352 THR n 2 353 GLY n 2 354 LYS n 2 355 TYR n 2 356 ALA n 2 357 ARG n 2 358 MET n 2 359 ARG n 2 360 GLY n 2 361 ALA n 2 362 HIS n 2 363 THR n 2 364 ASN n 2 365 ASP n 2 366 VAL n 2 367 LYS n 2 368 GLN n 2 369 LEU n 2 370 THR n 2 371 GLU n 2 372 ALA n 2 373 VAL n 2 374 GLN n 2 375 LYS n 2 376 ILE n 2 377 THR n 2 378 THR n 2 379 GLU n 2 380 SER n 2 381 ILE n 2 382 VAL n 2 383 ILE n 2 384 TRP n 2 385 GLY n 2 386 LYS n 2 387 THR n 2 388 PRO n 2 389 LYS n 2 390 PHE n 2 391 LYS n 2 392 LEU n 2 393 PRO n 2 394 ILE n 2 395 GLN n 2 396 LYS n 2 397 GLU n 2 398 THR n 2 399 TRP n 2 400 GLU n 2 401 THR n 2 402 TRP n 2 403 TRP n 2 404 THR n 2 405 GLU n 2 406 TYR n 2 407 TRP n 2 408 GLN n 2 409 ALA n 2 410 THR n 2 411 TRP n 2 412 ILE n 2 413 PRO n 2 414 GLU n 2 415 TRP n 2 416 GLU n 2 417 PHE n 2 418 VAL n 2 419 ASN n 2 420 THR n 2 421 PRO n 2 422 PRO n 2 423 LEU n 2 424 VAL n 2 425 LYS n 2 426 LEU n 2 427 TRP n 2 428 TYR n 2 429 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 557 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3) RIL' ? ? ? ? ? ? ? plasmid ? ? ? pET35a ? ? 2 1 sample 'Biological sequence' 1 429 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3) RIL' ? ? ? ? ? ? ? plasmid ? ? ? pET35a ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP POL_HV1B1 P03366 ? 1 ;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG ; 600 2 UNP POL_HV1B1 P03366 ? 2 ;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET WWTEYWQATWIPEWEFVNTPPLVKLWYQ ; 600 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6AOC A 3 ? 557 ? P03366 600 ? 1154 ? 1 555 2 2 6AOC B 2 ? 429 ? P03366 600 ? 1027 ? 1 428 3 1 6AOC C 3 ? 557 ? P03366 600 ? 1154 ? 1 555 4 2 6AOC D 2 ? 429 ? P03366 600 ? 1027 ? 1 428 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AOC MET A 1 ? UNP P03366 ? ? 'initiating methionine' -1 1 1 6AOC VAL A 2 ? UNP P03366 ? ? 'expression tag' 0 2 1 6AOC SER A 282 ? UNP P03366 CYS 879 'engineered mutation' 280 3 2 6AOC GLY B 1 ? UNP P03366 ? ? 'expression tag' 0 4 2 6AOC SER B 281 ? UNP P03366 CYS 879 'engineered mutation' 280 5 3 6AOC MET C 1 ? UNP P03366 ? ? 'initiating methionine' -1 6 3 6AOC VAL C 2 ? UNP P03366 ? ? 'expression tag' 0 7 3 6AOC SER C 282 ? UNP P03366 CYS 879 'engineered mutation' 280 8 4 6AOC GLY D 1 ? UNP P03366 ? ? 'expression tag' 0 9 4 6AOC SER D 281 ? UNP P03366 CYS 879 'engineered mutation' 280 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZW2 non-polymer . '6-benzyl-3-hydroxythieno[2,3-d]pyrimidine-2,4(1H,3H)-dione' ? 'C13 H10 N2 O3 S' 274.295 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AOC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.139 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, SODIUM POTASSIUM PHOSPHATE, ETHYLENE GLYCOL, TRIS' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-30 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 36.810 _reflns.entry_id 6AOC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 55.320 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 217194 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.500 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.062 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 761476 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.800 1.830 ? 0.700 34281 ? ? ? 10575 94.600 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.200 ? ? ? ? 1.812 0.984 ? 1 1 ? ? 4.880 55.340 ? 29.900 38373 ? ? ? 11006 98.300 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.500 ? ? ? ? 0.038 0.020 ? 2 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 196.690 _refine.B_iso_mean 61.5361 _refine.B_iso_min 22.920 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AOC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 55.3180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 217135 _refine.ls_number_reflns_R_free 10774 _refine.ls_number_reflns_R_work 206361 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.0300 _refine.ls_percent_reflns_R_free 4.9600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1883 _refine.ls_R_factor_R_free 0.2258 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1863 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.960 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4KFB _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.8700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 55.3180 _refine_hist.pdbx_number_atoms_ligand 384 _refine_hist.number_atoms_solvent 1147 _refine_hist.number_atoms_total 17523 _refine_hist.pdbx_number_residues_total 1950 _refine_hist.pdbx_B_iso_mean_ligand 73.09 _refine_hist.pdbx_B_iso_mean_solvent 60.52 _refine_hist.pdbx_number_atoms_protein 15992 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 17540 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.983 ? 23765 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 2533 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 2996 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.944 ? 10781 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 5967 9.484 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 5967 9.484 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 2 1 TORSIONAL B 4441 9.484 ? ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 2 2 TORSIONAL D 4441 9.484 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8000 1.8205 6945 . 338 6607 93.0000 . . . 0.3837 0.0000 0.3795 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.8205 1.8419 7187 . 375 6812 96.0000 . . . 0.3785 0.0000 0.3523 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.8419 1.8643 7103 . 352 6751 96.0000 . . . 0.3772 0.0000 0.3283 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.8643 1.8879 7154 . 365 6789 96.0000 . . . 0.3712 0.0000 0.3107 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.8879 1.9128 7150 . 342 6808 96.0000 . . . 0.3439 0.0000 0.2956 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.9128 1.9390 7209 . 373 6836 96.0000 . . . 0.2817 0.0000 0.2783 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.9390 1.9667 7161 . 355 6806 96.0000 . . . 0.3251 0.0000 0.2722 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.9667 1.9961 7218 . 348 6870 96.0000 . . . 0.3066 0.0000 0.2710 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 1.9961 2.0272 7199 . 383 6816 96.0000 . . . 0.3068 0.0000 0.2602 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.0272 2.0605 7222 . 352 6870 97.0000 . . . 0.2815 0.0000 0.2487 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.0605 2.0960 7146 . 386 6760 96.0000 . . . 0.2734 0.0000 0.2346 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.0960 2.1341 7235 . 324 6911 97.0000 . . . 0.2536 0.0000 0.2246 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.1341 2.1752 7229 . 340 6889 97.0000 . . . 0.2538 0.0000 0.2158 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.1752 2.2196 7191 . 337 6854 97.0000 . . . 0.2494 0.0000 0.2077 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.2196 2.2678 7273 . 325 6948 97.0000 . . . 0.2571 0.0000 0.2037 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.2678 2.3206 7226 . 351 6875 97.0000 . . . 0.2345 0.0000 0.1993 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.3206 2.3786 7249 . 343 6906 97.0000 . . . 0.2200 0.0000 0.2012 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.3786 2.4429 7270 . 350 6920 97.0000 . . . 0.2490 0.0000 0.2028 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.4429 2.5148 7300 . 391 6909 98.0000 . . . 0.2391 0.0000 0.1929 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.5148 2.5960 7268 . 378 6890 98.0000 . . . 0.2357 0.0000 0.1915 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.5960 2.6888 7302 . 373 6929 98.0000 . . . 0.2362 0.0000 0.1916 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.6888 2.7964 7309 . 331 6978 98.0000 . . . 0.2193 0.0000 0.1913 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.7964 2.9237 7321 . 345 6976 98.0000 . . . 0.2248 0.0000 0.1904 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 2.9237 3.0778 7312 . 359 6953 98.0000 . . . 0.2434 0.0000 0.1958 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 3.0778 3.2706 7325 . 398 6927 98.0000 . . . 0.2400 0.0000 0.1846 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 3.2706 3.5231 7376 . 358 7018 98.0000 . . . 0.2239 0.0000 0.1768 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 3.5231 3.8776 7297 . 359 6938 98.0000 . . . 0.2191 0.0000 0.1607 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 3.8776 4.4385 7316 . 380 6936 98.0000 . . . 0.1814 0.0000 0.1398 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 4.4385 5.5912 7326 . 362 6964 98.0000 . . . 0.1648 0.0000 0.1427 . . . . . . 30 . . . 'X-RAY DIFFRACTION' 5.5912 55.3439 7316 . 401 6915 98.0000 . . . 0.2192 0.0000 0.1868 . . . . . . 30 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; 1 2 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; 2 1 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; 2 2 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 1 A 21 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 23 A 39 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 41 A 42 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 44 A 52 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 54 A 59 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 61 A 71 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 73 A 81 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 83 A 103 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 105 A 133 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 136 A 160 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 11 ? A 162 A 163 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 12 ? A 165 A 168 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 13 ? A 170 A 1781 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 14 ? A 183 A 198 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 15 ? A 200198 A 200198 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 16 ? A 200 A 211 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 17 ? A 213 A 296 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 18 ? A 304 A 304 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 19 ? A 312 A 312 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 20 ? A 308 A 321 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 21 ? A 363 A 363 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 22 ? A 363 A 363 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 23 ? A 365 A 366 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 24 ? A 374 A 385 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 25 ? A 393 A 394 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 26 ? A 403 A 398 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 27 ? A 406 A 4006 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 28 ? A 414 A 416 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 29 ? A 424416 A 424416 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 30 ? A 424 A 427 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 31 ? A 429 A 447 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 32 ? A 450 A 460 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 33 ? A 462 A 466 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 34 ? A 468 A 4706 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 35 ? A 508 A 508 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 36 ? A 510 A 511 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 37 ? A 513 A 519 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 38 ? A 521 A 522 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 39 ? A 524 A 539 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 40 ? A 541 A 542 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 41 ? A 545 A 546 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 1 42 ? A 548 A 555 ;(chain A and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? C 1 C 21 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? C 23 C 39 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? C 41 C 42 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? C -1 C 59 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? C 61 C 71 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? C 73 C 81 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? C -1 C 562 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? C 105 C 133 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? C 162 C 163 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? C 173 C 181 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 11 ? C 173 C 181 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 12 ? C 183 C 198 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 13 ? C 200 C 211 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 14 ? C 304 C 306 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 15 ? C 312 C 312 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 16 ? C 329 C 352 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 17 ? C 360 C 355 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 18 ? C 360 C 355 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 19 ? C 363 C 363 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 20 ? C 374 C 385 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 21 ? C 393 C 394 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 22 ? C 403 C 398 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 23 ? C 403 C 398 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 24 ? C 414 C 416 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 25 ? C 424 C 426 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 26 ? C 450 C 467 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 27 ? C 429 C 447 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 28 ? C 462 C 460 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 29 ? C 468 C 476 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 30 ? C 477 C 505 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 31 ? C 508 C 508 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 32 ? C 513 C 519 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 33 ? C 521 C 522 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 34 ? C 521 C 522 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 35 ? C 545 C 542 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 36 ? C 545 C 546 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 1 2 37 ? C 548 C 555 ;(chain C and (resid 1 through 21 or resid 23 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 59 or resid 61 through 71 or resid 73 through 81 or resid 83 through 103 or resid 105 through 133 or resid 136 through 160 or resid 162 through 163 or resid 165 through 168 or resid 170 through 171 or resid 173 through 181 or resid 183 through 198 or resid 200 through 211 or resid 213 through 296 or resiD 304 through 304 or resiD 312 or resid 308 through 321 or resiD 329 through 352 or resiD 360 through 355 or resiD 363 or resiD 365 through 366 or resiD 374 through 385 or resiD 393 through 394 or resiD 403 through 398 or resiD 406 through 403 or resiD 411 through 406 or resiD 414 through 416 or resiD 424 through 427 or resid 429 through 447 or resid 450 through 460 or resid 462 through 466 or resid 468 through 475 or resid 477 through 506 or resid 508 or resid 510 through 511 or resid 513 through 519 or resid 521 through 522 or resid 524 through 539 or resid 541 through 542 or resid 545 through 546 or resid 548 through 555)) ; ? ? ? ? ? ? ? ? ? ? 2 1 1 ? B 4 B 21 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 2 ? B 23 B 27 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 3 ? B 29 B 29 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 4 ? B 31 B 31 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 5 ? B 33 B 42 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 6 ? B 0 B 0 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 7 ? B 66 B 66 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 8 ? B 0 B 72 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 9 ? B 74 B 92 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 10 ? B 95 B 101 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 11 ? B 0 B 428 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 12 ? B 3 B 12225 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 13 ? B 0 B 428 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 14 ? B 127 B 139 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 15 ? B 0 B 0 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 16 ? B 170 B 171 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 17 ? B 173 B 173 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 18 ? B 175 B 183 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 19 ? B 185 B 196 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 20 ? B 207 B 214 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 21 ? B 226 B 22 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 22 ? B 235 B 235 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 23 ? B 243 B 243 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 24 ? B 245 B 240 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 25 ? B 248 B 245 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 26 ? B 287 B 282 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 27 ? B 290 B 30 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 28 ? B 315 B 310 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 29 ? B 318 B 318 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 30 ? B 326 B 321 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 31 ? B 329 B 331 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 32 ? B 339 B 339 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 33 ? B 347 B 351 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 34 ? B 359 B 374 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 35 ? B 382 B 383 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 36 ? B 391 B 389 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 37 ? B 397 B 402 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 38 ? B 410 B 408 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 39 ? B 416 B 414 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 1 40 ? B 422 B 424 ;(chain B and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 214 or resiD 226 through 227 or resiD 235 through 235 or resiD 243 or resiD 245 through 240 or resiD 248 through 245 or resiD 254 through 279 or resiD 287 through 282 or resiD 290 through 307 or resiD 315 through 310 or resiD 318 through 318 or resiD 326 through 321 or resiD 329 through 331 or resiD 339 through 339 or resiD 347 through 351 or resiD 359 through 374 or resiD 382 through 383 or resiD 391 through 389 or resiD 397 through 402 or resiD 410 through 408 or resiD 416 through 414 or resiD 422 through 424)) ; ? ? ? ? ? ? ? ? ? ? 2 2 1 ? D 4 D 21 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 2 ? D 23 D 27 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 3 ? D 29 D 29 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 4 ? D 3 D 3 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 5 ? D 33 D 44 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 6 ? D 44 D 54 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 7 ? D 5 D 5 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 8 ? D 4 D 428 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 9 ? D 4 D 428 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 10 ? D 95 D 101 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 11 ? D 4 D 428 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 12 ? D 127 D 139 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 13 ? D 167 D 168 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 14 ? D 167 D 168 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 15 ? D 170 D 171 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 16 ? D 173 D 173 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 17 ? D 185 D 196 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 18 ? D 198 D 205 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 19 ? D 207 D 225 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 20 ? D 207 D 225 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 21 ? D 246 D 243 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 22 ? D 246 D 243 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 23 ? D 285 D 280 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 24 ? D 313 D 305 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 25 ? D 324 D 318 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 26 ? D 316 D 316 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 27 ? D 327 D 329 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 28 ? D 337 D 339 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 29 ? D 345 D 347 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 30 ? D 357 D 379 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 31 ? D 380 D 382 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 32 ? D 389 D 381 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 33 ? D 395 D 407 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 34 ? D 408 D 400 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 35 ? D 414 D 416 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 36 ? D 414 D 412 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? 2 2 37 ? D 420 D 422 ;(chain D and (resid 4 through 21 or resid 23 through 27 or resid 29 or resid 31 or resid 33 through 39 or resid 41 through 42 or resid 44 through 52 or resid 54 through 64 or resid 66 through 72 or resid 74 through 92 or resid 95 through 101 or resid 103 through 122 or resid 124 through 125 or resid 127 through 139 or resid 142 or resid 144 through 165 or resid 167 through 168 or resid 170 through 171 or resid 173 or resid 175 through 183 or resid 185 through 196 or resid 198 through 205 or resid 207 through 225 or resiD 233 through 233 or resiD 241 or resid 237 through 238 or resiD 246 through 243 or resiD 252 through 277 or resiD 285 through 280 or resiD 288 through 305 or resiD 313 through 308 or resiD 316 through 316 or resiD 324 through 319 or resiD 327 through 329 or resiD 337 through 337 or resiD 345 through 349 or resiD 357 through 372 or resiD 380 through 381 or resiD 389 through 387 or resiD 395 through 400 or resiD 408 through 406 or resiD 414 through 412 or resiD 420 through 422)) ; ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 6AOC _struct.title ;Crystal Structure of an N-Hydroxythienopyrimidine-2,4-dione RNase H Active Site Inhibitor with Multiple Binding Modes to HIV Reverse Transcriptase ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AOC _struct_keywords.text 'HIV-1, TRANSFERASE - TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE / TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 6 ? J N N 6 ? K N N 6 ? L N N 6 ? M N N 6 ? N N N 6 ? O N N 6 ? P N N 6 ? Q N N 6 ? R N N 6 ? S N N 6 ? T N N 6 ? U N N 6 ? V N N 6 ? W N N 5 ? X N N 5 ? Y N N 5 ? Z N N 5 ? AA N N 6 ? BA N N 6 ? CA N N 6 ? DA N N 6 ? EA N N 6 ? FA N N 6 ? GA N N 6 ? HA N N 6 ? IA N N 6 ? JA N N 6 ? KA N N 6 ? LA N N 6 ? MA N N 6 ? NA N N 6 ? OA N N 6 ? PA N N 6 ? QA N N 6 ? RA N N 6 ? SA N N 6 ? TA N N 3 ? UA N N 3 ? VA N N 4 ? WA N N 6 ? XA N N 6 ? YA N N 6 ? ZA N N 6 ? AB N N 6 ? BB N N 6 ? CB N N 6 ? DB N N 6 ? EB N N 6 ? FB N N 6 ? GB N N 6 ? HB N N 6 ? IB N N 6 ? JB N N 6 ? KB N N 6 ? LB N N 6 ? MB N N 6 ? NB N N 6 ? OB N N 6 ? PB N N 6 ? QB N N 6 ? RB N N 6 ? SB N N 6 ? TB N N 5 ? UB N N 5 ? VB N N 6 ? WB N N 6 ? XB N N 6 ? YB N N 6 ? ZB N N 6 ? AC N N 6 ? BC N N 6 ? CC N N 6 ? DC N N 6 ? EC N N 6 ? FC N N 6 ? GC N N 6 ? HC N N 7 ? IC N N 7 ? JC N N 7 ? KC N N 7 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 29 ? GLU A 46 ? THR A 27 GLU A 44 1 ? 18 HELX_P HELX_P2 AA2 PHE A 79 ? ARG A 85 ? PHE A 77 ARG A 83 1 ? 7 HELX_P HELX_P3 AA3 HIS A 98 ? LEU A 102 ? HIS A 96 LEU A 100 5 ? 5 HELX_P HELX_P4 AA4 GLY A 114 ? VAL A 120 ? GLY A 112 VAL A 118 5 ? 7 HELX_P HELX_P5 AA5 ASP A 123 ? LYS A 128 ? ASP A 121 LYS A 126 1 ? 6 HELX_P HELX_P6 AA6 TYR A 129 ? ALA A 131 ? TYR A 127 ALA A 129 5 ? 3 HELX_P HELX_P7 AA7 LYS A 156 ? ASN A 177 ? LYS A 154 ASN A 175 1 ? 22 HELX_P HELX_P8 AA8 GLU A 196 ? TRP A 214 ? GLU A 194 TRP A 212 1 ? 19 HELX_P HELX_P9 AA9 VAL A 256 ? SER A 270 ? VAL A 254 SER A 268 1 ? 15 HELX_P HELX_P10 AB1 VAL A 278 ? LEU A 284 ? VAL A 276 LEU A 282 1 ? 7 HELX_P HELX_P11 AB2 THR A 298 ? LEU A 312 ? THR A 296 LEU A 310 1 ? 15 HELX_P HELX_P12 AB3 ASN A 365 ? GLY A 386 ? ASN A 363 GLY A 384 1 ? 22 HELX_P HELX_P13 AB4 GLN A 396 ? TYR A 407 ? GLN A 394 TYR A 405 1 ? 12 HELX_P HELX_P14 AB5 THR A 475 ? SER A 491 ? THR A 473 SER A 489 1 ? 17 HELX_P HELX_P15 AB6 SER A 501 ? ALA A 510 ? SER A 499 ALA A 508 1 ? 10 HELX_P HELX_P16 AB7 SER A 517 ? LYS A 530 ? SER A 515 LYS A 528 1 ? 14 HELX_P HELX_P17 AB8 GLY A 546 ? SER A 555 ? GLY A 544 SER A 553 1 ? 10 HELX_P HELX_P18 AB9 THR B 28 ? GLU B 45 ? THR B 27 GLU B 44 1 ? 18 HELX_P HELX_P19 AC1 PHE B 78 ? THR B 85 ? PHE B 77 THR B 84 1 ? 8 HELX_P HELX_P20 AC2 GLY B 100 ? LYS B 104 ? GLY B 99 LYS B 103 5 ? 5 HELX_P HELX_P21 AC3 VAL B 112 ? PHE B 117 ? VAL B 111 PHE B 116 1 ? 6 HELX_P HELX_P22 AC4 ASP B 122 ? ALA B 130 ? ASP B 121 ALA B 129 5 ? 9 HELX_P HELX_P23 AC5 SER B 135 ? GLU B 139 ? SER B 134 GLU B 138 5 ? 5 HELX_P HELX_P24 AC6 LYS B 155 ? ASN B 176 ? LYS B 154 ASN B 175 1 ? 22 HELX_P HELX_P25 AC7 GLU B 195 ? GLY B 214 ? GLU B 194 GLY B 213 1 ? 20 HELX_P HELX_P26 AC8 HIS B 236 ? TRP B 240 ? HIS B 235 TRP B 239 5 ? 5 HELX_P HELX_P27 AC9 VAL B 255 ? SER B 269 ? VAL B 254 SER B 268 1 ? 15 HELX_P HELX_P28 AD1 VAL B 277 ? LEU B 283 ? VAL B 276 LEU B 282 1 ? 7 HELX_P HELX_P29 AD2 THR B 297 ? GLU B 313 ? THR B 296 GLU B 312 1 ? 17 HELX_P HELX_P30 AD3 ASN B 364 ? TRP B 384 ? ASN B 363 TRP B 383 1 ? 21 HELX_P HELX_P31 AD4 GLN B 395 ? TRP B 407 ? GLN B 394 TRP B 406 1 ? 13 HELX_P HELX_P32 AD5 LEU B 423 ? GLN B 429 ? LEU B 422 GLN B 428 1 ? 7 HELX_P HELX_P33 AD6 THR C 29 ? GLU C 46 ? THR C 27 GLU C 44 1 ? 18 HELX_P HELX_P34 AD7 PHE C 79 ? THR C 86 ? PHE C 77 THR C 84 1 ? 8 HELX_P HELX_P35 AD8 HIS C 98 ? LEU C 102 ? HIS C 96 LEU C 100 5 ? 5 HELX_P HELX_P36 AD9 ASP C 115 ? VAL C 120 ? ASP C 113 VAL C 118 5 ? 6 HELX_P HELX_P37 AE1 PHE C 126 ? ALA C 131 ? PHE C 124 ALA C 129 5 ? 6 HELX_P HELX_P38 AE2 GLY C 157 ? ASN C 177 ? GLY C 155 ASN C 175 1 ? 21 HELX_P HELX_P39 AE3 GLU C 196 ? TRP C 214 ? GLU C 194 TRP C 212 1 ? 19 HELX_P HELX_P40 AE4 VAL C 256 ? GLN C 271 ? VAL C 254 GLN C 269 1 ? 16 HELX_P HELX_P41 AE5 VAL C 278 ? LEU C 284 ? VAL C 276 LEU C 282 1 ? 7 HELX_P HELX_P42 AE6 THR C 298 ? LEU C 312 ? THR C 296 LEU C 310 1 ? 15 HELX_P HELX_P43 AE7 ASN C 365 ? GLY C 386 ? ASN C 363 GLY C 384 1 ? 22 HELX_P HELX_P44 AE8 GLN C 396 ? TYR C 407 ? GLN C 394 TYR C 405 1 ? 12 HELX_P HELX_P45 AE9 THR C 475 ? SER C 491 ? THR C 473 SER C 489 1 ? 17 HELX_P HELX_P46 AF1 SER C 501 ? ALA C 510 ? SER C 499 ALA C 508 1 ? 10 HELX_P HELX_P47 AF2 SER C 517 ? LYS C 530 ? SER C 515 LYS C 528 1 ? 14 HELX_P HELX_P48 AF3 ILE C 544 ? SER C 555 ? ILE C 542 SER C 553 1 ? 12 HELX_P HELX_P49 AF4 THR D 28 ? GLU D 45 ? THR D 27 GLU D 44 1 ? 18 HELX_P HELX_P50 AF5 PHE D 78 ? THR D 85 ? PHE D 77 THR D 84 1 ? 8 HELX_P HELX_P51 AF6 GLY D 100 ? LYS D 104 ? GLY D 99 LYS D 103 5 ? 5 HELX_P HELX_P52 AF7 GLY D 113 ? VAL D 119 ? GLY D 112 VAL D 118 5 ? 7 HELX_P HELX_P53 AF8 ASP D 122 ? ALA D 130 ? ASP D 121 ALA D 129 5 ? 9 HELX_P HELX_P54 AF9 SER D 135 ? GLU D 139 ? SER D 134 GLU D 138 5 ? 5 HELX_P HELX_P55 AG1 LYS D 155 ? GLN D 175 ? LYS D 154 GLN D 174 1 ? 21 HELX_P HELX_P56 AG2 GLU D 195 ? LEU D 215 ? GLU D 194 LEU D 214 1 ? 21 HELX_P HELX_P57 AG3 PRO D 227 ? MET D 231 ? PRO D 226 MET D 230 5 ? 5 HELX_P HELX_P58 AG4 HIS D 236 ? TRP D 240 ? HIS D 235 TRP D 239 5 ? 5 HELX_P HELX_P59 AG5 VAL D 255 ? SER D 269 ? VAL D 254 SER D 268 1 ? 15 HELX_P HELX_P60 AG6 VAL D 277 ? LEU D 283 ? VAL D 276 LEU D 282 1 ? 7 HELX_P HELX_P61 AG7 THR D 297 ? LYS D 312 ? THR D 296 LYS D 311 1 ? 16 HELX_P HELX_P62 AG8 ASN D 364 ? GLY D 385 ? ASN D 363 GLY D 384 1 ? 22 HELX_P HELX_P63 AG9 GLN D 395 ? TRP D 403 ? GLN D 394 TRP D 402 1 ? 9 HELX_P HELX_P64 AH1 THR D 404 ? TRP D 407 ? THR D 403 TRP D 406 5 ? 4 HELX_P HELX_P65 AH2 PRO D 421 ? GLN D 429 ? PRO D 420 GLN D 428 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 445 OD1 ? ? ? 1_555 E MN . MN ? ? A ASP 443 A MN 601 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc2 metalc ? ? A ASP 445 OD2 ? ? ? 1_555 F MN . MN ? ? A ASP 443 A MN 602 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc3 metalc ? ? A GLU 480 OE1 ? ? ? 1_555 E MN . MN ? ? A GLU 478 A MN 601 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc4 metalc ? ? A ASP 500 OD1 ? ? ? 1_555 E MN . MN ? ? A ASP 498 A MN 601 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc5 metalc ? ? A ASP 551 OD1 ? ? ? 1_555 F MN . MN ? ? A ASP 549 A MN 602 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc6 metalc ? ? E MN . MN ? ? ? 1_555 G ZW2 . O1 ? ? A MN 601 A ZW2 603 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc7 metalc ? ? E MN . MN ? ? ? 1_555 G ZW2 . O2 ? ? A MN 601 A ZW2 603 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc8 metalc ? ? F MN . MN ? ? ? 1_555 G ZW2 . O3 ? ? A MN 602 A ZW2 603 1_555 ? ? ? ? ? ? ? 2.188 ? ? metalc9 metalc ? ? F MN . MN ? ? ? 1_555 G ZW2 . N1 ? ? A MN 602 A ZW2 603 1_555 ? ? ? ? ? ? ? 2.761 ? ? metalc10 metalc ? ? F MN . MN ? ? ? 1_555 G ZW2 . O1 ? ? A MN 602 A ZW2 603 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc11 metalc ? ? F MN . MN ? ? ? 1_555 HC HOH . O ? ? A MN 602 A HOH 777 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc12 metalc ? ? F MN . MN ? ? ? 1_555 HC HOH . O ? ? A MN 602 A HOH 783 1_555 ? ? ? ? ? ? ? 2.101 ? ? metalc13 metalc ? ? C ASP 445 OD1 ? ? ? 1_555 TA MN . MN ? ? C ASP 443 C MN 601 1_555 ? ? ? ? ? ? ? 2.140 ? ? metalc14 metalc ? ? C ASP 445 OD2 ? ? ? 1_555 UA MN . MN ? ? C ASP 443 C MN 602 1_555 ? ? ? ? ? ? ? 2.156 ? ? metalc15 metalc ? ? C GLU 480 OE1 ? ? ? 1_555 TA MN . MN ? ? C GLU 478 C MN 601 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc16 metalc ? ? C ASP 500 OD1 ? ? ? 1_555 TA MN . MN ? ? C ASP 498 C MN 601 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc17 metalc ? ? C ASP 551 OD1 ? ? ? 1_555 UA MN . MN ? ? C ASP 549 C MN 602 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc18 metalc ? ? TA MN . MN ? ? ? 1_555 VA ZW2 . O1 ? ? C MN 601 C ZW2 603 1_555 ? ? ? ? ? ? ? 1.873 ? ? metalc19 metalc ? ? TA MN . MN ? ? ? 1_555 VA ZW2 . N1 ? ? C MN 601 C ZW2 603 1_555 ? ? ? ? ? ? ? 2.765 ? ? metalc20 metalc ? ? TA MN . MN ? ? ? 1_555 VA ZW2 . O3 ? ? C MN 601 C ZW2 603 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc21 metalc ? ? UA MN . MN ? ? ? 1_555 VA ZW2 . O2 ? ? C MN 602 C ZW2 603 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc22 metalc ? ? UA MN . MN ? ? ? 1_555 VA ZW2 . O1 ? ? C MN 602 C ZW2 603 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc23 metalc ? ? UA MN . MN ? ? ? 1_555 JC HOH . O ? ? C MN 602 C HOH 755 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc24 metalc ? ? UA MN . MN ? ? ? 1_555 JC HOH . O ? ? C MN 602 C HOH 882 1_555 ? ? ? ? ? ? ? 2.232 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 227 A . ? PRO 225 A PRO 228 A ? PRO 226 A 1 5.92 2 PRO 422 A . ? PRO 420 A PRO 423 A ? PRO 421 A 1 -1.33 3 PRO 227 C . ? PRO 225 C PRO 228 C ? PRO 226 C 1 5.12 4 PRO 422 C . ? PRO 420 C PRO 423 C ? PRO 421 C 1 -2.18 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 4 ? AA5 ? 2 ? AA6 ? 5 ? AA7 ? 2 ? AA8 ? 5 ? AA9 ? 3 ? AB1 ? 2 ? AB2 ? 4 ? AB3 ? 2 ? AB4 ? 5 ? AB5 ? 3 ? AB6 ? 2 ? AB7 ? 3 ? AB8 ? 4 ? AB9 ? 2 ? AC1 ? 5 ? AC2 ? 2 ? AC3 ? 5 ? AC4 ? 3 ? AC5 ? 2 ? AC6 ? 4 ? AC7 ? 2 ? AC8 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? parallel AA6 4 5 ? parallel AA7 1 2 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? parallel AA8 4 5 ? parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB3 1 2 ? anti-parallel AB4 1 2 ? anti-parallel AB4 2 3 ? anti-parallel AB4 3 4 ? parallel AB4 4 5 ? parallel AB5 1 2 ? anti-parallel AB5 2 3 ? anti-parallel AB6 1 2 ? anti-parallel AB7 1 2 ? anti-parallel AB7 2 3 ? anti-parallel AB8 1 2 ? anti-parallel AB8 2 3 ? anti-parallel AB8 3 4 ? anti-parallel AB9 1 2 ? anti-parallel AC1 1 2 ? anti-parallel AC1 2 3 ? anti-parallel AC1 3 4 ? parallel AC1 4 5 ? parallel AC2 1 2 ? anti-parallel AC3 1 2 ? anti-parallel AC3 2 3 ? anti-parallel AC3 3 4 ? parallel AC3 4 5 ? parallel AC4 1 2 ? anti-parallel AC4 2 3 ? anti-parallel AC5 1 2 ? anti-parallel AC6 1 2 ? anti-parallel AC6 2 3 ? anti-parallel AC6 3 4 ? anti-parallel AC7 1 2 ? anti-parallel AC8 1 2 ? anti-parallel AC8 2 3 ? anti-parallel AC8 3 4 ? parallel AC8 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 49 ? LYS A 51 ? ILE A 47 LYS A 49 AA1 2 ILE A 144 ? TYR A 148 ? ILE A 142 TYR A 146 AA1 3 PHE A 132 ? ILE A 134 ? PHE A 130 ILE A 132 AA2 1 PHE A 63 ? ILE A 65 ? PHE A 61 ILE A 63 AA2 2 ARG A 74 ? LEU A 76 ? ARG A 72 LEU A 74 AA3 1 SER A 107 ? ASP A 112 ? SER A 105 ASP A 110 AA3 2 ASP A 188 ? SER A 193 ? ASP A 186 SER A 191 AA3 3 VAL A 181 ? TYR A 185 ? VAL A 179 TYR A 183 AA4 1 PHE A 229 ? TRP A 231 ? PHE A 227 TRP A 229 AA4 2 TYR A 234 ? LEU A 236 ? TYR A 232 LEU A 234 AA4 3 TRP A 241 ? VAL A 243 ? TRP A 239 VAL A 241 AA4 4 VAL A 316 ? GLY A 318 ? VAL A 314 GLY A 316 AA5 1 TRP A 254 ? THR A 255 ? TRP A 252 THR A 253 AA5 2 VAL A 294 ? ILE A 295 ? VAL A 292 ILE A 293 AA6 1 LYS A 349 ? ALA A 357 ? LYS A 347 ALA A 355 AA6 2 GLN A 338 ? GLU A 346 ? GLN A 336 GLU A 344 AA6 3 ILE A 328 ? GLY A 335 ? ILE A 326 GLY A 333 AA6 4 LYS A 390 ? LEU A 393 ? LYS A 388 LEU A 391 AA6 5 TRP A 416 ? PHE A 418 ? TRP A 414 PHE A 416 AA7 1 HIS A 363 ? THR A 364 ? HIS A 361 THR A 362 AA7 2 LYS A 514 ? SER A 515 ? LYS A 512 SER A 513 AA8 1 GLN A 466 ? LEU A 471 ? GLN A 464 LEU A 469 AA8 2 GLY A 455 ? THR A 461 ? GLY A 453 THR A 459 AA8 3 THR A 441 ? ALA A 448 ? THR A 439 ALA A 446 AA8 4 GLU A 494 ? THR A 499 ? GLU A 492 THR A 497 AA8 5 LYS A 532 ? TRP A 537 ? LYS A 530 TRP A 535 AA9 1 ILE B 48 ? LYS B 50 ? ILE B 47 LYS B 49 AA9 2 ILE B 143 ? TYR B 147 ? ILE B 142 TYR B 146 AA9 3 PHE B 131 ? ILE B 133 ? PHE B 130 ILE B 132 AB1 1 VAL B 61 ? ILE B 64 ? VAL B 60 ILE B 63 AB1 2 ARG B 73 ? VAL B 76 ? ARG B 72 VAL B 75 AB2 1 VAL B 180 ? TYR B 184 ? VAL B 179 TYR B 183 AB2 2 ASP B 187 ? SER B 192 ? ASP B 186 SER B 191 AB2 3 SER B 106 ? ASP B 111 ? SER B 105 ASP B 110 AB2 4 TYR B 233 ? LEU B 235 ? TYR B 232 LEU B 234 AB3 1 TRP B 253 ? THR B 254 ? TRP B 252 THR B 253 AB3 2 VAL B 293 ? ILE B 294 ? VAL B 292 ILE B 293 AB4 1 ASN B 349 ? TYR B 355 ? ASN B 348 TYR B 354 AB4 2 GLN B 337 ? TYR B 343 ? GLN B 336 TYR B 342 AB4 3 ILE B 327 ? GLY B 334 ? ILE B 326 GLY B 333 AB4 4 LYS B 389 ? LEU B 392 ? LYS B 388 LEU B 391 AB4 5 GLU B 414 ? PHE B 417 ? GLU B 413 PHE B 416 AB5 1 ILE C 49 ? LYS C 51 ? ILE C 47 LYS C 49 AB5 2 ILE C 144 ? TYR C 148 ? ILE C 142 TYR C 146 AB5 3 PHE C 132 ? ILE C 134 ? PHE C 130 ILE C 132 AB6 1 VAL C 62 ? LYS C 66 ? VAL C 60 LYS C 64 AB6 2 TRP C 73 ? VAL C 77 ? TRP C 71 VAL C 75 AB7 1 SER C 107 ? ASP C 112 ? SER C 105 ASP C 110 AB7 2 ASP C 188 ? SER C 193 ? ASP C 186 SER C 191 AB7 3 VAL C 181 ? TYR C 185 ? VAL C 179 TYR C 183 AB8 1 PHE C 229 ? TRP C 231 ? PHE C 227 TRP C 229 AB8 2 TYR C 234 ? LEU C 236 ? TYR C 232 LEU C 234 AB8 3 TRP C 241 ? VAL C 243 ? TRP C 239 VAL C 241 AB8 4 HIS C 317 ? GLY C 318 ? HIS C 315 GLY C 316 AB9 1 TRP C 254 ? THR C 255 ? TRP C 252 THR C 253 AB9 2 VAL C 294 ? ILE C 295 ? VAL C 292 ILE C 293 AC1 1 LYS C 349 ? ALA C 357 ? LYS C 347 ALA C 355 AC1 2 GLN C 338 ? GLU C 346 ? GLN C 336 GLU C 344 AC1 3 ILE C 328 ? GLN C 334 ? ILE C 326 GLN C 332 AC1 4 LYS C 390 ? LEU C 393 ? LYS C 388 LEU C 391 AC1 5 TRP C 416 ? PHE C 418 ? TRP C 414 PHE C 416 AC2 1 HIS C 363 ? THR C 364 ? HIS C 361 THR C 362 AC2 2 LYS C 514 ? SER C 515 ? LYS C 512 SER C 513 AC3 1 GLN C 466 ? LEU C 471 ? GLN C 464 LEU C 469 AC3 2 GLY C 455 ? THR C 461 ? GLY C 453 THR C 459 AC3 3 THR C 441 ? ALA C 448 ? THR C 439 ALA C 446 AC3 4 GLU C 494 ? THR C 499 ? GLU C 492 THR C 497 AC3 5 LYS C 532 ? TRP C 537 ? LYS C 530 TRP C 535 AC4 1 ILE D 48 ? ILE D 51 ? ILE D 47 ILE D 50 AC4 2 ILE D 143 ? TYR D 147 ? ILE D 142 TYR D 146 AC4 3 PHE D 131 ? ILE D 133 ? PHE D 130 ILE D 132 AC5 1 VAL D 61 ? ILE D 64 ? VAL D 60 ILE D 63 AC5 2 ARG D 73 ? VAL D 76 ? ARG D 72 VAL D 75 AC6 1 VAL D 180 ? TYR D 184 ? VAL D 179 TYR D 183 AC6 2 ASP D 187 ? SER D 192 ? ASP D 186 SER D 191 AC6 3 SER D 106 ? ASP D 111 ? SER D 105 ASP D 110 AC6 4 TYR D 233 ? LEU D 235 ? TYR D 232 LEU D 234 AC7 1 TRP D 253 ? THR D 254 ? TRP D 252 THR D 253 AC7 2 VAL D 293 ? ILE D 294 ? VAL D 292 ILE D 293 AC8 1 LYS D 348 ? TYR D 355 ? LYS D 347 TYR D 354 AC8 2 GLN D 337 ? GLU D 345 ? GLN D 336 GLU D 344 AC8 3 ILE D 327 ? GLY D 334 ? ILE D 326 GLY D 333 AC8 4 LYS D 389 ? PRO D 393 ? LYS D 388 PRO D 392 AC8 5 TRP D 415 ? VAL D 418 ? TRP D 414 VAL D 417 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 50 ? N SER A 48 O GLN A 147 ? O GLN A 145 AA1 2 3 O ILE A 144 ? O ILE A 142 N ILE A 134 ? N ILE A 132 AA2 1 2 N PHE A 63 ? N PHE A 61 O LEU A 76 ? O LEU A 74 AA3 1 2 N THR A 109 ? N THR A 107 O VAL A 191 ? O VAL A 189 AA3 2 3 O GLY A 192 ? O GLY A 190 N VAL A 181 ? N VAL A 179 AA4 1 2 N PHE A 229 ? N PHE A 227 O LEU A 236 ? O LEU A 234 AA4 2 3 N GLU A 235 ? N GLU A 233 O THR A 242 ? O THR A 240 AA4 3 4 N VAL A 243 ? N VAL A 241 O VAL A 316 ? O VAL A 314 AA5 1 2 N TRP A 254 ? N TRP A 252 O ILE A 295 ? O ILE A 293 AA6 1 2 O LYS A 352 ? O LYS A 350 N ILE A 343 ? N ILE A 341 AA6 2 3 O GLN A 338 ? O GLN A 336 N GLN A 334 ? N GLN A 332 AA6 3 4 N ALA A 329 ? N ALA A 327 O LYS A 390 ? O LYS A 388 AA6 4 5 N LEU A 393 ? N LEU A 391 O GLU A 417 ? O GLU A 415 AA7 1 2 N THR A 364 ? N THR A 362 O LYS A 514 ? O LYS A 512 AA8 1 2 O LEU A 471 ? O LEU A 469 N GLY A 455 ? N GLY A 453 AA8 2 3 O VAL A 460 ? O VAL A 458 N TYR A 443 ? N TYR A 441 AA8 3 4 N PHE A 442 ? N PHE A 440 O ASN A 496 ? O ASN A 494 AA8 4 5 N ILE A 497 ? N ILE A 495 O ALA A 536 ? O ALA A 534 AA9 1 2 N SER B 49 ? N SER B 48 O GLN B 146 ? O GLN B 145 AA9 2 3 O ILE B 143 ? O ILE B 142 N ILE B 133 ? N ILE B 132 AB1 1 2 N PHE B 62 ? N PHE B 61 O LEU B 75 ? O LEU B 74 AB2 1 2 N TYR B 182 ? N TYR B 181 O TYR B 189 ? O TYR B 188 AB2 2 3 O LEU B 188 ? O LEU B 187 N LEU B 110 ? N LEU B 109 AB2 3 4 N VAL B 107 ? N VAL B 106 O LEU B 235 ? O LEU B 234 AB3 1 2 N TRP B 253 ? N TRP B 252 O ILE B 294 ? O ILE B 293 AB4 1 2 O LYS B 351 ? O LYS B 350 N ILE B 342 ? N ILE B 341 AB4 2 3 O TYR B 343 ? O TYR B 342 N ILE B 327 ? N ILE B 326 AB4 3 4 N ALA B 328 ? N ALA B 327 O LYS B 389 ? O LYS B 388 AB4 4 5 N LEU B 392 ? N LEU B 391 O GLU B 416 ? O GLU B 415 AB5 1 2 N SER C 50 ? N SER C 48 O GLN C 147 ? O GLN C 145 AB5 2 3 O ILE C 144 ? O ILE C 142 N ILE C 134 ? N ILE C 132 AB6 1 2 N ILE C 65 ? N ILE C 63 O ARG C 74 ? O ARG C 72 AB7 1 2 N LEU C 111 ? N LEU C 109 O LEU C 189 ? O LEU C 187 AB7 2 3 O GLY C 192 ? O GLY C 190 N VAL C 181 ? N VAL C 179 AB8 1 2 N PHE C 229 ? N PHE C 227 O LEU C 236 ? O LEU C 234 AB8 2 3 N GLU C 235 ? N GLU C 233 O THR C 242 ? O THR C 240 AB8 3 4 N TRP C 241 ? N TRP C 239 O GLY C 318 ? O GLY C 316 AB9 1 2 N TRP C 254 ? N TRP C 252 O ILE C 295 ? O ILE C 293 AC1 1 2 O LYS C 352 ? O LYS C 350 N ILE C 343 ? N ILE C 341 AC1 2 3 O GLN C 338 ? O GLN C 336 N GLN C 334 ? N GLN C 332 AC1 3 4 N ALA C 329 ? N ALA C 327 O LYS C 390 ? O LYS C 388 AC1 4 5 N PHE C 391 ? N PHE C 389 O GLU C 417 ? O GLU C 415 AC2 1 2 N THR C 364 ? N THR C 362 O LYS C 514 ? O LYS C 512 AC3 1 2 O VAL C 469 ? O VAL C 467 N ALA C 457 ? N ALA C 455 AC3 2 3 O VAL C 460 ? O VAL C 458 N TYR C 443 ? N TYR C 441 AC3 3 4 N PHE C 442 ? N PHE C 440 O ASN C 496 ? O ASN C 494 AC3 4 5 N ILE C 497 ? N ILE C 495 O ALA C 536 ? O ALA C 534 AC4 1 2 N SER D 49 ? N SER D 48 O GLN D 146 ? O GLN D 145 AC4 2 3 O ILE D 143 ? O ILE D 142 N ILE D 133 ? N ILE D 132 AC5 1 2 N ILE D 64 ? N ILE D 63 O ARG D 73 ? O ARG D 72 AC6 1 2 N TYR D 182 ? N TYR D 181 O TYR D 189 ? O TYR D 188 AC6 2 3 O LEU D 188 ? O LEU D 187 N LEU D 110 ? N LEU D 109 AC6 3 4 N VAL D 107 ? N VAL D 106 O LEU D 235 ? O LEU D 234 AC7 1 2 N TRP D 253 ? N TRP D 252 O ILE D 294 ? O ILE D 293 AC8 1 2 O TYR D 355 ? O TYR D 354 N TRP D 338 ? N TRP D 337 AC8 2 3 O TYR D 343 ? O TYR D 342 N ILE D 327 ? N ILE D 326 AC8 3 4 N ALA D 328 ? N ALA D 327 O LYS D 389 ? O LYS D 388 AC8 4 5 N LEU D 392 ? N LEU D 391 O GLU D 416 ? O GLU D 415 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 601 ? 4 'binding site for residue MN A 601' AC2 Software A MN 602 ? 5 'binding site for residue MN A 602' AC3 Software A ZW2 603 ? 11 'binding site for residue ZW2 A 603' AC4 Software A PGE 604 ? 4 'binding site for residue PGE A 604' AC5 Software A EDO 605 ? 3 'binding site for residue EDO A 605' AC6 Software A EDO 606 ? 7 'binding site for residue EDO A 606' AC7 Software A EDO 607 ? 3 'binding site for residue EDO A 607' AC8 Software A EDO 608 ? 3 'binding site for residue EDO A 608' AC9 Software A EDO 609 ? 3 'binding site for residue EDO A 609' AD1 Software A EDO 610 ? 5 'binding site for residue EDO A 610' AD2 Software A EDO 611 ? 8 'binding site for residue EDO A 611' AD3 Software A EDO 612 ? 5 'binding site for residue EDO A 612' AD4 Software A EDO 613 ? 6 'binding site for residue EDO A 613' AD5 Software A EDO 614 ? 5 'binding site for residue EDO A 614' AD6 Software A EDO 615 ? 3 'binding site for residue EDO A 615' AD7 Software A EDO 616 ? 6 'binding site for residue EDO A 616' AD8 Software A EDO 617 ? 2 'binding site for residue EDO A 617' AD9 Software A EDO 618 ? 8 'binding site for residue EDO A 618' AE1 Software B PGE 501 ? 9 'binding site for residue PGE B 501' AE2 Software B PGE 502 ? 12 'binding site for residue PGE B 502' AE3 Software B PGE 503 ? 11 'binding site for residue PGE B 503' AE4 Software B PGE 504 ? 12 'binding site for residue PGE B 504' AE5 Software B EDO 505 ? 5 'binding site for residue EDO B 505' AE6 Software B EDO 506 ? 8 'binding site for residue EDO B 506' AE7 Software B EDO 507 ? 7 'binding site for residue EDO B 507' AE8 Software B EDO 508 ? 4 'binding site for residue EDO B 508' AE9 Software B EDO 509 ? 6 'binding site for residue EDO B 509' AF1 Software B EDO 510 ? 5 'binding site for residue EDO B 510' AF2 Software B EDO 511 ? 6 'binding site for residue EDO B 511' AF3 Software B EDO 512 ? 5 'binding site for residue EDO B 512' AF4 Software B EDO 513 ? 7 'binding site for residue EDO B 513' AF5 Software B EDO 514 ? 2 'binding site for residue EDO B 514' AF6 Software B EDO 515 ? 3 'binding site for residue EDO B 515' AF7 Software B EDO 516 ? 4 'binding site for residue EDO B 516' AF8 Software B EDO 517 ? 6 'binding site for residue EDO B 517' AF9 Software B EDO 518 ? 1 'binding site for residue EDO B 518' AG1 Software B EDO 519 ? 8 'binding site for residue EDO B 519' AG2 Software B EDO 520 ? 8 'binding site for residue EDO B 520' AG3 Software B EDO 521 ? 6 'binding site for residue EDO B 521' AG4 Software B EDO 522 ? 7 'binding site for residue EDO B 522' AG5 Software B EDO 523 ? 9 'binding site for residue EDO B 523' AG6 Software C MN 601 ? 4 'binding site for residue MN C 601' AG7 Software C MN 602 ? 5 'binding site for residue MN C 602' AG8 Software C ZW2 603 ? 10 'binding site for residue ZW2 C 603' AG9 Software C EDO 604 ? 5 'binding site for residue EDO C 604' AH1 Software C EDO 605 ? 6 'binding site for residue EDO C 605' AH2 Software C EDO 606 ? 4 'binding site for residue EDO C 606' AH3 Software C EDO 607 ? 3 'binding site for residue EDO C 607' AH4 Software C EDO 608 ? 2 'binding site for residue EDO C 608' AH5 Software C EDO 609 ? 6 'binding site for residue EDO C 609' AH6 Software C EDO 610 ? 3 'binding site for residue EDO C 610' AH7 Software C EDO 611 ? 8 'binding site for residue EDO C 611' AH8 Software C EDO 612 ? 4 'binding site for residue EDO C 612' AH9 Software C EDO 613 ? 4 'binding site for residue EDO C 613' AI1 Software C EDO 614 ? 1 'binding site for residue EDO C 614' AI2 Software C EDO 615 ? 5 'binding site for residue EDO C 615' AI3 Software C EDO 616 ? 5 'binding site for residue EDO C 616' AI4 Software C EDO 617 ? 4 'binding site for residue EDO C 617' AI5 Software C EDO 618 ? 5 'binding site for residue EDO C 618' AI6 Software C EDO 619 ? 4 'binding site for residue EDO C 619' AI7 Software C EDO 620 ? 6 'binding site for residue EDO C 620' AI8 Software C EDO 621 ? 4 'binding site for residue EDO C 621' AI9 Software C EDO 622 ? 5 'binding site for residue EDO C 622' AJ1 Software C EDO 623 ? 6 'binding site for residue EDO C 623' AJ2 Software C EDO 624 ? 8 'binding site for residue EDO C 624' AJ3 Software C EDO 625 ? 4 'binding site for residue EDO C 625' AJ4 Software C EDO 626 ? 3 'binding site for residue EDO C 626' AJ5 Software D PGE 501 ? 11 'binding site for residue PGE D 501' AJ6 Software D PGE 502 ? 10 'binding site for residue PGE D 502' AJ7 Software D EDO 503 ? 5 'binding site for residue EDO D 503' AJ8 Software D EDO 504 ? 6 'binding site for residue EDO D 504' AJ9 Software D EDO 505 ? 2 'binding site for residue EDO D 505' AK1 Software D EDO 506 ? 3 'binding site for residue EDO D 506' AK2 Software D EDO 507 ? 7 'binding site for residue EDO D 507' AK3 Software D EDO 508 ? 4 'binding site for residue EDO D 508' AK4 Software D EDO 509 ? 5 'binding site for residue EDO D 509' AK5 Software D EDO 510 ? 4 'binding site for residue EDO D 510' AK6 Software D EDO 511 ? 5 'binding site for residue EDO D 511' AK7 Software D EDO 512 ? 4 'binding site for residue EDO D 512' AK8 Software D EDO 513 ? 4 'binding site for residue EDO D 513' AK9 Software D EDO 514 ? 6 'binding site for residue EDO D 514' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 445 ? ASP A 443 . ? 1_555 ? 2 AC1 4 GLU A 480 ? GLU A 478 . ? 1_555 ? 3 AC1 4 ASP A 500 ? ASP A 498 . ? 1_555 ? 4 AC1 4 ZW2 G . ? ZW2 A 603 . ? 1_555 ? 5 AC2 5 ASP A 445 ? ASP A 443 . ? 1_555 ? 6 AC2 5 ASP A 551 ? ASP A 549 . ? 1_555 ? 7 AC2 5 ZW2 G . ? ZW2 A 603 . ? 1_555 ? 8 AC2 5 HOH HC . ? HOH A 777 . ? 1_555 ? 9 AC2 5 HOH HC . ? HOH A 783 . ? 1_555 ? 10 AC3 11 ASP A 445 ? ASP A 443 . ? 1_555 ? 11 AC3 11 GLU A 480 ? GLU A 478 . ? 1_555 ? 12 AC3 11 ASP A 500 ? ASP A 498 . ? 1_555 ? 13 AC3 11 HIS A 541 ? HIS A 539 . ? 1_555 ? 14 AC3 11 ASP A 551 ? ASP A 549 . ? 1_555 ? 15 AC3 11 MN E . ? MN A 601 . ? 1_555 ? 16 AC3 11 MN F . ? MN A 602 . ? 1_555 ? 17 AC3 11 HOH HC . ? HOH A 730 . ? 1_555 ? 18 AC3 11 HOH HC . ? HOH A 742 . ? 1_555 ? 19 AC3 11 HOH HC . ? HOH A 777 . ? 1_555 ? 20 AC3 11 HOH HC . ? HOH A 783 . ? 1_555 ? 21 AC4 4 GLN A 396 ? GLN A 394 . ? 1_555 ? 22 AC4 4 LYS A 397 ? LYS A 395 . ? 1_555 ? 23 AC4 4 GLU A 398 ? GLU A 396 . ? 1_555 ? 24 AC4 4 PHE A 418 ? PHE A 416 . ? 1_555 ? 25 AC5 3 PHE A 391 ? PHE A 389 . ? 1_555 ? 26 AC5 3 GLU A 415 ? GLU A 413 . ? 1_555 ? 27 AC5 3 GLU A 417 ? GLU A 415 . ? 1_555 ? 28 AC6 7 LYS A 103 ? LYS A 101 . ? 1_555 ? 29 AC6 7 LYS A 104 ? LYS A 102 . ? 1_555 ? 30 AC6 7 LYS A 105 ? LYS A 103 . ? 1_555 ? 31 AC6 7 VAL A 108 ? VAL A 106 . ? 1_555 ? 32 AC6 7 TYR A 190 ? TYR A 188 . ? 1_555 ? 33 AC6 7 PRO A 238 ? PRO A 236 . ? 1_555 ? 34 AC6 7 TYR A 320 ? TYR A 318 . ? 1_555 ? 35 AC7 3 LYS A 463 ? LYS A 461 . ? 1_555 ? 36 AC7 3 ARG A 465 ? ARG A 463 . ? 1_555 ? 37 AC7 3 PRO C 470 ? PRO C 468 . ? 1_666 ? 38 AC8 3 LYS A 283 ? LYS A 281 . ? 1_555 ? 39 AC8 3 ARG A 286 ? ARG A 284 . ? 1_555 ? 40 AC8 3 LYS C 72 ? LYS C 70 . ? 1_555 ? 41 AC9 3 GLN A 375 ? GLN A 373 . ? 1_555 ? 42 AC9 3 THR A 379 ? THR A 377 . ? 1_555 ? 43 AC9 3 HOH HC . ? HOH A 739 . ? 1_555 ? 44 AD1 5 THR A 405 ? THR A 403 . ? 1_555 ? 45 AD1 5 GLU A 406 ? GLU A 404 . ? 1_555 ? 46 AD1 5 TYR A 407 ? TYR A 405 . ? 1_555 ? 47 AD1 5 LYS B 332 ? LYS B 331 . ? 1_555 ? 48 AD1 5 LYS B 425 ? LYS B 424 . ? 1_555 ? 49 AD2 8 ALA A 439 ? ALA A 437 . ? 1_555 ? 50 AD2 8 GLU A 440 ? GLU A 438 . ? 1_555 ? 51 AD2 8 ASN A 462 ? ASN A 460 . ? 1_555 ? 52 AD2 8 LYS A 463 ? LYS A 461 . ? 1_555 ? 53 AD2 8 HOH HC . ? HOH A 710 . ? 1_555 ? 54 AD2 8 HOH HC . ? HOH A 751 . ? 1_555 ? 55 AD2 8 HOH HC . ? HOH A 765 . ? 1_555 ? 56 AD2 8 ALA B 289 ? ALA B 288 . ? 1_555 ? 57 AD3 5 ARG A 450 ? ARG A 448 . ? 1_555 ? 58 AD3 5 THR A 475 ? THR A 473 . ? 1_555 ? 59 AD3 5 ASN A 476 ? ASN A 474 . ? 1_555 ? 60 AD3 5 GLN A 477 ? GLN A 475 . ? 1_555 ? 61 AD3 5 LYS C 51 ? LYS C 49 . ? 1_555 ? 62 AD4 6 LYS A 478 ? LYS A 476 . ? 1_555 ? 63 AD4 6 SER A 517 ? SER A 515 . ? 1_555 ? 64 AD4 6 GLU A 518 ? GLU A 516 . ? 1_555 ? 65 AD4 6 LEU A 519 ? LEU A 517 . ? 1_555 ? 66 AD4 6 HOH HC . ? HOH A 753 . ? 1_555 ? 67 AD4 6 HOH HC . ? HOH A 848 . ? 1_555 ? 68 AD5 5 GLY A 543 ? GLY A 541 . ? 1_555 ? 69 AD5 5 GLY A 545 ? GLY A 543 . ? 1_555 ? 70 AD5 5 GLU A 548 ? GLU A 546 . ? 1_555 ? 71 AD5 5 HOH HC . ? HOH A 764 . ? 1_555 ? 72 AD5 5 ARG B 285 ? ARG B 284 . ? 1_555 ? 73 AD6 3 GLN A 549 ? GLN A 547 . ? 1_555 ? 74 AD6 3 LYS A 552 ? LYS A 550 . ? 1_555 ? 75 AD6 3 LEU A 553 ? LEU A 551 . ? 1_555 ? 76 AD7 6 TYR A 341 ? TYR A 339 . ? 1_555 ? 77 AD7 6 GLN A 342 ? GLN A 340 . ? 1_555 ? 78 AD7 6 GLY A 354 ? GLY A 352 . ? 1_555 ? 79 AD7 6 EDO U . ? EDO A 617 . ? 1_555 ? 80 AD7 6 HOH HC . ? HOH A 748 . ? 1_555 ? 81 AD7 6 HOH HC . ? HOH A 920 . ? 1_555 ? 82 AD8 2 GLN A 332 ? GLN A 330 . ? 1_555 ? 83 AD8 2 EDO T . ? EDO A 616 . ? 1_555 ? 84 AD9 8 LYS A 333 ? LYS A 331 . ? 1_555 ? 85 AD9 8 GLY A 335 ? GLY A 333 . ? 1_555 ? 86 AD9 8 GLN A 336 ? GLN A 334 . ? 1_555 ? 87 AD9 8 GLY A 337 ? GLY A 335 . ? 1_555 ? 88 AD9 8 ARG A 358 ? ARG A 356 . ? 1_555 ? 89 AD9 8 ASP A 366 ? ASP A 364 . ? 1_555 ? 90 AD9 8 GLN A 369 ? GLN A 367 . ? 1_555 ? 91 AD9 8 HOH HC . ? HOH A 744 . ? 1_555 ? 92 AE1 9 VAL B 76 ? VAL B 75 . ? 1_555 ? 93 AE1 9 PHE B 78 ? PHE B 77 . ? 1_555 ? 94 AE1 9 ASN B 82 ? ASN B 81 . ? 1_555 ? 95 AE1 9 GLY B 153 ? GLY B 152 . ? 1_555 ? 96 AE1 9 TYR B 184 ? TYR B 183 . ? 1_555 ? 97 AE1 9 THR B 387 ? THR B 386 . ? 1_555 ? 98 AE1 9 TRP B 411 ? TRP B 410 . ? 1_555 ? 99 AE1 9 ILE B 412 ? ILE B 411 . ? 1_555 ? 100 AE1 9 HOH IC . ? HOH B 739 . ? 1_555 ? 101 AE2 12 LYS B 31 ? LYS B 30 . ? 1_555 ? 102 AE2 12 ILE B 64 ? ILE B 63 . ? 1_555 ? 103 AE2 12 LYS B 65 ? LYS B 64 . ? 1_555 ? 104 AE2 12 LYS B 66 ? LYS B 65 . ? 1_555 ? 105 AE2 12 LYS B 67 ? LYS B 66 . ? 1_555 ? 106 AE2 12 ASP B 68 ? ASP B 67 . ? 1_555 ? 107 AE2 12 THR B 404 ? THR B 403 . ? 1_555 ? 108 AE2 12 GLU B 405 ? GLU B 404 . ? 1_555 ? 109 AE2 12 TRP B 407 ? TRP B 406 . ? 1_555 ? 110 AE2 12 GLN B 408 ? GLN B 407 . ? 1_555 ? 111 AE2 12 EDO PA . ? EDO B 520 . ? 1_555 ? 112 AE2 12 HOH KC . ? HOH D 693 . ? 1_656 ? 113 AE3 11 LYS B 66 ? LYS B 65 . ? 1_555 ? 114 AE3 11 LYS B 67 ? LYS B 66 . ? 1_555 ? 115 AE3 11 TYR B 189 ? TYR B 188 . ? 1_555 ? 116 AE3 11 TYR B 233 ? TYR B 232 . ? 1_555 ? 117 AE3 11 THR B 378 ? THR B 377 . ? 1_555 ? 118 AE3 11 GLN B 408 ? GLN B 407 . ? 1_555 ? 119 AE3 11 ALA B 409 ? ALA B 408 . ? 1_555 ? 120 AE3 11 TRP B 411 ? TRP B 410 . ? 1_555 ? 121 AE3 11 EDO CA . ? EDO B 507 . ? 1_555 ? 122 AE3 11 EDO EA . ? EDO B 509 . ? 1_555 ? 123 AE3 11 HOH IC . ? HOH B 781 . ? 1_555 ? 124 AE4 12 GLU A 196 ? GLU A 194 . ? 1_455 ? 125 AE4 12 HOH HC . ? HOH A 961 . ? 1_455 ? 126 AE4 12 ILE B 95 ? ILE B 94 . ? 1_555 ? 127 AE4 12 PRO B 96 ? PRO B 95 . ? 1_555 ? 128 AE4 12 PRO B 98 ? PRO B 97 . ? 1_555 ? 129 AE4 12 LYS B 173 ? LYS B 172 . ? 1_555 ? 130 AE4 12 ILE B 181 ? ILE B 180 . ? 1_555 ? 131 AE4 12 TYR B 182 ? TYR B 181 . ? 1_555 ? 132 AE4 12 GLN B 183 ? GLN B 182 . ? 1_555 ? 133 AE4 12 HOH IC . ? HOH B 666 . ? 1_555 ? 134 AE4 12 HOH IC . ? HOH B 772 . ? 1_555 ? 135 AE4 12 HOH IC . ? HOH B 847 . ? 1_555 ? 136 AE5 5 TRP B 25 ? TRP B 24 . ? 1_555 ? 137 AE5 5 GLU B 400 ? GLU B 399 . ? 1_555 ? 138 AE5 5 TRP B 403 ? TRP B 402 . ? 1_555 ? 139 AE5 5 EDO BA . ? EDO B 506 . ? 1_555 ? 140 AE5 5 HOH IC . ? HOH B 678 . ? 1_555 ? 141 AE6 8 TRP B 25 ? TRP B 24 . ? 1_555 ? 142 AE6 8 ARG B 79 ? ARG B 78 . ? 1_555 ? 143 AE6 8 GLU B 400 ? GLU B 399 . ? 1_555 ? 144 AE6 8 TRP B 415 ? TRP B 414 . ? 1_555 ? 145 AE6 8 EDO AA . ? EDO B 505 . ? 1_555 ? 146 AE6 8 HOH IC . ? HOH B 634 . ? 1_555 ? 147 AE6 8 HOH IC . ? HOH B 720 . ? 1_555 ? 148 AE6 8 HOH IC . ? HOH B 741 . ? 1_555 ? 149 AE7 7 LYS B 67 ? LYS B 66 . ? 1_555 ? 150 AE7 7 TYR B 233 ? TYR B 232 . ? 1_555 ? 151 AE7 7 GLU B 371 ? GLU B 370 . ? 1_555 ? 152 AE7 7 GLN B 374 ? GLN B 373 . ? 1_555 ? 153 AE7 7 THR B 378 ? THR B 377 . ? 1_555 ? 154 AE7 7 PGE Y . ? PGE B 503 . ? 1_555 ? 155 AE7 7 EDO DA . ? EDO B 508 . ? 1_555 ? 156 AE8 4 TRP B 240 ? TRP B 239 . ? 1_555 ? 157 AE8 4 LYS B 375 ? LYS B 374 . ? 1_555 ? 158 AE8 4 GLU B 379 ? GLU B 378 . ? 1_555 ? 159 AE8 4 EDO CA . ? EDO B 507 . ? 1_555 ? 160 AE9 6 LYS B 66 ? LYS B 65 . ? 1_555 ? 161 AE9 6 VAL B 109 ? VAL B 108 . ? 1_555 ? 162 AE9 6 ASP B 111 ? ASP B 110 . ? 1_555 ? 163 AE9 6 ASP B 187 ? ASP B 186 . ? 1_555 ? 164 AE9 6 TYR B 233 ? TYR B 232 . ? 1_555 ? 165 AE9 6 PGE Y . ? PGE B 503 . ? 1_555 ? 166 AF1 5 GLU B 329 ? GLU B 328 . ? 1_555 ? 167 AF1 5 ILE B 330 ? ILE B 329 . ? 1_555 ? 168 AF1 5 GLN B 331 ? GLN B 330 . ? 1_555 ? 169 AF1 5 PRO B 393 ? PRO B 392 . ? 1_555 ? 170 AF1 5 PRO B 422 ? PRO B 421 . ? 1_555 ? 171 AF2 6 GLN B 335 ? GLN B 334 . ? 1_555 ? 172 AF2 6 GLY B 336 ? GLY B 335 . ? 1_555 ? 173 AF2 6 HIS B 362 ? HIS B 361 . ? 1_555 ? 174 AF2 6 HOH IC . ? HOH B 652 . ? 1_555 ? 175 AF2 6 HOH IC . ? HOH B 733 . ? 1_555 ? 176 AF2 6 HOH IC . ? HOH B 779 . ? 1_555 ? 177 AF3 5 GLU B 7 ? GLU B 6 . ? 1_555 ? 178 AF3 5 VAL B 9 ? VAL B 8 . ? 1_555 ? 179 AF3 5 VAL B 119 ? VAL B 118 . ? 1_555 ? 180 AF3 5 SER B 163 ? SER B 162 . ? 1_555 ? 181 AF3 5 HOH IC . ? HOH B 619 . ? 1_555 ? 182 AF4 7 PRO B 2 ? PRO B 1 . ? 1_555 ? 183 AF4 7 SER B 4 ? SER B 3 . ? 1_555 ? 184 AF4 7 PRO B 120 ? PRO B 119 . ? 1_555 ? 185 AF4 7 ARG B 126 ? ARG B 125 . ? 1_555 ? 186 AF4 7 ASN B 148 ? ASN B 147 . ? 1_555 ? 187 AF4 7 HOH IC . ? HOH B 657 . ? 1_555 ? 188 AF4 7 HOH IC . ? HOH B 770 . ? 1_555 ? 189 AF5 2 SER B 4 ? SER B 3 . ? 1_555 ? 190 AF5 2 SER B 118 ? SER B 117 . ? 1_555 ? 191 AF6 3 GLU A 171 ? GLU A 169 . ? 1_555 ? 192 AF6 3 GLU B 43 ? GLU B 42 . ? 1_555 ? 193 AF6 3 LYS B 50 ? LYS B 49 . ? 1_555 ? 194 AF7 4 ASN B 82 ? ASN B 81 . ? 1_555 ? 195 AF7 4 LYS B 155 ? LYS B 154 . ? 1_555 ? 196 AF7 4 MET B 185 ? MET B 184 . ? 1_555 ? 197 AF7 4 HOH IC . ? HOH B 739 . ? 1_555 ? 198 AF8 6 ILE B 95 ? ILE B 94 . ? 1_555 ? 199 AF8 6 PRO B 158 ? PRO B 157 . ? 1_555 ? 200 AF8 6 TYR B 182 ? TYR B 181 . ? 1_555 ? 201 AF8 6 GLN B 183 ? GLN B 182 . ? 1_555 ? 202 AF8 6 TYR B 184 ? TYR B 183 . ? 1_555 ? 203 AF8 6 MET B 185 ? MET B 184 . ? 1_555 ? 204 AF9 1 LYS B 127 ? LYS B 126 . ? 1_555 ? 205 AG1 8 PHE B 417 ? PHE B 416 . ? 1_555 ? 206 AG1 8 ASN B 419 ? ASN B 418 . ? 1_555 ? 207 AG1 8 HOH IC . ? HOH B 601 . ? 1_555 ? 208 AG1 8 HOH IC . ? HOH B 740 . ? 1_555 ? 209 AG1 8 HOH IC . ? HOH B 827 . ? 1_555 ? 210 AG1 8 GLU C 30 ? GLU C 28 . ? 1_555 ? 211 AG1 8 GLU C 31 ? GLU C 29 . ? 1_555 ? 212 AG1 8 EDO KB . ? EDO C 618 . ? 1_555 ? 213 AG2 8 ARG B 359 ? ARG B 358 . ? 1_555 ? 214 AG2 8 LYS B 367 ? LYS B 366 . ? 1_555 ? 215 AG2 8 GLU B 405 ? GLU B 404 . ? 1_555 ? 216 AG2 8 TYR B 406 ? TYR B 405 . ? 1_555 ? 217 AG2 8 PGE X . ? PGE B 502 . ? 1_555 ? 218 AG2 8 HOH IC . ? HOH B 756 . ? 1_555 ? 219 AG2 8 GLU D 301 ? GLU D 300 . ? 1_656 ? 220 AG2 8 HOH KC . ? HOH D 775 . ? 1_656 ? 221 AG3 6 THR B 28 ? THR B 27 . ? 1_555 ? 222 AG3 6 THR B 401 ? THR B 400 . ? 1_555 ? 223 AG3 6 TRP B 402 ? TRP B 401 . ? 1_555 ? 224 AG3 6 GLU B 405 ? GLU B 404 . ? 1_555 ? 225 AG3 6 EDO SA . ? EDO B 523 . ? 1_555 ? 226 AG3 6 HOH IC . ? HOH B 631 . ? 1_555 ? 227 AG4 7 THR B 241 ? THR B 240 . ? 1_555 ? 228 AG4 7 VAL B 242 ? VAL B 241 . ? 1_555 ? 229 AG4 7 GLN B 243 ? GLN B 242 . ? 1_555 ? 230 AG4 7 TYR B 340 ? TYR B 339 . ? 1_555 ? 231 AG4 7 GLY B 353 ? GLY B 352 . ? 1_555 ? 232 AG4 7 LYS B 354 ? LYS B 353 . ? 1_555 ? 233 AG4 7 HOH IC . ? HOH B 712 . ? 1_555 ? 234 AG5 9 PRO B 26 ? PRO B 25 . ? 1_555 ? 235 AG5 9 LEU B 27 ? LEU B 26 . ? 1_555 ? 236 AG5 9 THR B 28 ? THR B 27 . ? 1_555 ? 237 AG5 9 LYS B 31 ? LYS B 30 . ? 1_555 ? 238 AG5 9 THR B 404 ? THR B 403 . ? 1_555 ? 239 AG5 9 EDO QA . ? EDO B 521 . ? 1_555 ? 240 AG5 9 HOH IC . ? HOH B 602 . ? 1_555 ? 241 AG5 9 HOH IC . ? HOH B 631 . ? 1_555 ? 242 AG5 9 HOH IC . ? HOH B 705 . ? 1_555 ? 243 AG6 4 ASP C 445 ? ASP C 443 . ? 1_555 ? 244 AG6 4 GLU C 480 ? GLU C 478 . ? 1_555 ? 245 AG6 4 ASP C 500 ? ASP C 498 . ? 1_555 ? 246 AG6 4 ZW2 VA . ? ZW2 C 603 . ? 1_555 ? 247 AG7 5 ASP C 445 ? ASP C 443 . ? 1_555 ? 248 AG7 5 ASP C 551 ? ASP C 549 . ? 1_555 ? 249 AG7 5 ZW2 VA . ? ZW2 C 603 . ? 1_555 ? 250 AG7 5 HOH JC . ? HOH C 755 . ? 1_555 ? 251 AG7 5 HOH JC . ? HOH C 882 . ? 1_555 ? 252 AG8 10 ASP C 445 ? ASP C 443 . ? 1_555 ? 253 AG8 10 GLU C 480 ? GLU C 478 . ? 1_555 ? 254 AG8 10 ASP C 500 ? ASP C 498 . ? 1_555 ? 255 AG8 10 HIS C 541 ? HIS C 539 . ? 1_555 ? 256 AG8 10 ASP C 551 ? ASP C 549 . ? 1_555 ? 257 AG8 10 MN TA . ? MN C 601 . ? 1_555 ? 258 AG8 10 MN UA . ? MN C 602 . ? 1_555 ? 259 AG8 10 EDO OB . ? EDO C 622 . ? 1_555 ? 260 AG8 10 EDO PB . ? EDO C 623 . ? 1_555 ? 261 AG8 10 HOH JC . ? HOH C 882 . ? 1_555 ? 262 AG9 5 ASP C 123 ? ASP C 121 . ? 1_555 ? 263 AG9 5 GLU C 124 ? GLU C 122 . ? 1_555 ? 264 AG9 5 ASP C 125 ? ASP C 123 . ? 1_555 ? 265 AG9 5 EDO XA . ? EDO C 605 . ? 1_555 ? 266 AG9 5 HOH JC . ? HOH C 701 . ? 1_555 ? 267 AH1 6 VAL C 12 ? VAL C 10 . ? 1_555 ? 268 AH1 6 LYS C 13 ? LYS C 11 . ? 1_555 ? 269 AH1 6 ASP C 123 ? ASP C 121 . ? 1_555 ? 270 AH1 6 ASP C 125 ? ASP C 123 . ? 1_555 ? 271 AH1 6 EDO WA . ? EDO C 604 . ? 1_555 ? 272 AH1 6 HOH JC . ? HOH C 933 . ? 1_555 ? 273 AH2 4 LYS C 105 ? LYS C 103 . ? 1_555 ? 274 AH2 4 VAL C 108 ? VAL C 106 . ? 1_555 ? 275 AH2 4 TYR C 190 ? TYR C 188 . ? 1_555 ? 276 AH2 4 TYR C 320 ? TYR C 318 . ? 1_555 ? 277 AH3 3 TYR C 185 ? TYR C 183 . ? 1_555 ? 278 AH3 3 ASP C 188 ? ASP C 186 . ? 1_555 ? 279 AH3 3 HOH JC . ? HOH C 836 . ? 1_555 ? 280 AH4 2 PHE C 348 ? PHE C 346 . ? 1_555 ? 281 AH4 2 ASN C 350 ? ASN C 348 . ? 1_555 ? 282 AH5 6 THR C 379 ? THR C 377 . ? 1_555 ? 283 AH5 6 ILE C 382 ? ILE C 380 . ? 1_555 ? 284 AH5 6 TRP D 25 ? TRP D 24 . ? 1_555 ? 285 AH5 6 PRO D 26 ? PRO D 25 . ? 1_555 ? 286 AH5 6 GLU D 400 ? GLU D 399 . ? 1_555 ? 287 AH5 6 PGE UB . ? PGE D 502 . ? 1_555 ? 288 AH6 3 GLN C 502 ? GLN C 500 . ? 1_555 ? 289 AH6 3 TRP D 267 ? TRP D 266 . ? 1_555 ? 290 AH6 3 HOH KC . ? HOH D 702 . ? 1_555 ? 291 AH7 8 GLY C 438 ? GLY C 436 . ? 1_555 ? 292 AH7 8 ALA C 439 ? ALA C 437 . ? 1_555 ? 293 AH7 8 GLU C 440 ? GLU C 438 . ? 1_555 ? 294 AH7 8 ASN C 462 ? ASN C 460 . ? 1_555 ? 295 AH7 8 LYS C 463 ? LYS C 461 . ? 1_555 ? 296 AH7 8 HOH JC . ? HOH C 717 . ? 1_555 ? 297 AH7 8 HOH JC . ? HOH C 827 . ? 1_555 ? 298 AH7 8 ALA D 289 ? ALA D 288 . ? 1_555 ? 299 AH8 4 GLU A 250 ? GLU A 248 . ? 1_455 ? 300 AH8 4 LYS A 251 ? LYS A 249 . ? 1_455 ? 301 AH8 4 ASP A 252 ? ASP A 250 . ? 1_455 ? 302 AH8 4 PRO C 16 ? PRO C 14 . ? 1_555 ? 303 AH9 4 PRO C 3 ? PRO C 1 . ? 1_555 ? 304 AH9 4 ILE C 4 ? ILE C 2 . ? 1_555 ? 305 AH9 4 GLY C 215 ? GLY C 213 . ? 1_555 ? 306 AH9 4 HOH JC . ? HOH C 837 . ? 1_555 ? 307 AI1 1 GLU C 8 ? GLU C 6 . ? 1_555 ? 308 AI2 5 VAL C 12 ? VAL C 10 . ? 1_555 ? 309 AI2 5 LYS C 13 ? LYS C 11 . ? 1_555 ? 310 AI2 5 LEU C 14 ? LEU C 12 . ? 1_555 ? 311 AI2 5 ASP C 125 ? ASP C 123 . ? 1_555 ? 312 AI2 5 TYR C 129 ? TYR C 127 . ? 1_555 ? 313 AI3 5 ASP C 19 ? ASP C 17 . ? 1_555 ? 314 AI3 5 LYS C 22 ? LYS C 20 . ? 1_555 ? 315 AI3 5 PRO C 57 ? PRO C 55 . ? 1_555 ? 316 AI3 5 TYR C 58 ? TYR C 56 . ? 1_555 ? 317 AI3 5 HOH JC . ? HOH C 945 . ? 1_555 ? 318 AI4 4 ASN C 56 ? ASN C 54 . ? 1_555 ? 319 AI4 4 PRO C 57 ? PRO C 55 . ? 1_555 ? 320 AI4 4 ASN C 59 ? ASN C 57 . ? 1_555 ? 321 AI4 4 ARG C 145 ? ARG C 143 . ? 1_555 ? 322 AI5 5 LYS B 396 ? LYS B 395 . ? 1_555 ? 323 AI5 5 EDO OA . ? EDO B 519 . ? 1_555 ? 324 AI5 5 HOH IC . ? HOH B 723 . ? 1_555 ? 325 AI5 5 HOH IC . ? HOH B 740 . ? 1_555 ? 326 AI5 5 GLU C 31 ? GLU C 29 . ? 1_555 ? 327 AI6 4 SER C 50 ? SER C 48 . ? 1_555 ? 328 AI6 4 LYS C 51 ? LYS C 49 . ? 1_555 ? 329 AI6 4 ILE C 52 ? ILE C 50 . ? 1_555 ? 330 AI6 4 HOH JC . ? HOH C 763 . ? 1_555 ? 331 AI7 6 ARG C 80 ? ARG C 78 . ? 1_555 ? 332 AI7 6 ASN C 83 ? ASN C 81 . ? 1_555 ? 333 AI7 6 LYS C 84 ? LYS C 82 . ? 1_555 ? 334 AI7 6 HOH JC . ? HOH C 704 . ? 1_555 ? 335 AI7 6 HOH JC . ? HOH C 810 . ? 1_555 ? 336 AI7 6 HOH JC . ? HOH C 860 . ? 1_555 ? 337 AI8 4 TYR C 117 ? TYR C 115 . ? 1_555 ? 338 AI8 4 GLY C 154 ? GLY C 152 . ? 1_555 ? 339 AI8 4 SER C 158 ? SER C 156 . ? 1_555 ? 340 AI8 4 HOH JC . ? HOH C 814 . ? 1_555 ? 341 AI9 5 GLY C 446 ? GLY C 444 . ? 1_555 ? 342 AI9 5 ASN C 476 ? ASN C 474 . ? 1_555 ? 343 AI9 5 GLU C 480 ? GLU C 478 . ? 1_555 ? 344 AI9 5 ZW2 VA . ? ZW2 C 603 . ? 1_555 ? 345 AI9 5 EDO PB . ? EDO C 623 . ? 1_555 ? 346 AJ1 6 GLU C 480 ? GLU C 478 . ? 1_555 ? 347 AJ1 6 ASP C 500 ? ASP C 498 . ? 1_555 ? 348 AJ1 6 SER C 501 ? SER C 499 . ? 1_555 ? 349 AJ1 6 ZW2 VA . ? ZW2 C 603 . ? 1_555 ? 350 AJ1 6 EDO OB . ? EDO C 622 . ? 1_555 ? 351 AJ1 6 HOH JC . ? HOH C 838 . ? 1_555 ? 352 AJ2 8 TYR C 429 ? TYR C 427 . ? 1_555 ? 353 AJ2 8 GLN C 430 ? GLN C 428 . ? 1_555 ? 354 AJ2 8 LEU C 527 ? LEU C 525 . ? 1_555 ? 355 AJ2 8 LYS C 530 ? LYS C 528 . ? 1_555 ? 356 AJ2 8 GLU C 531 ? GLU C 529 . ? 1_555 ? 357 AJ2 8 VAL C 533 ? VAL C 531 . ? 1_555 ? 358 AJ2 8 HOH JC . ? HOH C 710 . ? 1_555 ? 359 AJ2 8 HOH JC . ? HOH C 736 . ? 1_555 ? 360 AJ3 4 PRO C 6 ? PRO C 4 . ? 1_555 ? 361 AJ3 4 ARG C 213 ? ARG C 211 . ? 1_555 ? 362 AJ3 4 TRP C 214 ? TRP C 212 . ? 1_555 ? 363 AJ3 4 HOH JC . ? HOH C 976 . ? 1_555 ? 364 AJ4 3 GLU C 91 ? GLU C 89 . ? 1_555 ? 365 AJ4 3 GLN C 163 ? GLN C 161 . ? 1_555 ? 366 AJ4 3 HOH JC . ? HOH C 735 . ? 1_555 ? 367 AJ5 11 LEU D 75 ? LEU D 74 . ? 1_555 ? 368 AJ5 11 VAL D 76 ? VAL D 75 . ? 1_555 ? 369 AJ5 11 PHE D 78 ? PHE D 77 . ? 1_555 ? 370 AJ5 11 ASN D 82 ? ASN D 81 . ? 1_555 ? 371 AJ5 11 GLY D 153 ? GLY D 152 . ? 1_555 ? 372 AJ5 11 TYR D 184 ? TYR D 183 . ? 1_555 ? 373 AJ5 11 MET D 185 ? MET D 184 . ? 1_555 ? 374 AJ5 11 THR D 387 ? THR D 386 . ? 1_555 ? 375 AJ5 11 TRP D 411 ? TRP D 410 . ? 1_555 ? 376 AJ5 11 ILE D 412 ? ILE D 411 . ? 1_555 ? 377 AJ5 11 HOH KC . ? HOH D 737 . ? 1_555 ? 378 AJ6 10 EDO BB . ? EDO C 609 . ? 1_555 ? 379 AJ6 10 TRP D 25 ? TRP D 24 . ? 1_555 ? 380 AJ6 10 GLU D 400 ? GLU D 399 . ? 1_555 ? 381 AJ6 10 THR D 401 ? THR D 400 . ? 1_555 ? 382 AJ6 10 TRP D 402 ? TRP D 401 . ? 1_555 ? 383 AJ6 10 TRP D 403 ? TRP D 402 . ? 1_555 ? 384 AJ6 10 THR D 404 ? THR D 403 . ? 1_555 ? 385 AJ6 10 EDO WB . ? EDO D 504 . ? 1_555 ? 386 AJ6 10 HOH KC . ? HOH D 692 . ? 1_555 ? 387 AJ6 10 HOH KC . ? HOH D 694 . ? 1_555 ? 388 AJ7 5 ILE D 64 ? ILE D 63 . ? 1_555 ? 389 AJ7 5 LYS D 65 ? LYS D 64 . ? 1_555 ? 390 AJ7 5 GLU D 405 ? GLU D 404 . ? 1_555 ? 391 AJ7 5 TRP D 407 ? TRP D 406 . ? 1_555 ? 392 AJ7 5 GLN D 408 ? GLN D 407 . ? 1_555 ? 393 AJ8 6 ARG D 79 ? ARG D 78 . ? 1_555 ? 394 AJ8 6 GLU D 400 ? GLU D 399 . ? 1_555 ? 395 AJ8 6 TRP D 415 ? TRP D 414 . ? 1_555 ? 396 AJ8 6 PGE UB . ? PGE D 502 . ? 1_555 ? 397 AJ8 6 HOH KC . ? HOH D 607 . ? 1_555 ? 398 AJ8 6 HOH KC . ? HOH D 630 . ? 1_555 ? 399 AJ9 2 GLN D 86 ? GLN D 85 . ? 1_555 ? 400 AJ9 2 ASP D 87 ? ASP D 86 . ? 1_555 ? 401 AK1 3 VAL D 242 ? VAL D 241 . ? 1_555 ? 402 AK1 3 LEU D 350 ? LEU D 349 . ? 1_555 ? 403 AK1 3 LYS D 351 ? LYS D 350 . ? 1_555 ? 404 AK2 7 LYS D 66 ? LYS D 65 . ? 1_555 ? 405 AK2 7 VAL D 109 ? VAL D 108 . ? 1_555 ? 406 AK2 7 LEU D 110 ? LEU D 109 . ? 1_555 ? 407 AK2 7 ASP D 111 ? ASP D 110 . ? 1_555 ? 408 AK2 7 ASP D 187 ? ASP D 186 . ? 1_555 ? 409 AK2 7 MET D 231 ? MET D 230 . ? 1_555 ? 410 AK2 7 HOH KC . ? HOH D 678 . ? 1_555 ? 411 AK3 4 THR D 287 ? THR D 286 . ? 1_555 ? 412 AK3 4 LYS D 288 ? LYS D 287 . ? 1_555 ? 413 AK3 4 GLU D 292 ? GLU D 291 . ? 1_555 ? 414 AK3 4 HOH KC . ? HOH D 603 . ? 1_555 ? 415 AK4 5 GLU D 299 ? GLU D 298 . ? 1_555 ? 416 AK4 5 LEU D 302 ? LEU D 301 . ? 1_555 ? 417 AK4 5 GLU D 306 ? GLU D 305 . ? 1_555 ? 418 AK4 5 HOH KC . ? HOH D 649 . ? 1_555 ? 419 AK4 5 HOH KC . ? HOH D 684 . ? 1_555 ? 420 AK5 4 TYR D 233 ? TYR D 232 . ? 1_555 ? 421 AK5 4 TRP D 240 ? TRP D 239 . ? 1_555 ? 422 AK5 4 LYS D 375 ? LYS D 374 . ? 1_555 ? 423 AK5 4 GLU D 379 ? GLU D 378 . ? 1_555 ? 424 AK6 5 LYS D 396 ? LYS D 395 . ? 1_555 ? 425 AK6 5 GLU D 397 ? GLU D 396 . ? 1_555 ? 426 AK6 5 GLU D 400 ? GLU D 399 . ? 1_555 ? 427 AK6 5 HOH KC . ? HOH D 694 . ? 1_555 ? 428 AK6 5 HOH KC . ? HOH D 748 . ? 1_555 ? 429 AK7 4 PRO C 435 ? PRO C 433 . ? 1_555 ? 430 AK7 4 THR D 254 ? THR D 253 . ? 1_555 ? 431 AK7 4 THR D 291 ? THR D 290 . ? 1_555 ? 432 AK7 4 HOH KC . ? HOH D 623 . ? 1_555 ? 433 AK8 4 TYR D 184 ? TYR D 183 . ? 1_555 ? 434 AK8 4 LYS D 386 ? LYS D 385 . ? 1_555 ? 435 AK8 4 THR D 387 ? THR D 386 . ? 1_555 ? 436 AK8 4 LYS D 389 ? LYS D 388 . ? 1_555 ? 437 AK9 6 GLU D 329 ? GLU D 328 . ? 1_555 ? 438 AK9 6 ILE D 330 ? ILE D 329 . ? 1_555 ? 439 AK9 6 GLN D 331 ? GLN D 330 . ? 1_555 ? 440 AK9 6 LYS D 391 ? LYS D 390 . ? 1_555 ? 441 AK9 6 VAL D 418 ? VAL D 417 . ? 1_555 ? 442 AK9 6 THR D 420 ? THR D 419 . ? 1_555 ? # _atom_sites.entry_id 6AOC _atom_sites.fract_transf_matrix[1][1] 0.014211 _atom_sites.fract_transf_matrix[1][2] 0.005375 _atom_sites.fract_transf_matrix[1][3] 0.003164 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011997 _atom_sites.fract_transf_matrix[2][3] 0.004110 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009413 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 VAL 2 0 ? ? ? A . n A 1 3 PRO 3 1 1 PRO PRO A . n A 1 4 ILE 4 2 2 ILE ILE A . n A 1 5 SER 5 3 3 SER SER A . n A 1 6 PRO 6 4 4 PRO PRO A . n A 1 7 ILE 7 5 5 ILE ILE A . n A 1 8 GLU 8 6 6 GLU GLU A . n A 1 9 THR 9 7 7 THR THR A . n A 1 10 VAL 10 8 8 VAL VAL A . n A 1 11 PRO 11 9 9 PRO PRO A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 PRO 16 14 14 PRO PRO A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 MET 18 16 16 MET MET A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 PRO 21 19 19 PRO PRO A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 TRP 26 24 24 TRP TRP A . n A 1 27 PRO 27 25 25 PRO PRO A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 THR 29 27 27 THR THR A . n A 1 30 GLU 30 28 28 GLU GLU A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 LYS 32 30 30 LYS LYS A . n A 1 33 ILE 33 31 31 ILE ILE A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 ALA 35 33 33 ALA ALA A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 GLU 38 36 36 GLU GLU A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 CYS 40 38 38 CYS CYS A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 GLU 42 40 40 GLU GLU A . n A 1 43 MET 43 41 41 MET MET A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 LYS 45 43 43 LYS LYS A . n A 1 46 GLU 46 44 44 GLU GLU A . n A 1 47 GLY 47 45 45 GLY GLY A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 ILE 49 47 47 ILE ILE A . n A 1 50 SER 50 48 48 SER SER A . n A 1 51 LYS 51 49 49 LYS LYS A . n A 1 52 ILE 52 50 50 ILE ILE A . n A 1 53 GLY 53 51 51 GLY GLY A . n A 1 54 PRO 54 52 52 PRO PRO A . n A 1 55 GLU 55 53 53 GLU GLU A . n A 1 56 ASN 56 54 54 ASN ASN A . n A 1 57 PRO 57 55 55 PRO PRO A . n A 1 58 TYR 58 56 56 TYR TYR A . n A 1 59 ASN 59 57 57 ASN ASN A . n A 1 60 THR 60 58 58 THR THR A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 PHE 63 61 61 PHE PHE A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 ILE 65 63 63 ILE ILE A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 LYS 67 65 65 LYS LYS A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 SER 70 68 68 SER SER A . n A 1 71 THR 71 69 69 THR THR A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 TRP 73 71 71 TRP TRP A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 LYS 75 73 73 LYS LYS A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 VAL 77 75 75 VAL VAL A . n A 1 78 ASP 78 76 76 ASP ASP A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 ARG 80 78 78 ARG ARG A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 LYS 84 82 82 LYS LYS A . n A 1 85 ARG 85 83 83 ARG ARG A . n A 1 86 THR 86 84 84 THR THR A . n A 1 87 GLN 87 85 85 GLN GLN A . n A 1 88 ASP 88 86 86 ASP ASP A . n A 1 89 PHE 89 87 87 PHE PHE A . n A 1 90 TRP 90 88 88 TRP TRP A . n A 1 91 GLU 91 89 89 GLU GLU A . n A 1 92 VAL 92 90 90 VAL VAL A . n A 1 93 GLN 93 91 91 GLN GLN A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 GLY 95 93 93 GLY GLY A . n A 1 96 ILE 96 94 94 ILE ILE A . n A 1 97 PRO 97 95 95 PRO PRO A . n A 1 98 HIS 98 96 96 HIS HIS A . n A 1 99 PRO 99 97 97 PRO PRO A . n A 1 100 ALA 100 98 98 ALA ALA A . n A 1 101 GLY 101 99 99 GLY GLY A . n A 1 102 LEU 102 100 100 LEU LEU A . n A 1 103 LYS 103 101 101 LYS LYS A . n A 1 104 LYS 104 102 102 LYS LYS A . n A 1 105 LYS 105 103 103 LYS LYS A . n A 1 106 LYS 106 104 104 LYS LYS A . n A 1 107 SER 107 105 105 SER SER A . n A 1 108 VAL 108 106 106 VAL VAL A . n A 1 109 THR 109 107 107 THR THR A . n A 1 110 VAL 110 108 108 VAL VAL A . n A 1 111 LEU 111 109 109 LEU LEU A . n A 1 112 ASP 112 110 110 ASP ASP A . n A 1 113 VAL 113 111 111 VAL VAL A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 ALA 116 114 114 ALA ALA A . n A 1 117 TYR 117 115 115 TYR TYR A . n A 1 118 PHE 118 116 116 PHE PHE A . n A 1 119 SER 119 117 117 SER SER A . n A 1 120 VAL 120 118 118 VAL VAL A . n A 1 121 PRO 121 119 119 PRO PRO A . n A 1 122 LEU 122 120 120 LEU LEU A . n A 1 123 ASP 123 121 121 ASP ASP A . n A 1 124 GLU 124 122 122 GLU GLU A . n A 1 125 ASP 125 123 123 ASP ASP A . n A 1 126 PHE 126 124 124 PHE PHE A . n A 1 127 ARG 127 125 125 ARG ARG A . n A 1 128 LYS 128 126 126 LYS LYS A . n A 1 129 TYR 129 127 127 TYR TYR A . n A 1 130 THR 130 128 128 THR THR A . n A 1 131 ALA 131 129 129 ALA ALA A . n A 1 132 PHE 132 130 130 PHE PHE A . n A 1 133 THR 133 131 131 THR THR A . n A 1 134 ILE 134 132 132 ILE ILE A . n A 1 135 PRO 135 133 133 PRO PRO A . n A 1 136 SER 136 134 134 SER SER A . n A 1 137 ILE 137 135 135 ILE ILE A . n A 1 138 ASN 138 136 136 ASN ASN A . n A 1 139 ASN 139 137 137 ASN ASN A . n A 1 140 GLU 140 138 138 GLU GLU A . n A 1 141 THR 141 139 139 THR THR A . n A 1 142 PRO 142 140 140 PRO PRO A . n A 1 143 GLY 143 141 141 GLY GLY A . n A 1 144 ILE 144 142 142 ILE ILE A . n A 1 145 ARG 145 143 143 ARG ARG A . n A 1 146 TYR 146 144 144 TYR TYR A . n A 1 147 GLN 147 145 145 GLN GLN A . n A 1 148 TYR 148 146 146 TYR TYR A . n A 1 149 ASN 149 147 147 ASN ASN A . n A 1 150 VAL 150 148 148 VAL VAL A . n A 1 151 LEU 151 149 149 LEU LEU A . n A 1 152 PRO 152 150 150 PRO PRO A . n A 1 153 GLN 153 151 151 GLN GLN A . n A 1 154 GLY 154 152 152 GLY GLY A . n A 1 155 TRP 155 153 153 TRP TRP A . n A 1 156 LYS 156 154 154 LYS LYS A . n A 1 157 GLY 157 155 155 GLY GLY A . n A 1 158 SER 158 156 156 SER SER A . n A 1 159 PRO 159 157 157 PRO PRO A . n A 1 160 ALA 160 158 158 ALA ALA A . n A 1 161 ILE 161 159 159 ILE ILE A . n A 1 162 PHE 162 160 160 PHE PHE A . n A 1 163 GLN 163 161 161 GLN GLN A . n A 1 164 SER 164 162 162 SER SER A . n A 1 165 SER 165 163 163 SER SER A . n A 1 166 MET 166 164 164 MET MET A . n A 1 167 THR 167 165 165 THR THR A . n A 1 168 LYS 168 166 166 LYS LYS A . n A 1 169 ILE 169 167 167 ILE ILE A . n A 1 170 LEU 170 168 168 LEU LEU A . n A 1 171 GLU 171 169 169 GLU GLU A . n A 1 172 PRO 172 170 170 PRO PRO A . n A 1 173 PHE 173 171 171 PHE PHE A . n A 1 174 LYS 174 172 172 LYS LYS A . n A 1 175 LYS 175 173 173 LYS LYS A . n A 1 176 GLN 176 174 174 GLN GLN A . n A 1 177 ASN 177 175 175 ASN ASN A . n A 1 178 PRO 178 176 176 PRO PRO A . n A 1 179 ASP 179 177 177 ASP ASP A . n A 1 180 ILE 180 178 178 ILE ILE A . n A 1 181 VAL 181 179 179 VAL VAL A . n A 1 182 ILE 182 180 180 ILE ILE A . n A 1 183 TYR 183 181 181 TYR TYR A . n A 1 184 GLN 184 182 182 GLN GLN A . n A 1 185 TYR 185 183 183 TYR TYR A . n A 1 186 MET 186 184 184 MET MET A . n A 1 187 ASP 187 185 185 ASP ASP A . n A 1 188 ASP 188 186 186 ASP ASP A . n A 1 189 LEU 189 187 187 LEU LEU A . n A 1 190 TYR 190 188 188 TYR TYR A . n A 1 191 VAL 191 189 189 VAL VAL A . n A 1 192 GLY 192 190 190 GLY GLY A . n A 1 193 SER 193 191 191 SER SER A . n A 1 194 ASP 194 192 192 ASP ASP A . n A 1 195 LEU 195 193 193 LEU LEU A . n A 1 196 GLU 196 194 194 GLU GLU A . n A 1 197 ILE 197 195 195 ILE ILE A . n A 1 198 GLY 198 196 196 GLY GLY A . n A 1 199 GLN 199 197 197 GLN GLN A . n A 1 200 HIS 200 198 198 HIS HIS A . n A 1 201 ARG 201 199 199 ARG ARG A . n A 1 202 THR 202 200 200 THR THR A . n A 1 203 LYS 203 201 201 LYS LYS A . n A 1 204 ILE 204 202 202 ILE ILE A . n A 1 205 GLU 205 203 203 GLU GLU A . n A 1 206 GLU 206 204 204 GLU GLU A . n A 1 207 LEU 207 205 205 LEU LEU A . n A 1 208 ARG 208 206 206 ARG ARG A . n A 1 209 GLN 209 207 207 GLN GLN A . n A 1 210 HIS 210 208 208 HIS HIS A . n A 1 211 LEU 211 209 209 LEU LEU A . n A 1 212 LEU 212 210 210 LEU LEU A . n A 1 213 ARG 213 211 211 ARG ARG A . n A 1 214 TRP 214 212 212 TRP TRP A . n A 1 215 GLY 215 213 213 GLY GLY A . n A 1 216 LEU 216 214 214 LEU LEU A . n A 1 217 THR 217 215 215 THR THR A . n A 1 218 THR 218 216 216 THR THR A . n A 1 219 PRO 219 217 217 PRO PRO A . n A 1 220 ASP 220 218 218 ASP ASP A . n A 1 221 LYS 221 219 219 LYS LYS A . n A 1 222 LYS 222 220 220 LYS LYS A . n A 1 223 HIS 223 221 221 HIS HIS A . n A 1 224 GLN 224 222 222 GLN GLN A . n A 1 225 LYS 225 223 223 LYS LYS A . n A 1 226 GLU 226 224 224 GLU GLU A . n A 1 227 PRO 227 225 225 PRO PRO A . n A 1 228 PRO 228 226 226 PRO PRO A . n A 1 229 PHE 229 227 227 PHE PHE A . n A 1 230 LEU 230 228 228 LEU LEU A . n A 1 231 TRP 231 229 229 TRP TRP A . n A 1 232 MET 232 230 230 MET MET A . n A 1 233 GLY 233 231 231 GLY GLY A . n A 1 234 TYR 234 232 232 TYR TYR A . n A 1 235 GLU 235 233 233 GLU GLU A . n A 1 236 LEU 236 234 234 LEU LEU A . n A 1 237 HIS 237 235 235 HIS HIS A . n A 1 238 PRO 238 236 236 PRO PRO A . n A 1 239 ASP 239 237 237 ASP ASP A . n A 1 240 LYS 240 238 238 LYS LYS A . n A 1 241 TRP 241 239 239 TRP TRP A . n A 1 242 THR 242 240 240 THR THR A . n A 1 243 VAL 243 241 241 VAL VAL A . n A 1 244 GLN 244 242 242 GLN GLN A . n A 1 245 PRO 245 243 243 PRO PRO A . n A 1 246 ILE 246 244 244 ILE ILE A . n A 1 247 VAL 247 245 245 VAL VAL A . n A 1 248 LEU 248 246 246 LEU LEU A . n A 1 249 PRO 249 247 247 PRO PRO A . n A 1 250 GLU 250 248 248 GLU GLU A . n A 1 251 LYS 251 249 249 LYS LYS A . n A 1 252 ASP 252 250 250 ASP ASP A . n A 1 253 SER 253 251 251 SER SER A . n A 1 254 TRP 254 252 252 TRP TRP A . n A 1 255 THR 255 253 253 THR THR A . n A 1 256 VAL 256 254 254 VAL VAL A . n A 1 257 ASN 257 255 255 ASN ASN A . n A 1 258 ASP 258 256 256 ASP ASP A . n A 1 259 ILE 259 257 257 ILE ILE A . n A 1 260 GLN 260 258 258 GLN GLN A . n A 1 261 LYS 261 259 259 LYS LYS A . n A 1 262 LEU 262 260 260 LEU LEU A . n A 1 263 VAL 263 261 261 VAL VAL A . n A 1 264 GLY 264 262 262 GLY GLY A . n A 1 265 LYS 265 263 263 LYS LYS A . n A 1 266 LEU 266 264 264 LEU LEU A . n A 1 267 ASN 267 265 265 ASN ASN A . n A 1 268 TRP 268 266 266 TRP TRP A . n A 1 269 ALA 269 267 267 ALA ALA A . n A 1 270 SER 270 268 268 SER SER A . n A 1 271 GLN 271 269 269 GLN GLN A . n A 1 272 ILE 272 270 270 ILE ILE A . n A 1 273 TYR 273 271 271 TYR TYR A . n A 1 274 PRO 274 272 272 PRO PRO A . n A 1 275 GLY 275 273 273 GLY GLY A . n A 1 276 ILE 276 274 274 ILE ILE A . n A 1 277 LYS 277 275 275 LYS LYS A . n A 1 278 VAL 278 276 276 VAL VAL A . n A 1 279 ARG 279 277 277 ARG ARG A . n A 1 280 GLN 280 278 278 GLN GLN A . n A 1 281 LEU 281 279 279 LEU LEU A . n A 1 282 SER 282 280 280 SER SER A . n A 1 283 LYS 283 281 281 LYS LYS A . n A 1 284 LEU 284 282 282 LEU LEU A . n A 1 285 LEU 285 283 283 LEU LEU A . n A 1 286 ARG 286 284 284 ARG ARG A . n A 1 287 GLY 287 285 285 GLY GLY A . n A 1 288 THR 288 286 286 THR THR A . n A 1 289 LYS 289 287 287 LYS LYS A . n A 1 290 ALA 290 288 288 ALA ALA A . n A 1 291 LEU 291 289 289 LEU LEU A . n A 1 292 THR 292 290 290 THR THR A . n A 1 293 GLU 293 291 291 GLU GLU A . n A 1 294 VAL 294 292 292 VAL VAL A . n A 1 295 ILE 295 293 293 ILE ILE A . n A 1 296 PRO 296 294 294 PRO PRO A . n A 1 297 LEU 297 295 295 LEU LEU A . n A 1 298 THR 298 296 296 THR THR A . n A 1 299 GLU 299 297 297 GLU GLU A . n A 1 300 GLU 300 298 298 GLU GLU A . n A 1 301 ALA 301 299 299 ALA ALA A . n A 1 302 GLU 302 300 300 GLU GLU A . n A 1 303 LEU 303 301 301 LEU LEU A . n A 1 304 GLU 304 302 302 GLU GLU A . n A 1 305 LEU 305 303 303 LEU LEU A . n A 1 306 ALA 306 304 304 ALA ALA A . n A 1 307 GLU 307 305 305 GLU GLU A . n A 1 308 ASN 308 306 306 ASN ASN A . n A 1 309 ARG 309 307 307 ARG ARG A . n A 1 310 GLU 310 308 308 GLU GLU A . n A 1 311 ILE 311 309 309 ILE ILE A . n A 1 312 LEU 312 310 310 LEU LEU A . n A 1 313 LYS 313 311 311 LYS LYS A . n A 1 314 GLU 314 312 312 GLU GLU A . n A 1 315 PRO 315 313 313 PRO PRO A . n A 1 316 VAL 316 314 314 VAL VAL A . n A 1 317 HIS 317 315 315 HIS HIS A . n A 1 318 GLY 318 316 316 GLY GLY A . n A 1 319 VAL 319 317 317 VAL VAL A . n A 1 320 TYR 320 318 318 TYR TYR A . n A 1 321 TYR 321 319 319 TYR TYR A . n A 1 322 ASP 322 320 320 ASP ASP A . n A 1 323 PRO 323 321 321 PRO PRO A . n A 1 324 SER 324 322 322 SER SER A . n A 1 325 LYS 325 323 323 LYS LYS A . n A 1 326 ASP 326 324 324 ASP ASP A . n A 1 327 LEU 327 325 325 LEU LEU A . n A 1 328 ILE 328 326 326 ILE ILE A . n A 1 329 ALA 329 327 327 ALA ALA A . n A 1 330 GLU 330 328 328 GLU GLU A . n A 1 331 ILE 331 329 329 ILE ILE A . n A 1 332 GLN 332 330 330 GLN GLN A . n A 1 333 LYS 333 331 331 LYS LYS A . n A 1 334 GLN 334 332 332 GLN GLN A . n A 1 335 GLY 335 333 333 GLY GLY A . n A 1 336 GLN 336 334 334 GLN GLN A . n A 1 337 GLY 337 335 335 GLY GLY A . n A 1 338 GLN 338 336 336 GLN GLN A . n A 1 339 TRP 339 337 337 TRP TRP A . n A 1 340 THR 340 338 338 THR THR A . n A 1 341 TYR 341 339 339 TYR TYR A . n A 1 342 GLN 342 340 340 GLN GLN A . n A 1 343 ILE 343 341 341 ILE ILE A . n A 1 344 TYR 344 342 342 TYR TYR A . n A 1 345 GLN 345 343 343 GLN GLN A . n A 1 346 GLU 346 344 344 GLU GLU A . n A 1 347 PRO 347 345 345 PRO PRO A . n A 1 348 PHE 348 346 346 PHE PHE A . n A 1 349 LYS 349 347 347 LYS LYS A . n A 1 350 ASN 350 348 348 ASN ASN A . n A 1 351 LEU 351 349 349 LEU LEU A . n A 1 352 LYS 352 350 350 LYS LYS A . n A 1 353 THR 353 351 351 THR THR A . n A 1 354 GLY 354 352 352 GLY GLY A . n A 1 355 LYS 355 353 353 LYS LYS A . n A 1 356 TYR 356 354 354 TYR TYR A . n A 1 357 ALA 357 355 355 ALA ALA A . n A 1 358 ARG 358 356 356 ARG ARG A . n A 1 359 MET 359 357 357 MET MET A . n A 1 360 ARG 360 358 358 ARG ARG A . n A 1 361 GLY 361 359 359 GLY GLY A . n A 1 362 ALA 362 360 360 ALA ALA A . n A 1 363 HIS 363 361 361 HIS HIS A . n A 1 364 THR 364 362 362 THR THR A . n A 1 365 ASN 365 363 363 ASN ASN A . n A 1 366 ASP 366 364 364 ASP ASP A . n A 1 367 VAL 367 365 365 VAL VAL A . n A 1 368 LYS 368 366 366 LYS LYS A . n A 1 369 GLN 369 367 367 GLN GLN A . n A 1 370 LEU 370 368 368 LEU LEU A . n A 1 371 THR 371 369 369 THR THR A . n A 1 372 GLU 372 370 370 GLU GLU A . n A 1 373 ALA 373 371 371 ALA ALA A . n A 1 374 VAL 374 372 372 VAL VAL A . n A 1 375 GLN 375 373 373 GLN GLN A . n A 1 376 LYS 376 374 374 LYS LYS A . n A 1 377 ILE 377 375 375 ILE ILE A . n A 1 378 THR 378 376 376 THR THR A . n A 1 379 THR 379 377 377 THR THR A . n A 1 380 GLU 380 378 378 GLU GLU A . n A 1 381 SER 381 379 379 SER SER A . n A 1 382 ILE 382 380 380 ILE ILE A . n A 1 383 VAL 383 381 381 VAL VAL A . n A 1 384 ILE 384 382 382 ILE ILE A . n A 1 385 TRP 385 383 383 TRP TRP A . n A 1 386 GLY 386 384 384 GLY GLY A . n A 1 387 LYS 387 385 385 LYS LYS A . n A 1 388 THR 388 386 386 THR THR A . n A 1 389 PRO 389 387 387 PRO PRO A . n A 1 390 LYS 390 388 388 LYS LYS A . n A 1 391 PHE 391 389 389 PHE PHE A . n A 1 392 LYS 392 390 390 LYS LYS A . n A 1 393 LEU 393 391 391 LEU LEU A . n A 1 394 PRO 394 392 392 PRO PRO A . n A 1 395 ILE 395 393 393 ILE ILE A . n A 1 396 GLN 396 394 394 GLN GLN A . n A 1 397 LYS 397 395 395 LYS LYS A . n A 1 398 GLU 398 396 396 GLU GLU A . n A 1 399 THR 399 397 397 THR THR A . n A 1 400 TRP 400 398 398 TRP TRP A . n A 1 401 GLU 401 399 399 GLU GLU A . n A 1 402 THR 402 400 400 THR THR A . n A 1 403 TRP 403 401 401 TRP TRP A . n A 1 404 TRP 404 402 402 TRP TRP A . n A 1 405 THR 405 403 403 THR THR A . n A 1 406 GLU 406 404 404 GLU GLU A . n A 1 407 TYR 407 405 405 TYR TYR A . n A 1 408 TRP 408 406 406 TRP TRP A . n A 1 409 GLN 409 407 407 GLN GLN A . n A 1 410 ALA 410 408 408 ALA ALA A . n A 1 411 THR 411 409 409 THR THR A . n A 1 412 TRP 412 410 410 TRP TRP A . n A 1 413 ILE 413 411 411 ILE ILE A . n A 1 414 PRO 414 412 412 PRO PRO A . n A 1 415 GLU 415 413 413 GLU GLU A . n A 1 416 TRP 416 414 414 TRP TRP A . n A 1 417 GLU 417 415 415 GLU GLU A . n A 1 418 PHE 418 416 416 PHE PHE A . n A 1 419 VAL 419 417 417 VAL VAL A . n A 1 420 ASN 420 418 418 ASN ASN A . n A 1 421 THR 421 419 419 THR THR A . n A 1 422 PRO 422 420 420 PRO PRO A . n A 1 423 PRO 423 421 421 PRO PRO A . n A 1 424 LEU 424 422 422 LEU LEU A . n A 1 425 VAL 425 423 423 VAL VAL A . n A 1 426 LYS 426 424 424 LYS LYS A . n A 1 427 LEU 427 425 425 LEU LEU A . n A 1 428 TRP 428 426 426 TRP TRP A . n A 1 429 TYR 429 427 427 TYR TYR A . n A 1 430 GLN 430 428 428 GLN GLN A . n A 1 431 LEU 431 429 429 LEU LEU A . n A 1 432 GLU 432 430 430 GLU GLU A . n A 1 433 LYS 433 431 431 LYS LYS A . n A 1 434 GLU 434 432 432 GLU GLU A . n A 1 435 PRO 435 433 433 PRO PRO A . n A 1 436 ILE 436 434 434 ILE ILE A . n A 1 437 VAL 437 435 435 VAL VAL A . n A 1 438 GLY 438 436 436 GLY GLY A . n A 1 439 ALA 439 437 437 ALA ALA A . n A 1 440 GLU 440 438 438 GLU GLU A . n A 1 441 THR 441 439 439 THR THR A . n A 1 442 PHE 442 440 440 PHE PHE A . n A 1 443 TYR 443 441 441 TYR TYR A . n A 1 444 VAL 444 442 442 VAL VAL A . n A 1 445 ASP 445 443 443 ASP ASP A . n A 1 446 GLY 446 444 444 GLY GLY A . n A 1 447 ALA 447 445 445 ALA ALA A . n A 1 448 ALA 448 446 446 ALA ALA A . n A 1 449 ASN 449 447 447 ASN ASN A . n A 1 450 ARG 450 448 448 ARG ARG A . n A 1 451 GLU 451 449 449 GLU GLU A . n A 1 452 THR 452 450 450 THR THR A . n A 1 453 LYS 453 451 451 LYS LYS A . n A 1 454 LEU 454 452 452 LEU LEU A . n A 1 455 GLY 455 453 453 GLY GLY A . n A 1 456 LYS 456 454 454 LYS LYS A . n A 1 457 ALA 457 455 455 ALA ALA A . n A 1 458 GLY 458 456 456 GLY GLY A . n A 1 459 TYR 459 457 457 TYR TYR A . n A 1 460 VAL 460 458 458 VAL VAL A . n A 1 461 THR 461 459 459 THR THR A . n A 1 462 ASN 462 460 460 ASN ASN A . n A 1 463 LYS 463 461 461 LYS LYS A . n A 1 464 GLY 464 462 462 GLY GLY A . n A 1 465 ARG 465 463 463 ARG ARG A . n A 1 466 GLN 466 464 464 GLN GLN A . n A 1 467 LYS 467 465 465 LYS LYS A . n A 1 468 VAL 468 466 466 VAL VAL A . n A 1 469 VAL 469 467 467 VAL VAL A . n A 1 470 PRO 470 468 468 PRO PRO A . n A 1 471 LEU 471 469 469 LEU LEU A . n A 1 472 THR 472 470 470 THR THR A . n A 1 473 ASN 473 471 471 ASN ASN A . n A 1 474 THR 474 472 472 THR THR A . n A 1 475 THR 475 473 473 THR THR A . n A 1 476 ASN 476 474 474 ASN ASN A . n A 1 477 GLN 477 475 475 GLN GLN A . n A 1 478 LYS 478 476 476 LYS LYS A . n A 1 479 THR 479 477 477 THR THR A . n A 1 480 GLU 480 478 478 GLU GLU A . n A 1 481 LEU 481 479 479 LEU LEU A . n A 1 482 GLN 482 480 480 GLN GLN A . n A 1 483 ALA 483 481 481 ALA ALA A . n A 1 484 ILE 484 482 482 ILE ILE A . n A 1 485 TYR 485 483 483 TYR TYR A . n A 1 486 LEU 486 484 484 LEU LEU A . n A 1 487 ALA 487 485 485 ALA ALA A . n A 1 488 LEU 488 486 486 LEU LEU A . n A 1 489 GLN 489 487 487 GLN GLN A . n A 1 490 ASP 490 488 488 ASP ASP A . n A 1 491 SER 491 489 489 SER SER A . n A 1 492 GLY 492 490 490 GLY GLY A . n A 1 493 LEU 493 491 491 LEU LEU A . n A 1 494 GLU 494 492 492 GLU GLU A . n A 1 495 VAL 495 493 493 VAL VAL A . n A 1 496 ASN 496 494 494 ASN ASN A . n A 1 497 ILE 497 495 495 ILE ILE A . n A 1 498 VAL 498 496 496 VAL VAL A . n A 1 499 THR 499 497 497 THR THR A . n A 1 500 ASP 500 498 498 ASP ASP A . n A 1 501 SER 501 499 499 SER SER A . n A 1 502 GLN 502 500 500 GLN GLN A . n A 1 503 TYR 503 501 501 TYR TYR A . n A 1 504 ALA 504 502 502 ALA ALA A . n A 1 505 LEU 505 503 503 LEU LEU A . n A 1 506 GLY 506 504 504 GLY GLY A . n A 1 507 ILE 507 505 505 ILE ILE A . n A 1 508 ILE 508 506 506 ILE ILE A . n A 1 509 GLN 509 507 507 GLN GLN A . n A 1 510 ALA 510 508 508 ALA ALA A . n A 1 511 GLN 511 509 509 GLN GLN A . n A 1 512 PRO 512 510 510 PRO PRO A . n A 1 513 ASP 513 511 511 ASP ASP A . n A 1 514 LYS 514 512 512 LYS LYS A . n A 1 515 SER 515 513 513 SER SER A . n A 1 516 GLU 516 514 514 GLU GLU A . n A 1 517 SER 517 515 515 SER SER A . n A 1 518 GLU 518 516 516 GLU GLU A . n A 1 519 LEU 519 517 517 LEU LEU A . n A 1 520 VAL 520 518 518 VAL VAL A . n A 1 521 ASN 521 519 519 ASN ASN A . n A 1 522 GLN 522 520 520 GLN GLN A . n A 1 523 ILE 523 521 521 ILE ILE A . n A 1 524 ILE 524 522 522 ILE ILE A . n A 1 525 GLU 525 523 523 GLU GLU A . n A 1 526 GLN 526 524 524 GLN GLN A . n A 1 527 LEU 527 525 525 LEU LEU A . n A 1 528 ILE 528 526 526 ILE ILE A . n A 1 529 LYS 529 527 527 LYS LYS A . n A 1 530 LYS 530 528 528 LYS LYS A . n A 1 531 GLU 531 529 529 GLU GLU A . n A 1 532 LYS 532 530 530 LYS LYS A . n A 1 533 VAL 533 531 531 VAL VAL A . n A 1 534 TYR 534 532 532 TYR TYR A . n A 1 535 LEU 535 533 533 LEU LEU A . n A 1 536 ALA 536 534 534 ALA ALA A . n A 1 537 TRP 537 535 535 TRP TRP A . n A 1 538 VAL 538 536 536 VAL VAL A . n A 1 539 PRO 539 537 537 PRO PRO A . n A 1 540 ALA 540 538 538 ALA ALA A . n A 1 541 HIS 541 539 539 HIS HIS A . n A 1 542 LYS 542 540 540 LYS LYS A . n A 1 543 GLY 543 541 541 GLY GLY A . n A 1 544 ILE 544 542 542 ILE ILE A . n A 1 545 GLY 545 543 543 GLY GLY A . n A 1 546 GLY 546 544 544 GLY GLY A . n A 1 547 ASN 547 545 545 ASN ASN A . n A 1 548 GLU 548 546 546 GLU GLU A . n A 1 549 GLN 549 547 547 GLN GLN A . n A 1 550 VAL 550 548 548 VAL VAL A . n A 1 551 ASP 551 549 549 ASP ASP A . n A 1 552 LYS 552 550 550 LYS LYS A . n A 1 553 LEU 553 551 551 LEU LEU A . n A 1 554 VAL 554 552 552 VAL VAL A . n A 1 555 SER 555 553 553 SER SER A . n A 1 556 ALA 556 554 554 ALA ALA A . n A 1 557 GLY 557 555 555 GLY GLY A . n B 2 1 GLY 1 0 0 GLY GLY B . n B 2 2 PRO 2 1 1 PRO PRO B . n B 2 3 ILE 3 2 2 ILE ILE B . n B 2 4 SER 4 3 3 SER SER B . n B 2 5 PRO 5 4 4 PRO PRO B . n B 2 6 ILE 6 5 5 ILE ILE B . n B 2 7 GLU 7 6 6 GLU GLU B . n B 2 8 THR 8 7 7 THR THR B . n B 2 9 VAL 9 8 8 VAL VAL B . n B 2 10 PRO 10 9 9 PRO PRO B . n B 2 11 VAL 11 10 10 VAL VAL B . n B 2 12 LYS 12 11 11 LYS LYS B . n B 2 13 LEU 13 12 12 LEU LEU B . n B 2 14 LYS 14 13 13 LYS LYS B . n B 2 15 PRO 15 14 14 PRO PRO B . n B 2 16 GLY 16 15 15 GLY GLY B . n B 2 17 MET 17 16 16 MET MET B . n B 2 18 ASP 18 17 17 ASP ASP B . n B 2 19 GLY 19 18 18 GLY GLY B . n B 2 20 PRO 20 19 19 PRO PRO B . n B 2 21 LYS 21 20 20 LYS LYS B . n B 2 22 VAL 22 21 21 VAL VAL B . n B 2 23 LYS 23 22 22 LYS LYS B . n B 2 24 GLN 24 23 23 GLN GLN B . n B 2 25 TRP 25 24 24 TRP TRP B . n B 2 26 PRO 26 25 25 PRO PRO B . n B 2 27 LEU 27 26 26 LEU LEU B . n B 2 28 THR 28 27 27 THR THR B . n B 2 29 GLU 29 28 28 GLU GLU B . n B 2 30 GLU 30 29 29 GLU GLU B . n B 2 31 LYS 31 30 30 LYS LYS B . n B 2 32 ILE 32 31 31 ILE ILE B . n B 2 33 LYS 33 32 32 LYS LYS B . n B 2 34 ALA 34 33 33 ALA ALA B . n B 2 35 LEU 35 34 34 LEU LEU B . n B 2 36 VAL 36 35 35 VAL VAL B . n B 2 37 GLU 37 36 36 GLU GLU B . n B 2 38 ILE 38 37 37 ILE ILE B . n B 2 39 CYS 39 38 38 CYS CYS B . n B 2 40 THR 40 39 39 THR THR B . n B 2 41 GLU 41 40 40 GLU GLU B . n B 2 42 MET 42 41 41 MET MET B . n B 2 43 GLU 43 42 42 GLU GLU B . n B 2 44 LYS 44 43 43 LYS LYS B . n B 2 45 GLU 45 44 44 GLU GLU B . n B 2 46 GLY 46 45 45 GLY GLY B . n B 2 47 LYS 47 46 46 LYS LYS B . n B 2 48 ILE 48 47 47 ILE ILE B . n B 2 49 SER 49 48 48 SER SER B . n B 2 50 LYS 50 49 49 LYS LYS B . n B 2 51 ILE 51 50 50 ILE ILE B . n B 2 52 GLY 52 51 51 GLY GLY B . n B 2 53 PRO 53 52 52 PRO PRO B . n B 2 54 GLU 54 53 53 GLU GLU B . n B 2 55 ASN 55 54 54 ASN ASN B . n B 2 56 PRO 56 55 55 PRO PRO B . n B 2 57 TYR 57 56 56 TYR TYR B . n B 2 58 ASN 58 57 57 ASN ASN B . n B 2 59 THR 59 58 58 THR THR B . n B 2 60 PRO 60 59 59 PRO PRO B . n B 2 61 VAL 61 60 60 VAL VAL B . n B 2 62 PHE 62 61 61 PHE PHE B . n B 2 63 ALA 63 62 62 ALA ALA B . n B 2 64 ILE 64 63 63 ILE ILE B . n B 2 65 LYS 65 64 64 LYS LYS B . n B 2 66 LYS 66 65 65 LYS LYS B . n B 2 67 LYS 67 66 66 LYS LYS B . n B 2 68 ASP 68 67 67 ASP ASP B . n B 2 69 SER 69 68 68 SER SER B . n B 2 70 THR 70 69 69 THR THR B . n B 2 71 LYS 71 70 70 LYS LYS B . n B 2 72 TRP 72 71 71 TRP TRP B . n B 2 73 ARG 73 72 72 ARG ARG B . n B 2 74 LYS 74 73 73 LYS LYS B . n B 2 75 LEU 75 74 74 LEU LEU B . n B 2 76 VAL 76 75 75 VAL VAL B . n B 2 77 ASP 77 76 76 ASP ASP B . n B 2 78 PHE 78 77 77 PHE PHE B . n B 2 79 ARG 79 78 78 ARG ARG B . n B 2 80 GLU 80 79 79 GLU GLU B . n B 2 81 LEU 81 80 80 LEU LEU B . n B 2 82 ASN 82 81 81 ASN ASN B . n B 2 83 LYS 83 82 82 LYS LYS B . n B 2 84 ARG 84 83 83 ARG ARG B . n B 2 85 THR 85 84 84 THR THR B . n B 2 86 GLN 86 85 85 GLN GLN B . n B 2 87 ASP 87 86 86 ASP ASP B . n B 2 88 PHE 88 87 87 PHE PHE B . n B 2 89 TRP 89 88 88 TRP TRP B . n B 2 90 GLU 90 89 89 GLU GLU B . n B 2 91 VAL 91 90 90 VAL VAL B . n B 2 92 GLN 92 91 91 GLN GLN B . n B 2 93 LEU 93 92 92 LEU LEU B . n B 2 94 GLY 94 93 93 GLY GLY B . n B 2 95 ILE 95 94 94 ILE ILE B . n B 2 96 PRO 96 95 95 PRO PRO B . n B 2 97 HIS 97 96 96 HIS HIS B . n B 2 98 PRO 98 97 97 PRO PRO B . n B 2 99 ALA 99 98 98 ALA ALA B . n B 2 100 GLY 100 99 99 GLY GLY B . n B 2 101 LEU 101 100 100 LEU LEU B . n B 2 102 LYS 102 101 101 LYS LYS B . n B 2 103 LYS 103 102 102 LYS LYS B . n B 2 104 LYS 104 103 103 LYS LYS B . n B 2 105 LYS 105 104 104 LYS LYS B . n B 2 106 SER 106 105 105 SER SER B . n B 2 107 VAL 107 106 106 VAL VAL B . n B 2 108 THR 108 107 107 THR THR B . n B 2 109 VAL 109 108 108 VAL VAL B . n B 2 110 LEU 110 109 109 LEU LEU B . n B 2 111 ASP 111 110 110 ASP ASP B . n B 2 112 VAL 112 111 111 VAL VAL B . n B 2 113 GLY 113 112 112 GLY GLY B . n B 2 114 ASP 114 113 113 ASP ASP B . n B 2 115 ALA 115 114 114 ALA ALA B . n B 2 116 TYR 116 115 115 TYR TYR B . n B 2 117 PHE 117 116 116 PHE PHE B . n B 2 118 SER 118 117 117 SER SER B . n B 2 119 VAL 119 118 118 VAL VAL B . n B 2 120 PRO 120 119 119 PRO PRO B . n B 2 121 LEU 121 120 120 LEU LEU B . n B 2 122 ASP 122 121 121 ASP ASP B . n B 2 123 GLU 123 122 122 GLU GLU B . n B 2 124 ASP 124 123 123 ASP ASP B . n B 2 125 PHE 125 124 124 PHE PHE B . n B 2 126 ARG 126 125 125 ARG ARG B . n B 2 127 LYS 127 126 126 LYS LYS B . n B 2 128 TYR 128 127 127 TYR TYR B . n B 2 129 THR 129 128 128 THR THR B . n B 2 130 ALA 130 129 129 ALA ALA B . n B 2 131 PHE 131 130 130 PHE PHE B . n B 2 132 THR 132 131 131 THR THR B . n B 2 133 ILE 133 132 132 ILE ILE B . n B 2 134 PRO 134 133 133 PRO PRO B . n B 2 135 SER 135 134 134 SER SER B . n B 2 136 ILE 136 135 135 ILE ILE B . n B 2 137 ASN 137 136 136 ASN ASN B . n B 2 138 ASN 138 137 137 ASN ASN B . n B 2 139 GLU 139 138 138 GLU GLU B . n B 2 140 THR 140 139 139 THR THR B . n B 2 141 PRO 141 140 140 PRO PRO B . n B 2 142 GLY 142 141 141 GLY GLY B . n B 2 143 ILE 143 142 142 ILE ILE B . n B 2 144 ARG 144 143 143 ARG ARG B . n B 2 145 TYR 145 144 144 TYR TYR B . n B 2 146 GLN 146 145 145 GLN GLN B . n B 2 147 TYR 147 146 146 TYR TYR B . n B 2 148 ASN 148 147 147 ASN ASN B . n B 2 149 VAL 149 148 148 VAL VAL B . n B 2 150 LEU 150 149 149 LEU LEU B . n B 2 151 PRO 151 150 150 PRO PRO B . n B 2 152 GLN 152 151 151 GLN GLN B . n B 2 153 GLY 153 152 152 GLY GLY B . n B 2 154 TRP 154 153 153 TRP TRP B . n B 2 155 LYS 155 154 154 LYS LYS B . n B 2 156 GLY 156 155 155 GLY GLY B . n B 2 157 SER 157 156 156 SER SER B . n B 2 158 PRO 158 157 157 PRO PRO B . n B 2 159 ALA 159 158 158 ALA ALA B . n B 2 160 ILE 160 159 159 ILE ILE B . n B 2 161 PHE 161 160 160 PHE PHE B . n B 2 162 GLN 162 161 161 GLN GLN B . n B 2 163 SER 163 162 162 SER SER B . n B 2 164 SER 164 163 163 SER SER B . n B 2 165 MET 165 164 164 MET MET B . n B 2 166 THR 166 165 165 THR THR B . n B 2 167 LYS 167 166 166 LYS LYS B . n B 2 168 ILE 168 167 167 ILE ILE B . n B 2 169 LEU 169 168 168 LEU LEU B . n B 2 170 GLU 170 169 169 GLU GLU B . n B 2 171 PRO 171 170 170 PRO PRO B . n B 2 172 PHE 172 171 171 PHE PHE B . n B 2 173 LYS 173 172 172 LYS LYS B . n B 2 174 LYS 174 173 173 LYS LYS B . n B 2 175 GLN 175 174 174 GLN GLN B . n B 2 176 ASN 176 175 175 ASN ASN B . n B 2 177 PRO 177 176 176 PRO PRO B . n B 2 178 ASP 178 177 177 ASP ASP B . n B 2 179 ILE 179 178 178 ILE ILE B . n B 2 180 VAL 180 179 179 VAL VAL B . n B 2 181 ILE 181 180 180 ILE ILE B . n B 2 182 TYR 182 181 181 TYR TYR B . n B 2 183 GLN 183 182 182 GLN GLN B . n B 2 184 TYR 184 183 183 TYR TYR B . n B 2 185 MET 185 184 184 MET MET B . n B 2 186 ASP 186 185 185 ASP ASP B . n B 2 187 ASP 187 186 186 ASP ASP B . n B 2 188 LEU 188 187 187 LEU LEU B . n B 2 189 TYR 189 188 188 TYR TYR B . n B 2 190 VAL 190 189 189 VAL VAL B . n B 2 191 GLY 191 190 190 GLY GLY B . n B 2 192 SER 192 191 191 SER SER B . n B 2 193 ASP 193 192 192 ASP ASP B . n B 2 194 LEU 194 193 193 LEU LEU B . n B 2 195 GLU 195 194 194 GLU GLU B . n B 2 196 ILE 196 195 195 ILE ILE B . n B 2 197 GLY 197 196 196 GLY GLY B . n B 2 198 GLN 198 197 197 GLN GLN B . n B 2 199 HIS 199 198 198 HIS HIS B . n B 2 200 ARG 200 199 199 ARG ARG B . n B 2 201 THR 201 200 200 THR THR B . n B 2 202 LYS 202 201 201 LYS LYS B . n B 2 203 ILE 203 202 202 ILE ILE B . n B 2 204 GLU 204 203 203 GLU GLU B . n B 2 205 GLU 205 204 204 GLU GLU B . n B 2 206 LEU 206 205 205 LEU LEU B . n B 2 207 ARG 207 206 206 ARG ARG B . n B 2 208 GLN 208 207 207 GLN GLN B . n B 2 209 HIS 209 208 208 HIS HIS B . n B 2 210 LEU 210 209 209 LEU LEU B . n B 2 211 LEU 211 210 210 LEU LEU B . n B 2 212 ARG 212 211 211 ARG ARG B . n B 2 213 TRP 213 212 212 TRP TRP B . n B 2 214 GLY 214 213 213 GLY GLY B . n B 2 215 LEU 215 214 214 LEU LEU B . n B 2 216 THR 216 215 215 THR THR B . n B 2 217 THR 217 216 216 THR THR B . n B 2 218 PRO 218 217 217 PRO PRO B . n B 2 219 ASP 219 218 218 ASP ASP B . n B 2 220 LYS 220 218 ? ? ? B A n B 2 221 LYS 221 218 ? ? ? B B n B 2 222 HIS 222 218 ? ? ? B C n B 2 223 GLN 223 218 ? ? ? B D n B 2 224 LYS 224 219 219 LYS LYS B . n B 2 225 GLU 225 224 224 GLU GLU B . n B 2 226 PRO 226 225 225 PRO PRO B . n B 2 227 PRO 227 226 226 PRO PRO B . n B 2 228 PHE 228 227 227 PHE PHE B . n B 2 229 LEU 229 228 228 LEU LEU B . n B 2 230 TRP 230 229 229 TRP TRP B . n B 2 231 MET 231 230 230 MET MET B . n B 2 232 GLY 232 231 231 GLY GLY B . n B 2 233 TYR 233 232 232 TYR TYR B . n B 2 234 GLU 234 233 233 GLU GLU B . n B 2 235 LEU 235 234 234 LEU LEU B . n B 2 236 HIS 236 235 235 HIS HIS B . n B 2 237 PRO 237 236 236 PRO PRO B . n B 2 238 ASP 238 237 237 ASP ASP B . n B 2 239 LYS 239 238 238 LYS LYS B . n B 2 240 TRP 240 239 239 TRP TRP B . n B 2 241 THR 241 240 240 THR THR B . n B 2 242 VAL 242 241 241 VAL VAL B . n B 2 243 GLN 243 242 242 GLN GLN B . n B 2 244 PRO 244 243 243 PRO PRO B . n B 2 245 ILE 245 244 244 ILE ILE B . n B 2 246 VAL 246 245 245 VAL VAL B . n B 2 247 LEU 247 246 246 LEU LEU B . n B 2 248 PRO 248 247 247 PRO PRO B . n B 2 249 GLU 249 248 248 GLU GLU B . n B 2 250 LYS 250 249 249 LYS LYS B . n B 2 251 ASP 251 250 250 ASP ASP B . n B 2 252 SER 252 251 251 SER SER B . n B 2 253 TRP 253 252 252 TRP TRP B . n B 2 254 THR 254 253 253 THR THR B . n B 2 255 VAL 255 254 254 VAL VAL B . n B 2 256 ASN 256 255 255 ASN ASN B . n B 2 257 ASP 257 256 256 ASP ASP B . n B 2 258 ILE 258 257 257 ILE ILE B . n B 2 259 GLN 259 258 258 GLN GLN B . n B 2 260 LYS 260 259 259 LYS LYS B . n B 2 261 LEU 261 260 260 LEU LEU B . n B 2 262 VAL 262 261 261 VAL VAL B . n B 2 263 GLY 263 262 262 GLY GLY B . n B 2 264 LYS 264 263 263 LYS LYS B . n B 2 265 LEU 265 264 264 LEU LEU B . n B 2 266 ASN 266 265 265 ASN ASN B . n B 2 267 TRP 267 266 266 TRP TRP B . n B 2 268 ALA 268 267 267 ALA ALA B . n B 2 269 SER 269 268 268 SER SER B . n B 2 270 GLN 270 269 269 GLN GLN B . n B 2 271 ILE 271 270 270 ILE ILE B . n B 2 272 TYR 272 271 271 TYR TYR B . n B 2 273 PRO 273 272 272 PRO PRO B . n B 2 274 GLY 274 273 273 GLY GLY B . n B 2 275 ILE 275 274 274 ILE ILE B . n B 2 276 LYS 276 275 275 LYS LYS B . n B 2 277 VAL 277 276 276 VAL VAL B . n B 2 278 ARG 278 277 277 ARG ARG B . n B 2 279 GLN 279 278 278 GLN GLN B . n B 2 280 LEU 280 279 279 LEU LEU B . n B 2 281 SER 281 280 280 SER SER B . n B 2 282 LYS 282 281 281 LYS LYS B . n B 2 283 LEU 283 282 282 LEU LEU B . n B 2 284 LEU 284 283 283 LEU LEU B . n B 2 285 ARG 285 284 284 ARG ARG B . n B 2 286 GLY 286 285 285 GLY GLY B . n B 2 287 THR 287 286 286 THR THR B . n B 2 288 LYS 288 287 287 LYS LYS B . n B 2 289 ALA 289 288 288 ALA ALA B . n B 2 290 LEU 290 289 289 LEU LEU B . n B 2 291 THR 291 290 290 THR THR B . n B 2 292 GLU 292 291 291 GLU GLU B . n B 2 293 VAL 293 292 292 VAL VAL B . n B 2 294 ILE 294 293 293 ILE ILE B . n B 2 295 PRO 295 294 294 PRO PRO B . n B 2 296 LEU 296 295 295 LEU LEU B . n B 2 297 THR 297 296 296 THR THR B . n B 2 298 GLU 298 297 297 GLU GLU B . n B 2 299 GLU 299 298 298 GLU GLU B . n B 2 300 ALA 300 299 299 ALA ALA B . n B 2 301 GLU 301 300 300 GLU GLU B . n B 2 302 LEU 302 301 301 LEU LEU B . n B 2 303 GLU 303 302 302 GLU GLU B . n B 2 304 LEU 304 303 303 LEU LEU B . n B 2 305 ALA 305 304 304 ALA ALA B . n B 2 306 GLU 306 305 305 GLU GLU B . n B 2 307 ASN 307 306 306 ASN ASN B . n B 2 308 ARG 308 307 307 ARG ARG B . n B 2 309 GLU 309 308 308 GLU GLU B . n B 2 310 ILE 310 309 309 ILE ILE B . n B 2 311 LEU 311 310 310 LEU LEU B . n B 2 312 LYS 312 311 311 LYS LYS B . n B 2 313 GLU 313 312 312 GLU GLU B . n B 2 314 PRO 314 313 313 PRO PRO B . n B 2 315 VAL 315 314 314 VAL VAL B . n B 2 316 HIS 316 315 315 HIS HIS B . n B 2 317 GLY 317 316 316 GLY GLY B . n B 2 318 VAL 318 317 317 VAL VAL B . n B 2 319 TYR 319 318 318 TYR TYR B . n B 2 320 TYR 320 319 319 TYR TYR B . n B 2 321 ASP 321 320 320 ASP ASP B . n B 2 322 PRO 322 321 321 PRO PRO B . n B 2 323 SER 323 322 322 SER SER B . n B 2 324 LYS 324 323 323 LYS LYS B . n B 2 325 ASP 325 324 324 ASP ASP B . n B 2 326 LEU 326 325 325 LEU LEU B . n B 2 327 ILE 327 326 326 ILE ILE B . n B 2 328 ALA 328 327 327 ALA ALA B . n B 2 329 GLU 329 328 328 GLU GLU B . n B 2 330 ILE 330 329 329 ILE ILE B . n B 2 331 GLN 331 330 330 GLN GLN B . n B 2 332 LYS 332 331 331 LYS LYS B . n B 2 333 GLN 333 332 332 GLN GLN B . n B 2 334 GLY 334 333 333 GLY GLY B . n B 2 335 GLN 335 334 334 GLN GLN B . n B 2 336 GLY 336 335 335 GLY GLY B . n B 2 337 GLN 337 336 336 GLN GLN B . n B 2 338 TRP 338 337 337 TRP TRP B . n B 2 339 THR 339 338 338 THR THR B . n B 2 340 TYR 340 339 339 TYR TYR B . n B 2 341 GLN 341 340 340 GLN GLN B . n B 2 342 ILE 342 341 341 ILE ILE B . n B 2 343 TYR 343 342 342 TYR TYR B . n B 2 344 GLN 344 343 343 GLN GLN B . n B 2 345 GLU 345 344 344 GLU GLU B . n B 2 346 PRO 346 345 345 PRO PRO B . n B 2 347 PHE 347 346 346 PHE PHE B . n B 2 348 LYS 348 347 347 LYS LYS B . n B 2 349 ASN 349 348 348 ASN ASN B . n B 2 350 LEU 350 349 349 LEU LEU B . n B 2 351 LYS 351 350 350 LYS LYS B . n B 2 352 THR 352 351 351 THR THR B . n B 2 353 GLY 353 352 352 GLY GLY B . n B 2 354 LYS 354 353 353 LYS LYS B . n B 2 355 TYR 355 354 354 TYR TYR B . n B 2 356 ALA 356 355 355 ALA ALA B . n B 2 357 ARG 357 356 356 ARG ARG B . n B 2 358 MET 358 357 357 MET MET B . n B 2 359 ARG 359 358 358 ARG ARG B . n B 2 360 GLY 360 359 359 GLY GLY B . n B 2 361 ALA 361 360 360 ALA ALA B . n B 2 362 HIS 362 361 361 HIS HIS B . n B 2 363 THR 363 362 362 THR THR B . n B 2 364 ASN 364 363 363 ASN ASN B . n B 2 365 ASP 365 364 364 ASP ASP B . n B 2 366 VAL 366 365 365 VAL VAL B . n B 2 367 LYS 367 366 366 LYS LYS B . n B 2 368 GLN 368 367 367 GLN GLN B . n B 2 369 LEU 369 368 368 LEU LEU B . n B 2 370 THR 370 369 369 THR THR B . n B 2 371 GLU 371 370 370 GLU GLU B . n B 2 372 ALA 372 371 371 ALA ALA B . n B 2 373 VAL 373 372 372 VAL VAL B . n B 2 374 GLN 374 373 373 GLN GLN B . n B 2 375 LYS 375 374 374 LYS LYS B . n B 2 376 ILE 376 375 375 ILE ILE B . n B 2 377 THR 377 376 376 THR THR B . n B 2 378 THR 378 377 377 THR THR B . n B 2 379 GLU 379 378 378 GLU GLU B . n B 2 380 SER 380 379 379 SER SER B . n B 2 381 ILE 381 380 380 ILE ILE B . n B 2 382 VAL 382 381 381 VAL VAL B . n B 2 383 ILE 383 382 382 ILE ILE B . n B 2 384 TRP 384 383 383 TRP TRP B . n B 2 385 GLY 385 384 384 GLY GLY B . n B 2 386 LYS 386 385 385 LYS LYS B . n B 2 387 THR 387 386 386 THR THR B . n B 2 388 PRO 388 387 387 PRO PRO B . n B 2 389 LYS 389 388 388 LYS LYS B . n B 2 390 PHE 390 389 389 PHE PHE B . n B 2 391 LYS 391 390 390 LYS LYS B . n B 2 392 LEU 392 391 391 LEU LEU B . n B 2 393 PRO 393 392 392 PRO PRO B . n B 2 394 ILE 394 393 393 ILE ILE B . n B 2 395 GLN 395 394 394 GLN GLN B . n B 2 396 LYS 396 395 395 LYS LYS B . n B 2 397 GLU 397 396 396 GLU GLU B . n B 2 398 THR 398 397 397 THR THR B . n B 2 399 TRP 399 398 398 TRP TRP B . n B 2 400 GLU 400 399 399 GLU GLU B . n B 2 401 THR 401 400 400 THR THR B . n B 2 402 TRP 402 401 401 TRP TRP B . n B 2 403 TRP 403 402 402 TRP TRP B . n B 2 404 THR 404 403 403 THR THR B . n B 2 405 GLU 405 404 404 GLU GLU B . n B 2 406 TYR 406 405 405 TYR TYR B . n B 2 407 TRP 407 406 406 TRP TRP B . n B 2 408 GLN 408 407 407 GLN GLN B . n B 2 409 ALA 409 408 408 ALA ALA B . n B 2 410 THR 410 409 409 THR THR B . n B 2 411 TRP 411 410 410 TRP TRP B . n B 2 412 ILE 412 411 411 ILE ILE B . n B 2 413 PRO 413 412 412 PRO PRO B . n B 2 414 GLU 414 413 413 GLU GLU B . n B 2 415 TRP 415 414 414 TRP TRP B . n B 2 416 GLU 416 415 415 GLU GLU B . n B 2 417 PHE 417 416 416 PHE PHE B . n B 2 418 VAL 418 417 417 VAL VAL B . n B 2 419 ASN 419 418 418 ASN ASN B . n B 2 420 THR 420 419 419 THR THR B . n B 2 421 PRO 421 420 420 PRO PRO B . n B 2 422 PRO 422 421 421 PRO PRO B . n B 2 423 LEU 423 422 422 LEU LEU B . n B 2 424 VAL 424 423 423 VAL VAL B . n B 2 425 LYS 425 424 424 LYS LYS B . n B 2 426 LEU 426 425 425 LEU LEU B . n B 2 427 TRP 427 426 426 TRP TRP B . n B 2 428 TYR 428 427 427 TYR TYR B . n B 2 429 GLN 429 428 428 GLN GLN B . n C 1 1 MET 1 -1 -1 MET MET C . n C 1 2 VAL 2 0 0 VAL VAL C . n C 1 3 PRO 3 1 1 PRO PRO C . n C 1 4 ILE 4 2 2 ILE ILE C . n C 1 5 SER 5 3 3 SER SER C . n C 1 6 PRO 6 4 4 PRO PRO C . n C 1 7 ILE 7 5 5 ILE ILE C . n C 1 8 GLU 8 6 6 GLU GLU C . n C 1 9 THR 9 7 7 THR THR C . n C 1 10 VAL 10 8 8 VAL VAL C . n C 1 11 PRO 11 9 9 PRO PRO C . n C 1 12 VAL 12 10 10 VAL VAL C . n C 1 13 LYS 13 11 11 LYS LYS C . n C 1 14 LEU 14 12 12 LEU LEU C . n C 1 15 LYS 15 13 13 LYS LYS C . n C 1 16 PRO 16 14 14 PRO PRO C . n C 1 17 GLY 17 15 15 GLY GLY C . n C 1 18 MET 18 16 16 MET MET C . n C 1 19 ASP 19 17 17 ASP ASP C . n C 1 20 GLY 20 18 18 GLY GLY C . n C 1 21 PRO 21 19 19 PRO PRO C . n C 1 22 LYS 22 20 20 LYS LYS C . n C 1 23 VAL 23 21 21 VAL VAL C . n C 1 24 LYS 24 22 22 LYS LYS C . n C 1 25 GLN 25 23 23 GLN GLN C . n C 1 26 TRP 26 24 24 TRP TRP C . n C 1 27 PRO 27 25 25 PRO PRO C . n C 1 28 LEU 28 26 26 LEU LEU C . n C 1 29 THR 29 27 27 THR THR C . n C 1 30 GLU 30 28 28 GLU GLU C . n C 1 31 GLU 31 29 29 GLU GLU C . n C 1 32 LYS 32 30 30 LYS LYS C . n C 1 33 ILE 33 31 31 ILE ILE C . n C 1 34 LYS 34 32 32 LYS LYS C . n C 1 35 ALA 35 33 33 ALA ALA C . n C 1 36 LEU 36 34 34 LEU LEU C . n C 1 37 VAL 37 35 35 VAL VAL C . n C 1 38 GLU 38 36 36 GLU GLU C . n C 1 39 ILE 39 37 37 ILE ILE C . n C 1 40 CYS 40 38 38 CYS CYS C . n C 1 41 THR 41 39 39 THR THR C . n C 1 42 GLU 42 40 40 GLU GLU C . n C 1 43 MET 43 41 41 MET MET C . n C 1 44 GLU 44 42 42 GLU GLU C . n C 1 45 LYS 45 43 43 LYS LYS C . n C 1 46 GLU 46 44 44 GLU GLU C . n C 1 47 GLY 47 45 45 GLY GLY C . n C 1 48 LYS 48 46 46 LYS LYS C . n C 1 49 ILE 49 47 47 ILE ILE C . n C 1 50 SER 50 48 48 SER SER C . n C 1 51 LYS 51 49 49 LYS LYS C . n C 1 52 ILE 52 50 50 ILE ILE C . n C 1 53 GLY 53 51 51 GLY GLY C . n C 1 54 PRO 54 52 52 PRO PRO C . n C 1 55 GLU 55 53 53 GLU GLU C . n C 1 56 ASN 56 54 54 ASN ASN C . n C 1 57 PRO 57 55 55 PRO PRO C . n C 1 58 TYR 58 56 56 TYR TYR C . n C 1 59 ASN 59 57 57 ASN ASN C . n C 1 60 THR 60 58 58 THR THR C . n C 1 61 PRO 61 59 59 PRO PRO C . n C 1 62 VAL 62 60 60 VAL VAL C . n C 1 63 PHE 63 61 61 PHE PHE C . n C 1 64 ALA 64 62 62 ALA ALA C . n C 1 65 ILE 65 63 63 ILE ILE C . n C 1 66 LYS 66 64 64 LYS LYS C . n C 1 67 LYS 67 65 65 LYS LYS C . n C 1 68 LYS 68 66 66 LYS LYS C . n C 1 69 ASP 69 67 67 ASP ASP C . n C 1 70 SER 70 68 68 SER SER C . n C 1 71 THR 71 69 69 THR THR C . n C 1 72 LYS 72 70 70 LYS LYS C . n C 1 73 TRP 73 71 71 TRP TRP C . n C 1 74 ARG 74 72 72 ARG ARG C . n C 1 75 LYS 75 73 73 LYS LYS C . n C 1 76 LEU 76 74 74 LEU LEU C . n C 1 77 VAL 77 75 75 VAL VAL C . n C 1 78 ASP 78 76 76 ASP ASP C . n C 1 79 PHE 79 77 77 PHE PHE C . n C 1 80 ARG 80 78 78 ARG ARG C . n C 1 81 GLU 81 79 79 GLU GLU C . n C 1 82 LEU 82 80 80 LEU LEU C . n C 1 83 ASN 83 81 81 ASN ASN C . n C 1 84 LYS 84 82 82 LYS LYS C . n C 1 85 ARG 85 83 83 ARG ARG C . n C 1 86 THR 86 84 84 THR THR C . n C 1 87 GLN 87 85 85 GLN GLN C . n C 1 88 ASP 88 86 86 ASP ASP C . n C 1 89 PHE 89 87 87 PHE PHE C . n C 1 90 TRP 90 88 88 TRP TRP C . n C 1 91 GLU 91 89 89 GLU GLU C . n C 1 92 VAL 92 90 90 VAL VAL C . n C 1 93 GLN 93 91 91 GLN GLN C . n C 1 94 LEU 94 92 92 LEU LEU C . n C 1 95 GLY 95 93 93 GLY GLY C . n C 1 96 ILE 96 94 94 ILE ILE C . n C 1 97 PRO 97 95 95 PRO PRO C . n C 1 98 HIS 98 96 96 HIS HIS C . n C 1 99 PRO 99 97 97 PRO PRO C . n C 1 100 ALA 100 98 98 ALA ALA C . n C 1 101 GLY 101 99 99 GLY GLY C . n C 1 102 LEU 102 100 100 LEU LEU C . n C 1 103 LYS 103 101 101 LYS LYS C . n C 1 104 LYS 104 102 102 LYS LYS C . n C 1 105 LYS 105 103 103 LYS LYS C . n C 1 106 LYS 106 104 104 LYS LYS C . n C 1 107 SER 107 105 105 SER SER C . n C 1 108 VAL 108 106 106 VAL VAL C . n C 1 109 THR 109 107 107 THR THR C . n C 1 110 VAL 110 108 108 VAL VAL C . n C 1 111 LEU 111 109 109 LEU LEU C . n C 1 112 ASP 112 110 110 ASP ASP C . n C 1 113 VAL 113 111 111 VAL VAL C . n C 1 114 GLY 114 112 112 GLY GLY C . n C 1 115 ASP 115 113 113 ASP ASP C . n C 1 116 ALA 116 114 114 ALA ALA C . n C 1 117 TYR 117 115 115 TYR TYR C . n C 1 118 PHE 118 116 116 PHE PHE C . n C 1 119 SER 119 117 117 SER SER C . n C 1 120 VAL 120 118 118 VAL VAL C . n C 1 121 PRO 121 119 119 PRO PRO C . n C 1 122 LEU 122 120 120 LEU LEU C . n C 1 123 ASP 123 121 121 ASP ASP C . n C 1 124 GLU 124 122 122 GLU GLU C . n C 1 125 ASP 125 123 123 ASP ASP C . n C 1 126 PHE 126 124 124 PHE PHE C . n C 1 127 ARG 127 125 125 ARG ARG C . n C 1 128 LYS 128 126 126 LYS LYS C . n C 1 129 TYR 129 127 127 TYR TYR C . n C 1 130 THR 130 128 128 THR THR C . n C 1 131 ALA 131 129 129 ALA ALA C . n C 1 132 PHE 132 130 130 PHE PHE C . n C 1 133 THR 133 131 131 THR THR C . n C 1 134 ILE 134 132 132 ILE ILE C . n C 1 135 PRO 135 133 133 PRO PRO C . n C 1 136 SER 136 134 134 SER SER C . n C 1 137 ILE 137 135 135 ILE ILE C . n C 1 138 ASN 138 136 136 ASN ASN C . n C 1 139 ASN 139 137 137 ASN ASN C . n C 1 140 GLU 140 138 138 GLU GLU C . n C 1 141 THR 141 139 139 THR THR C . n C 1 142 PRO 142 140 140 PRO PRO C . n C 1 143 GLY 143 141 141 GLY GLY C . n C 1 144 ILE 144 142 142 ILE ILE C . n C 1 145 ARG 145 143 143 ARG ARG C . n C 1 146 TYR 146 144 144 TYR TYR C . n C 1 147 GLN 147 145 145 GLN GLN C . n C 1 148 TYR 148 146 146 TYR TYR C . n C 1 149 ASN 149 147 147 ASN ASN C . n C 1 150 VAL 150 148 148 VAL VAL C . n C 1 151 LEU 151 149 149 LEU LEU C . n C 1 152 PRO 152 150 150 PRO PRO C . n C 1 153 GLN 153 151 151 GLN GLN C . n C 1 154 GLY 154 152 152 GLY GLY C . n C 1 155 TRP 155 153 153 TRP TRP C . n C 1 156 LYS 156 154 154 LYS LYS C . n C 1 157 GLY 157 155 155 GLY GLY C . n C 1 158 SER 158 156 156 SER SER C . n C 1 159 PRO 159 157 157 PRO PRO C . n C 1 160 ALA 160 158 158 ALA ALA C . n C 1 161 ILE 161 159 159 ILE ILE C . n C 1 162 PHE 162 160 160 PHE PHE C . n C 1 163 GLN 163 161 161 GLN GLN C . n C 1 164 SER 164 162 162 SER SER C . n C 1 165 SER 165 163 163 SER SER C . n C 1 166 MET 166 164 164 MET MET C . n C 1 167 THR 167 165 165 THR THR C . n C 1 168 LYS 168 166 166 LYS LYS C . n C 1 169 ILE 169 167 167 ILE ILE C . n C 1 170 LEU 170 168 168 LEU LEU C . n C 1 171 GLU 171 169 169 GLU GLU C . n C 1 172 PRO 172 170 170 PRO PRO C . n C 1 173 PHE 173 171 171 PHE PHE C . n C 1 174 LYS 174 172 172 LYS LYS C . n C 1 175 LYS 175 173 173 LYS LYS C . n C 1 176 GLN 176 174 174 GLN GLN C . n C 1 177 ASN 177 175 175 ASN ASN C . n C 1 178 PRO 178 176 176 PRO PRO C . n C 1 179 ASP 179 177 177 ASP ASP C . n C 1 180 ILE 180 178 178 ILE ILE C . n C 1 181 VAL 181 179 179 VAL VAL C . n C 1 182 ILE 182 180 180 ILE ILE C . n C 1 183 TYR 183 181 181 TYR TYR C . n C 1 184 GLN 184 182 182 GLN GLN C . n C 1 185 TYR 185 183 183 TYR TYR C . n C 1 186 MET 186 184 184 MET MET C . n C 1 187 ASP 187 185 185 ASP ASP C . n C 1 188 ASP 188 186 186 ASP ASP C . n C 1 189 LEU 189 187 187 LEU LEU C . n C 1 190 TYR 190 188 188 TYR TYR C . n C 1 191 VAL 191 189 189 VAL VAL C . n C 1 192 GLY 192 190 190 GLY GLY C . n C 1 193 SER 193 191 191 SER SER C . n C 1 194 ASP 194 192 192 ASP ASP C . n C 1 195 LEU 195 193 193 LEU LEU C . n C 1 196 GLU 196 194 194 GLU GLU C . n C 1 197 ILE 197 195 195 ILE ILE C . n C 1 198 GLY 198 196 196 GLY GLY C . n C 1 199 GLN 199 197 197 GLN GLN C . n C 1 200 HIS 200 198 198 HIS HIS C . n C 1 201 ARG 201 199 199 ARG ARG C . n C 1 202 THR 202 200 200 THR THR C . n C 1 203 LYS 203 201 201 LYS LYS C . n C 1 204 ILE 204 202 202 ILE ILE C . n C 1 205 GLU 205 203 203 GLU GLU C . n C 1 206 GLU 206 204 204 GLU GLU C . n C 1 207 LEU 207 205 205 LEU LEU C . n C 1 208 ARG 208 206 206 ARG ARG C . n C 1 209 GLN 209 207 207 GLN GLN C . n C 1 210 HIS 210 208 208 HIS HIS C . n C 1 211 LEU 211 209 209 LEU LEU C . n C 1 212 LEU 212 210 210 LEU LEU C . n C 1 213 ARG 213 211 211 ARG ARG C . n C 1 214 TRP 214 212 212 TRP TRP C . n C 1 215 GLY 215 213 213 GLY GLY C . n C 1 216 LEU 216 214 214 LEU LEU C . n C 1 217 THR 217 215 215 THR THR C . n C 1 218 THR 218 216 216 THR THR C . n C 1 219 PRO 219 217 217 PRO PRO C . n C 1 220 ASP 220 218 218 ASP ASP C . n C 1 221 LYS 221 219 219 LYS LYS C . n C 1 222 LYS 222 220 220 LYS LYS C . n C 1 223 HIS 223 221 221 HIS HIS C . n C 1 224 GLN 224 222 222 GLN GLN C . n C 1 225 LYS 225 223 223 LYS LYS C . n C 1 226 GLU 226 224 224 GLU GLU C . n C 1 227 PRO 227 225 225 PRO PRO C . n C 1 228 PRO 228 226 226 PRO PRO C . n C 1 229 PHE 229 227 227 PHE PHE C . n C 1 230 LEU 230 228 228 LEU LEU C . n C 1 231 TRP 231 229 229 TRP TRP C . n C 1 232 MET 232 230 230 MET MET C . n C 1 233 GLY 233 231 231 GLY GLY C . n C 1 234 TYR 234 232 232 TYR TYR C . n C 1 235 GLU 235 233 233 GLU GLU C . n C 1 236 LEU 236 234 234 LEU LEU C . n C 1 237 HIS 237 235 235 HIS HIS C . n C 1 238 PRO 238 236 236 PRO PRO C . n C 1 239 ASP 239 237 237 ASP ASP C . n C 1 240 LYS 240 238 238 LYS LYS C . n C 1 241 TRP 241 239 239 TRP TRP C . n C 1 242 THR 242 240 240 THR THR C . n C 1 243 VAL 243 241 241 VAL VAL C . n C 1 244 GLN 244 242 242 GLN GLN C . n C 1 245 PRO 245 243 243 PRO PRO C . n C 1 246 ILE 246 244 244 ILE ILE C . n C 1 247 VAL 247 245 245 VAL VAL C . n C 1 248 LEU 248 246 246 LEU LEU C . n C 1 249 PRO 249 247 247 PRO PRO C . n C 1 250 GLU 250 248 248 GLU GLU C . n C 1 251 LYS 251 249 249 LYS LYS C . n C 1 252 ASP 252 250 250 ASP ASP C . n C 1 253 SER 253 251 251 SER SER C . n C 1 254 TRP 254 252 252 TRP TRP C . n C 1 255 THR 255 253 253 THR THR C . n C 1 256 VAL 256 254 254 VAL VAL C . n C 1 257 ASN 257 255 255 ASN ASN C . n C 1 258 ASP 258 256 256 ASP ASP C . n C 1 259 ILE 259 257 257 ILE ILE C . n C 1 260 GLN 260 258 258 GLN GLN C . n C 1 261 LYS 261 259 259 LYS LYS C . n C 1 262 LEU 262 260 260 LEU LEU C . n C 1 263 VAL 263 261 261 VAL VAL C . n C 1 264 GLY 264 262 262 GLY GLY C . n C 1 265 LYS 265 263 263 LYS LYS C . n C 1 266 LEU 266 264 264 LEU LEU C . n C 1 267 ASN 267 265 265 ASN ASN C . n C 1 268 TRP 268 266 266 TRP TRP C . n C 1 269 ALA 269 267 267 ALA ALA C . n C 1 270 SER 270 268 268 SER SER C . n C 1 271 GLN 271 269 269 GLN GLN C . n C 1 272 ILE 272 270 270 ILE ILE C . n C 1 273 TYR 273 271 271 TYR TYR C . n C 1 274 PRO 274 272 272 PRO PRO C . n C 1 275 GLY 275 273 273 GLY GLY C . n C 1 276 ILE 276 274 274 ILE ILE C . n C 1 277 LYS 277 275 275 LYS LYS C . n C 1 278 VAL 278 276 276 VAL VAL C . n C 1 279 ARG 279 277 277 ARG ARG C . n C 1 280 GLN 280 278 278 GLN GLN C . n C 1 281 LEU 281 279 279 LEU LEU C . n C 1 282 SER 282 280 280 SER SER C . n C 1 283 LYS 283 281 281 LYS LYS C . n C 1 284 LEU 284 282 282 LEU LEU C . n C 1 285 LEU 285 283 283 LEU LEU C . n C 1 286 ARG 286 284 284 ARG ARG C . n C 1 287 GLY 287 285 285 GLY GLY C . n C 1 288 THR 288 286 286 THR THR C . n C 1 289 LYS 289 287 287 LYS LYS C . n C 1 290 ALA 290 288 288 ALA ALA C . n C 1 291 LEU 291 289 289 LEU LEU C . n C 1 292 THR 292 290 290 THR THR C . n C 1 293 GLU 293 291 291 GLU GLU C . n C 1 294 VAL 294 292 292 VAL VAL C . n C 1 295 ILE 295 293 293 ILE ILE C . n C 1 296 PRO 296 294 294 PRO PRO C . n C 1 297 LEU 297 295 295 LEU LEU C . n C 1 298 THR 298 296 296 THR THR C . n C 1 299 GLU 299 297 297 GLU GLU C . n C 1 300 GLU 300 298 298 GLU GLU C . n C 1 301 ALA 301 299 299 ALA ALA C . n C 1 302 GLU 302 300 300 GLU GLU C . n C 1 303 LEU 303 301 301 LEU LEU C . n C 1 304 GLU 304 302 302 GLU GLU C . n C 1 305 LEU 305 303 303 LEU LEU C . n C 1 306 ALA 306 304 304 ALA ALA C . n C 1 307 GLU 307 305 305 GLU GLU C . n C 1 308 ASN 308 306 306 ASN ASN C . n C 1 309 ARG 309 307 307 ARG ARG C . n C 1 310 GLU 310 308 308 GLU GLU C . n C 1 311 ILE 311 309 309 ILE ILE C . n C 1 312 LEU 312 310 310 LEU LEU C . n C 1 313 LYS 313 311 311 LYS LYS C . n C 1 314 GLU 314 312 312 GLU GLU C . n C 1 315 PRO 315 313 313 PRO PRO C . n C 1 316 VAL 316 314 314 VAL VAL C . n C 1 317 HIS 317 315 315 HIS HIS C . n C 1 318 GLY 318 316 316 GLY GLY C . n C 1 319 VAL 319 317 317 VAL VAL C . n C 1 320 TYR 320 318 318 TYR TYR C . n C 1 321 TYR 321 319 319 TYR TYR C . n C 1 322 ASP 322 320 320 ASP ASP C . n C 1 323 PRO 323 321 321 PRO PRO C . n C 1 324 SER 324 322 322 SER SER C . n C 1 325 LYS 325 323 323 LYS LYS C . n C 1 326 ASP 326 324 324 ASP ASP C . n C 1 327 LEU 327 325 325 LEU LEU C . n C 1 328 ILE 328 326 326 ILE ILE C . n C 1 329 ALA 329 327 327 ALA ALA C . n C 1 330 GLU 330 328 328 GLU GLU C . n C 1 331 ILE 331 329 329 ILE ILE C . n C 1 332 GLN 332 330 330 GLN GLN C . n C 1 333 LYS 333 331 331 LYS LYS C . n C 1 334 GLN 334 332 332 GLN GLN C . n C 1 335 GLY 335 333 333 GLY GLY C . n C 1 336 GLN 336 334 334 GLN GLN C . n C 1 337 GLY 337 335 335 GLY GLY C . n C 1 338 GLN 338 336 336 GLN GLN C . n C 1 339 TRP 339 337 337 TRP TRP C . n C 1 340 THR 340 338 338 THR THR C . n C 1 341 TYR 341 339 339 TYR TYR C . n C 1 342 GLN 342 340 340 GLN GLN C . n C 1 343 ILE 343 341 341 ILE ILE C . n C 1 344 TYR 344 342 342 TYR TYR C . n C 1 345 GLN 345 343 343 GLN GLN C . n C 1 346 GLU 346 344 344 GLU GLU C . n C 1 347 PRO 347 345 345 PRO PRO C . n C 1 348 PHE 348 346 346 PHE PHE C . n C 1 349 LYS 349 347 347 LYS LYS C . n C 1 350 ASN 350 348 348 ASN ASN C . n C 1 351 LEU 351 349 349 LEU LEU C . n C 1 352 LYS 352 350 350 LYS LYS C . n C 1 353 THR 353 351 351 THR THR C . n C 1 354 GLY 354 352 352 GLY GLY C . n C 1 355 LYS 355 353 353 LYS LYS C . n C 1 356 TYR 356 354 354 TYR TYR C . n C 1 357 ALA 357 355 355 ALA ALA C . n C 1 358 ARG 358 356 356 ARG ARG C . n C 1 359 MET 359 357 357 MET MET C . n C 1 360 ARG 360 358 358 ARG ARG C . n C 1 361 GLY 361 359 359 GLY GLY C . n C 1 362 ALA 362 360 360 ALA ALA C . n C 1 363 HIS 363 361 361 HIS HIS C . n C 1 364 THR 364 362 362 THR THR C . n C 1 365 ASN 365 363 363 ASN ASN C . n C 1 366 ASP 366 364 364 ASP ASP C . n C 1 367 VAL 367 365 365 VAL VAL C . n C 1 368 LYS 368 366 366 LYS LYS C . n C 1 369 GLN 369 367 367 GLN GLN C . n C 1 370 LEU 370 368 368 LEU LEU C . n C 1 371 THR 371 369 369 THR THR C . n C 1 372 GLU 372 370 370 GLU GLU C . n C 1 373 ALA 373 371 371 ALA ALA C . n C 1 374 VAL 374 372 372 VAL VAL C . n C 1 375 GLN 375 373 373 GLN GLN C . n C 1 376 LYS 376 374 374 LYS LYS C . n C 1 377 ILE 377 375 375 ILE ILE C . n C 1 378 THR 378 376 376 THR THR C . n C 1 379 THR 379 377 377 THR THR C . n C 1 380 GLU 380 378 378 GLU GLU C . n C 1 381 SER 381 379 379 SER SER C . n C 1 382 ILE 382 380 380 ILE ILE C . n C 1 383 VAL 383 381 381 VAL VAL C . n C 1 384 ILE 384 382 382 ILE ILE C . n C 1 385 TRP 385 383 383 TRP TRP C . n C 1 386 GLY 386 384 384 GLY GLY C . n C 1 387 LYS 387 385 385 LYS LYS C . n C 1 388 THR 388 386 386 THR THR C . n C 1 389 PRO 389 387 387 PRO PRO C . n C 1 390 LYS 390 388 388 LYS LYS C . n C 1 391 PHE 391 389 389 PHE PHE C . n C 1 392 LYS 392 390 390 LYS LYS C . n C 1 393 LEU 393 391 391 LEU LEU C . n C 1 394 PRO 394 392 392 PRO PRO C . n C 1 395 ILE 395 393 393 ILE ILE C . n C 1 396 GLN 396 394 394 GLN GLN C . n C 1 397 LYS 397 395 395 LYS LYS C . n C 1 398 GLU 398 396 396 GLU GLU C . n C 1 399 THR 399 397 397 THR THR C . n C 1 400 TRP 400 398 398 TRP TRP C . n C 1 401 GLU 401 399 399 GLU GLU C . n C 1 402 THR 402 400 400 THR THR C . n C 1 403 TRP 403 401 401 TRP TRP C . n C 1 404 TRP 404 402 402 TRP TRP C . n C 1 405 THR 405 403 403 THR THR C . n C 1 406 GLU 406 404 404 GLU GLU C . n C 1 407 TYR 407 405 405 TYR TYR C . n C 1 408 TRP 408 406 406 TRP TRP C . n C 1 409 GLN 409 407 407 GLN GLN C . n C 1 410 ALA 410 408 408 ALA ALA C . n C 1 411 THR 411 409 409 THR THR C . n C 1 412 TRP 412 410 410 TRP TRP C . n C 1 413 ILE 413 411 411 ILE ILE C . n C 1 414 PRO 414 412 412 PRO PRO C . n C 1 415 GLU 415 413 413 GLU GLU C . n C 1 416 TRP 416 414 414 TRP TRP C . n C 1 417 GLU 417 415 415 GLU GLU C . n C 1 418 PHE 418 416 416 PHE PHE C . n C 1 419 VAL 419 417 417 VAL VAL C . n C 1 420 ASN 420 418 418 ASN ASN C . n C 1 421 THR 421 419 419 THR THR C . n C 1 422 PRO 422 420 420 PRO PRO C . n C 1 423 PRO 423 421 421 PRO PRO C . n C 1 424 LEU 424 422 422 LEU LEU C . n C 1 425 VAL 425 423 423 VAL VAL C . n C 1 426 LYS 426 424 424 LYS LYS C . n C 1 427 LEU 427 425 425 LEU LEU C . n C 1 428 TRP 428 426 426 TRP TRP C . n C 1 429 TYR 429 427 427 TYR TYR C . n C 1 430 GLN 430 428 428 GLN GLN C . n C 1 431 LEU 431 429 429 LEU LEU C . n C 1 432 GLU 432 430 430 GLU GLU C . n C 1 433 LYS 433 431 431 LYS LYS C . n C 1 434 GLU 434 432 432 GLU GLU C . n C 1 435 PRO 435 433 433 PRO PRO C . n C 1 436 ILE 436 434 434 ILE ILE C . n C 1 437 VAL 437 435 435 VAL VAL C . n C 1 438 GLY 438 436 436 GLY GLY C . n C 1 439 ALA 439 437 437 ALA ALA C . n C 1 440 GLU 440 438 438 GLU GLU C . n C 1 441 THR 441 439 439 THR THR C . n C 1 442 PHE 442 440 440 PHE PHE C . n C 1 443 TYR 443 441 441 TYR TYR C . n C 1 444 VAL 444 442 442 VAL VAL C . n C 1 445 ASP 445 443 443 ASP ASP C . n C 1 446 GLY 446 444 444 GLY GLY C . n C 1 447 ALA 447 445 445 ALA ALA C . n C 1 448 ALA 448 446 446 ALA ALA C . n C 1 449 ASN 449 447 447 ASN ASN C . n C 1 450 ARG 450 448 448 ARG ARG C . n C 1 451 GLU 451 449 449 GLU GLU C . n C 1 452 THR 452 450 450 THR THR C . n C 1 453 LYS 453 451 451 LYS LYS C . n C 1 454 LEU 454 452 452 LEU LEU C . n C 1 455 GLY 455 453 453 GLY GLY C . n C 1 456 LYS 456 454 454 LYS LYS C . n C 1 457 ALA 457 455 455 ALA ALA C . n C 1 458 GLY 458 456 456 GLY GLY C . n C 1 459 TYR 459 457 457 TYR TYR C . n C 1 460 VAL 460 458 458 VAL VAL C . n C 1 461 THR 461 459 459 THR THR C . n C 1 462 ASN 462 460 460 ASN ASN C . n C 1 463 LYS 463 461 461 LYS LYS C . n C 1 464 GLY 464 462 462 GLY GLY C . n C 1 465 ARG 465 463 463 ARG ARG C . n C 1 466 GLN 466 464 464 GLN GLN C . n C 1 467 LYS 467 465 465 LYS LYS C . n C 1 468 VAL 468 466 466 VAL VAL C . n C 1 469 VAL 469 467 467 VAL VAL C . n C 1 470 PRO 470 468 468 PRO PRO C . n C 1 471 LEU 471 469 469 LEU LEU C . n C 1 472 THR 472 470 470 THR THR C . n C 1 473 ASN 473 471 471 ASN ASN C . n C 1 474 THR 474 472 472 THR THR C . n C 1 475 THR 475 473 473 THR THR C . n C 1 476 ASN 476 474 474 ASN ASN C . n C 1 477 GLN 477 475 475 GLN GLN C . n C 1 478 LYS 478 476 476 LYS LYS C . n C 1 479 THR 479 477 477 THR THR C . n C 1 480 GLU 480 478 478 GLU GLU C . n C 1 481 LEU 481 479 479 LEU LEU C . n C 1 482 GLN 482 480 480 GLN GLN C . n C 1 483 ALA 483 481 481 ALA ALA C . n C 1 484 ILE 484 482 482 ILE ILE C . n C 1 485 TYR 485 483 483 TYR TYR C . n C 1 486 LEU 486 484 484 LEU LEU C . n C 1 487 ALA 487 485 485 ALA ALA C . n C 1 488 LEU 488 486 486 LEU LEU C . n C 1 489 GLN 489 487 487 GLN GLN C . n C 1 490 ASP 490 488 488 ASP ASP C . n C 1 491 SER 491 489 489 SER SER C . n C 1 492 GLY 492 490 490 GLY GLY C . n C 1 493 LEU 493 491 491 LEU LEU C . n C 1 494 GLU 494 492 492 GLU GLU C . n C 1 495 VAL 495 493 493 VAL VAL C . n C 1 496 ASN 496 494 494 ASN ASN C . n C 1 497 ILE 497 495 495 ILE ILE C . n C 1 498 VAL 498 496 496 VAL VAL C . n C 1 499 THR 499 497 497 THR THR C . n C 1 500 ASP 500 498 498 ASP ASP C . n C 1 501 SER 501 499 499 SER SER C . n C 1 502 GLN 502 500 500 GLN GLN C . n C 1 503 TYR 503 501 501 TYR TYR C . n C 1 504 ALA 504 502 502 ALA ALA C . n C 1 505 LEU 505 503 503 LEU LEU C . n C 1 506 GLY 506 504 504 GLY GLY C . n C 1 507 ILE 507 505 505 ILE ILE C . n C 1 508 ILE 508 506 506 ILE ILE C . n C 1 509 GLN 509 507 507 GLN GLN C . n C 1 510 ALA 510 508 508 ALA ALA C . n C 1 511 GLN 511 509 509 GLN GLN C . n C 1 512 PRO 512 510 510 PRO PRO C . n C 1 513 ASP 513 511 511 ASP ASP C . n C 1 514 LYS 514 512 512 LYS LYS C . n C 1 515 SER 515 513 513 SER SER C . n C 1 516 GLU 516 514 514 GLU GLU C . n C 1 517 SER 517 515 515 SER SER C . n C 1 518 GLU 518 516 516 GLU GLU C . n C 1 519 LEU 519 517 517 LEU LEU C . n C 1 520 VAL 520 518 518 VAL VAL C . n C 1 521 ASN 521 519 519 ASN ASN C . n C 1 522 GLN 522 520 520 GLN GLN C . n C 1 523 ILE 523 521 521 ILE ILE C . n C 1 524 ILE 524 522 522 ILE ILE C . n C 1 525 GLU 525 523 523 GLU GLU C . n C 1 526 GLN 526 524 524 GLN GLN C . n C 1 527 LEU 527 525 525 LEU LEU C . n C 1 528 ILE 528 526 526 ILE ILE C . n C 1 529 LYS 529 527 527 LYS LYS C . n C 1 530 LYS 530 528 528 LYS LYS C . n C 1 531 GLU 531 529 529 GLU GLU C . n C 1 532 LYS 532 530 530 LYS LYS C . n C 1 533 VAL 533 531 531 VAL VAL C . n C 1 534 TYR 534 532 532 TYR TYR C . n C 1 535 LEU 535 533 533 LEU LEU C . n C 1 536 ALA 536 534 534 ALA ALA C . n C 1 537 TRP 537 535 535 TRP TRP C . n C 1 538 VAL 538 536 536 VAL VAL C . n C 1 539 PRO 539 537 537 PRO PRO C . n C 1 540 ALA 540 538 538 ALA ALA C . n C 1 541 HIS 541 539 539 HIS HIS C . n C 1 542 LYS 542 540 540 LYS LYS C . n C 1 543 GLY 543 541 541 GLY GLY C . n C 1 544 ILE 544 542 542 ILE ILE C . n C 1 545 GLY 545 543 543 GLY GLY C . n C 1 546 GLY 546 544 544 GLY GLY C . n C 1 547 ASN 547 545 545 ASN ASN C . n C 1 548 GLU 548 546 546 GLU GLU C . n C 1 549 GLN 549 547 547 GLN GLN C . n C 1 550 VAL 550 548 548 VAL VAL C . n C 1 551 ASP 551 549 549 ASP ASP C . n C 1 552 LYS 552 550 550 LYS LYS C . n C 1 553 LEU 553 551 551 LEU LEU C . n C 1 554 VAL 554 552 552 VAL VAL C . n C 1 555 SER 555 553 553 SER SER C . n C 1 556 ALA 556 554 554 ALA ALA C . n C 1 557 GLY 557 555 555 GLY GLY C . n D 2 1 GLY 1 0 ? ? ? D . n D 2 2 PRO 2 1 ? ? ? D . n D 2 3 ILE 3 2 ? ? ? D . n D 2 4 SER 4 3 ? ? ? D . n D 2 5 PRO 5 4 4 PRO PRO D . n D 2 6 ILE 6 5 5 ILE ILE D . n D 2 7 GLU 7 6 6 GLU GLU D . n D 2 8 THR 8 7 7 THR THR D . n D 2 9 VAL 9 8 8 VAL VAL D . n D 2 10 PRO 10 9 9 PRO PRO D . n D 2 11 VAL 11 10 10 VAL VAL D . n D 2 12 LYS 12 11 11 LYS LYS D . n D 2 13 LEU 13 12 12 LEU LEU D . n D 2 14 LYS 14 13 13 LYS LYS D . n D 2 15 PRO 15 14 14 PRO PRO D . n D 2 16 GLY 16 15 15 GLY GLY D . n D 2 17 MET 17 16 16 MET MET D . n D 2 18 ASP 18 17 17 ASP ASP D . n D 2 19 GLY 19 18 18 GLY GLY D . n D 2 20 PRO 20 19 19 PRO PRO D . n D 2 21 LYS 21 20 20 LYS LYS D . n D 2 22 VAL 22 21 21 VAL VAL D . n D 2 23 LYS 23 22 22 LYS LYS D . n D 2 24 GLN 24 23 23 GLN GLN D . n D 2 25 TRP 25 24 24 TRP TRP D . n D 2 26 PRO 26 25 25 PRO PRO D . n D 2 27 LEU 27 26 26 LEU LEU D . n D 2 28 THR 28 27 27 THR THR D . n D 2 29 GLU 29 28 28 GLU GLU D . n D 2 30 GLU 30 29 29 GLU GLU D . n D 2 31 LYS 31 30 30 LYS LYS D . n D 2 32 ILE 32 31 31 ILE ILE D . n D 2 33 LYS 33 32 32 LYS LYS D . n D 2 34 ALA 34 33 33 ALA ALA D . n D 2 35 LEU 35 34 34 LEU LEU D . n D 2 36 VAL 36 35 35 VAL VAL D . n D 2 37 GLU 37 36 36 GLU GLU D . n D 2 38 ILE 38 37 37 ILE ILE D . n D 2 39 CYS 39 38 38 CYS CYS D . n D 2 40 THR 40 39 39 THR THR D . n D 2 41 GLU 41 40 40 GLU GLU D . n D 2 42 MET 42 41 41 MET MET D . n D 2 43 GLU 43 42 42 GLU GLU D . n D 2 44 LYS 44 43 43 LYS LYS D . n D 2 45 GLU 45 44 44 GLU GLU D . n D 2 46 GLY 46 45 45 GLY GLY D . n D 2 47 LYS 47 46 46 LYS LYS D . n D 2 48 ILE 48 47 47 ILE ILE D . n D 2 49 SER 49 48 48 SER SER D . n D 2 50 LYS 50 49 49 LYS LYS D . n D 2 51 ILE 51 50 50 ILE ILE D . n D 2 52 GLY 52 51 51 GLY GLY D . n D 2 53 PRO 53 52 52 PRO PRO D . n D 2 54 GLU 54 53 53 GLU GLU D . n D 2 55 ASN 55 54 54 ASN ASN D . n D 2 56 PRO 56 55 55 PRO PRO D . n D 2 57 TYR 57 56 56 TYR TYR D . n D 2 58 ASN 58 57 57 ASN ASN D . n D 2 59 THR 59 58 58 THR THR D . n D 2 60 PRO 60 59 59 PRO PRO D . n D 2 61 VAL 61 60 60 VAL VAL D . n D 2 62 PHE 62 61 61 PHE PHE D . n D 2 63 ALA 63 62 62 ALA ALA D . n D 2 64 ILE 64 63 63 ILE ILE D . n D 2 65 LYS 65 64 64 LYS LYS D . n D 2 66 LYS 66 65 65 LYS LYS D . n D 2 67 LYS 67 66 66 LYS LYS D . n D 2 68 ASP 68 67 67 ASP ASP D . n D 2 69 SER 69 68 68 SER SER D . n D 2 70 THR 70 69 69 THR THR D . n D 2 71 LYS 71 70 70 LYS LYS D . n D 2 72 TRP 72 71 71 TRP TRP D . n D 2 73 ARG 73 72 72 ARG ARG D . n D 2 74 LYS 74 73 73 LYS LYS D . n D 2 75 LEU 75 74 74 LEU LEU D . n D 2 76 VAL 76 75 75 VAL VAL D . n D 2 77 ASP 77 76 76 ASP ASP D . n D 2 78 PHE 78 77 77 PHE PHE D . n D 2 79 ARG 79 78 78 ARG ARG D . n D 2 80 GLU 80 79 79 GLU GLU D . n D 2 81 LEU 81 80 80 LEU LEU D . n D 2 82 ASN 82 81 81 ASN ASN D . n D 2 83 LYS 83 82 82 LYS LYS D . n D 2 84 ARG 84 83 83 ARG ARG D . n D 2 85 THR 85 84 84 THR THR D . n D 2 86 GLN 86 85 85 GLN GLN D . n D 2 87 ASP 87 86 86 ASP ASP D . n D 2 88 PHE 88 87 87 PHE PHE D . n D 2 89 TRP 89 88 88 TRP TRP D . n D 2 90 GLU 90 89 89 GLU GLU D . n D 2 91 VAL 91 90 90 VAL VAL D . n D 2 92 GLN 92 91 91 GLN GLN D . n D 2 93 LEU 93 92 92 LEU LEU D . n D 2 94 GLY 94 93 93 GLY GLY D . n D 2 95 ILE 95 94 94 ILE ILE D . n D 2 96 PRO 96 95 95 PRO PRO D . n D 2 97 HIS 97 96 96 HIS HIS D . n D 2 98 PRO 98 97 97 PRO PRO D . n D 2 99 ALA 99 98 98 ALA ALA D . n D 2 100 GLY 100 99 99 GLY GLY D . n D 2 101 LEU 101 100 100 LEU LEU D . n D 2 102 LYS 102 101 101 LYS LYS D . n D 2 103 LYS 103 102 102 LYS LYS D . n D 2 104 LYS 104 103 103 LYS LYS D . n D 2 105 LYS 105 104 104 LYS LYS D . n D 2 106 SER 106 105 105 SER SER D . n D 2 107 VAL 107 106 106 VAL VAL D . n D 2 108 THR 108 107 107 THR THR D . n D 2 109 VAL 109 108 108 VAL VAL D . n D 2 110 LEU 110 109 109 LEU LEU D . n D 2 111 ASP 111 110 110 ASP ASP D . n D 2 112 VAL 112 111 111 VAL VAL D . n D 2 113 GLY 113 112 112 GLY GLY D . n D 2 114 ASP 114 113 113 ASP ASP D . n D 2 115 ALA 115 114 114 ALA ALA D . n D 2 116 TYR 116 115 115 TYR TYR D . n D 2 117 PHE 117 116 116 PHE PHE D . n D 2 118 SER 118 117 117 SER SER D . n D 2 119 VAL 119 118 118 VAL VAL D . n D 2 120 PRO 120 119 119 PRO PRO D . n D 2 121 LEU 121 120 120 LEU LEU D . n D 2 122 ASP 122 121 121 ASP ASP D . n D 2 123 GLU 123 122 122 GLU GLU D . n D 2 124 ASP 124 123 123 ASP ASP D . n D 2 125 PHE 125 124 124 PHE PHE D . n D 2 126 ARG 126 125 125 ARG ARG D . n D 2 127 LYS 127 126 126 LYS LYS D . n D 2 128 TYR 128 127 127 TYR TYR D . n D 2 129 THR 129 128 128 THR THR D . n D 2 130 ALA 130 129 129 ALA ALA D . n D 2 131 PHE 131 130 130 PHE PHE D . n D 2 132 THR 132 131 131 THR THR D . n D 2 133 ILE 133 132 132 ILE ILE D . n D 2 134 PRO 134 133 133 PRO PRO D . n D 2 135 SER 135 134 134 SER SER D . n D 2 136 ILE 136 135 135 ILE ILE D . n D 2 137 ASN 137 136 136 ASN ASN D . n D 2 138 ASN 138 137 137 ASN ASN D . n D 2 139 GLU 139 138 138 GLU GLU D . n D 2 140 THR 140 139 139 THR THR D . n D 2 141 PRO 141 140 140 PRO PRO D . n D 2 142 GLY 142 141 141 GLY GLY D . n D 2 143 ILE 143 142 142 ILE ILE D . n D 2 144 ARG 144 143 143 ARG ARG D . n D 2 145 TYR 145 144 144 TYR TYR D . n D 2 146 GLN 146 145 145 GLN GLN D . n D 2 147 TYR 147 146 146 TYR TYR D . n D 2 148 ASN 148 147 147 ASN ASN D . n D 2 149 VAL 149 148 148 VAL VAL D . n D 2 150 LEU 150 149 149 LEU LEU D . n D 2 151 PRO 151 150 150 PRO PRO D . n D 2 152 GLN 152 151 151 GLN GLN D . n D 2 153 GLY 153 152 152 GLY GLY D . n D 2 154 TRP 154 153 153 TRP TRP D . n D 2 155 LYS 155 154 154 LYS LYS D . n D 2 156 GLY 156 155 155 GLY GLY D . n D 2 157 SER 157 156 156 SER SER D . n D 2 158 PRO 158 157 157 PRO PRO D . n D 2 159 ALA 159 158 158 ALA ALA D . n D 2 160 ILE 160 159 159 ILE ILE D . n D 2 161 PHE 161 160 160 PHE PHE D . n D 2 162 GLN 162 161 161 GLN GLN D . n D 2 163 SER 163 162 162 SER SER D . n D 2 164 SER 164 163 163 SER SER D . n D 2 165 MET 165 164 164 MET MET D . n D 2 166 THR 166 165 165 THR THR D . n D 2 167 LYS 167 166 166 LYS LYS D . n D 2 168 ILE 168 167 167 ILE ILE D . n D 2 169 LEU 169 168 168 LEU LEU D . n D 2 170 GLU 170 169 169 GLU GLU D . n D 2 171 PRO 171 170 170 PRO PRO D . n D 2 172 PHE 172 171 171 PHE PHE D . n D 2 173 LYS 173 172 172 LYS LYS D . n D 2 174 LYS 174 173 173 LYS LYS D . n D 2 175 GLN 175 174 174 GLN GLN D . n D 2 176 ASN 176 175 175 ASN ASN D . n D 2 177 PRO 177 176 176 PRO PRO D . n D 2 178 ASP 178 177 177 ASP ASP D . n D 2 179 ILE 179 178 178 ILE ILE D . n D 2 180 VAL 180 179 179 VAL VAL D . n D 2 181 ILE 181 180 180 ILE ILE D . n D 2 182 TYR 182 181 181 TYR TYR D . n D 2 183 GLN 183 182 182 GLN GLN D . n D 2 184 TYR 184 183 183 TYR TYR D . n D 2 185 MET 185 184 184 MET MET D . n D 2 186 ASP 186 185 185 ASP ASP D . n D 2 187 ASP 187 186 186 ASP ASP D . n D 2 188 LEU 188 187 187 LEU LEU D . n D 2 189 TYR 189 188 188 TYR TYR D . n D 2 190 VAL 190 189 189 VAL VAL D . n D 2 191 GLY 191 190 190 GLY GLY D . n D 2 192 SER 192 191 191 SER SER D . n D 2 193 ASP 193 192 192 ASP ASP D . n D 2 194 LEU 194 193 193 LEU LEU D . n D 2 195 GLU 195 194 194 GLU GLU D . n D 2 196 ILE 196 195 195 ILE ILE D . n D 2 197 GLY 197 196 196 GLY GLY D . n D 2 198 GLN 198 197 197 GLN GLN D . n D 2 199 HIS 199 198 198 HIS HIS D . n D 2 200 ARG 200 199 199 ARG ARG D . n D 2 201 THR 201 200 200 THR THR D . n D 2 202 LYS 202 201 201 LYS LYS D . n D 2 203 ILE 203 202 202 ILE ILE D . n D 2 204 GLU 204 203 203 GLU GLU D . n D 2 205 GLU 205 204 204 GLU GLU D . n D 2 206 LEU 206 205 205 LEU LEU D . n D 2 207 ARG 207 206 206 ARG ARG D . n D 2 208 GLN 208 207 207 GLN GLN D . n D 2 209 HIS 209 208 208 HIS HIS D . n D 2 210 LEU 210 209 209 LEU LEU D . n D 2 211 LEU 211 210 210 LEU LEU D . n D 2 212 ARG 212 211 211 ARG ARG D . n D 2 213 TRP 213 212 212 TRP TRP D . n D 2 214 GLY 214 213 213 GLY GLY D . n D 2 215 LEU 215 214 214 LEU LEU D . n D 2 216 THR 216 215 ? ? ? D . n D 2 217 THR 217 216 ? ? ? D . n D 2 218 PRO 218 217 ? ? ? D . n D 2 219 ASP 219 218 ? ? ? D . n D 2 220 LYS 220 219 ? ? ? D . n D 2 221 LYS 221 220 ? ? ? D . n D 2 222 HIS 222 221 ? ? ? D . n D 2 223 GLN 223 222 ? ? ? D . n D 2 224 LYS 224 223 ? ? ? D . n D 2 225 GLU 225 224 224 GLU GLU D . n D 2 226 PRO 226 225 225 PRO PRO D . n D 2 227 PRO 227 226 226 PRO PRO D . n D 2 228 PHE 228 227 227 PHE PHE D . n D 2 229 LEU 229 228 228 LEU LEU D . n D 2 230 TRP 230 229 229 TRP TRP D . n D 2 231 MET 231 230 230 MET MET D . n D 2 232 GLY 232 231 231 GLY GLY D . n D 2 233 TYR 233 232 232 TYR TYR D . n D 2 234 GLU 234 233 233 GLU GLU D . n D 2 235 LEU 235 234 234 LEU LEU D . n D 2 236 HIS 236 235 235 HIS HIS D . n D 2 237 PRO 237 236 236 PRO PRO D . n D 2 238 ASP 238 237 237 ASP ASP D . n D 2 239 LYS 239 238 238 LYS LYS D . n D 2 240 TRP 240 239 239 TRP TRP D . n D 2 241 THR 241 240 240 THR THR D . n D 2 242 VAL 242 241 241 VAL VAL D . n D 2 243 GLN 243 242 242 GLN GLN D . n D 2 244 PRO 244 243 243 PRO PRO D . n D 2 245 ILE 245 244 244 ILE ILE D . n D 2 246 VAL 246 245 245 VAL VAL D . n D 2 247 LEU 247 246 246 LEU LEU D . n D 2 248 PRO 248 247 247 PRO PRO D . n D 2 249 GLU 249 248 248 GLU GLU D . n D 2 250 LYS 250 249 249 LYS LYS D . n D 2 251 ASP 251 250 250 ASP ASP D . n D 2 252 SER 252 251 251 SER SER D . n D 2 253 TRP 253 252 252 TRP TRP D . n D 2 254 THR 254 253 253 THR THR D . n D 2 255 VAL 255 254 254 VAL VAL D . n D 2 256 ASN 256 255 255 ASN ASN D . n D 2 257 ASP 257 256 256 ASP ASP D . n D 2 258 ILE 258 257 257 ILE ILE D . n D 2 259 GLN 259 258 258 GLN GLN D . n D 2 260 LYS 260 259 259 LYS LYS D . n D 2 261 LEU 261 260 260 LEU LEU D . n D 2 262 VAL 262 261 261 VAL VAL D . n D 2 263 GLY 263 262 262 GLY GLY D . n D 2 264 LYS 264 263 263 LYS LYS D . n D 2 265 LEU 265 264 264 LEU LEU D . n D 2 266 ASN 266 265 265 ASN ASN D . n D 2 267 TRP 267 266 266 TRP TRP D . n D 2 268 ALA 268 267 267 ALA ALA D . n D 2 269 SER 269 268 268 SER SER D . n D 2 270 GLN 270 269 269 GLN GLN D . n D 2 271 ILE 271 270 270 ILE ILE D . n D 2 272 TYR 272 271 271 TYR TYR D . n D 2 273 PRO 273 272 272 PRO PRO D . n D 2 274 GLY 274 273 273 GLY GLY D . n D 2 275 ILE 275 274 274 ILE ILE D . n D 2 276 LYS 276 275 275 LYS LYS D . n D 2 277 VAL 277 276 276 VAL VAL D . n D 2 278 ARG 278 277 277 ARG ARG D . n D 2 279 GLN 279 278 278 GLN GLN D . n D 2 280 LEU 280 279 279 LEU LEU D . n D 2 281 SER 281 280 280 SER SER D . n D 2 282 LYS 282 281 281 LYS LYS D . n D 2 283 LEU 283 282 282 LEU LEU D . n D 2 284 LEU 284 283 283 LEU LEU D . n D 2 285 ARG 285 284 284 ARG ARG D . n D 2 286 GLY 286 285 285 GLY GLY D . n D 2 287 THR 287 286 286 THR THR D . n D 2 288 LYS 288 287 287 LYS LYS D . n D 2 289 ALA 289 288 288 ALA ALA D . n D 2 290 LEU 290 289 289 LEU LEU D . n D 2 291 THR 291 290 290 THR THR D . n D 2 292 GLU 292 291 291 GLU GLU D . n D 2 293 VAL 293 292 292 VAL VAL D . n D 2 294 ILE 294 293 293 ILE ILE D . n D 2 295 PRO 295 294 294 PRO PRO D . n D 2 296 LEU 296 295 295 LEU LEU D . n D 2 297 THR 297 296 296 THR THR D . n D 2 298 GLU 298 297 297 GLU GLU D . n D 2 299 GLU 299 298 298 GLU GLU D . n D 2 300 ALA 300 299 299 ALA ALA D . n D 2 301 GLU 301 300 300 GLU GLU D . n D 2 302 LEU 302 301 301 LEU LEU D . n D 2 303 GLU 303 302 302 GLU GLU D . n D 2 304 LEU 304 303 303 LEU LEU D . n D 2 305 ALA 305 304 304 ALA ALA D . n D 2 306 GLU 306 305 305 GLU GLU D . n D 2 307 ASN 307 306 306 ASN ASN D . n D 2 308 ARG 308 307 307 ARG ARG D . n D 2 309 GLU 309 308 308 GLU GLU D . n D 2 310 ILE 310 309 309 ILE ILE D . n D 2 311 LEU 311 310 310 LEU LEU D . n D 2 312 LYS 312 311 311 LYS LYS D . n D 2 313 GLU 313 312 312 GLU GLU D . n D 2 314 PRO 314 313 313 PRO PRO D . n D 2 315 VAL 315 314 314 VAL VAL D . n D 2 316 HIS 316 315 315 HIS HIS D . n D 2 317 GLY 317 316 316 GLY GLY D . n D 2 318 VAL 318 317 317 VAL VAL D . n D 2 319 TYR 319 318 318 TYR TYR D . n D 2 320 TYR 320 319 319 TYR TYR D . n D 2 321 ASP 321 320 320 ASP ASP D . n D 2 322 PRO 322 321 321 PRO PRO D . n D 2 323 SER 323 322 322 SER SER D . n D 2 324 LYS 324 323 323 LYS LYS D . n D 2 325 ASP 325 324 324 ASP ASP D . n D 2 326 LEU 326 325 325 LEU LEU D . n D 2 327 ILE 327 326 326 ILE ILE D . n D 2 328 ALA 328 327 327 ALA ALA D . n D 2 329 GLU 329 328 328 GLU GLU D . n D 2 330 ILE 330 329 329 ILE ILE D . n D 2 331 GLN 331 330 330 GLN GLN D . n D 2 332 LYS 332 331 331 LYS LYS D . n D 2 333 GLN 333 332 332 GLN GLN D . n D 2 334 GLY 334 333 333 GLY GLY D . n D 2 335 GLN 335 334 334 GLN GLN D . n D 2 336 GLY 336 335 335 GLY GLY D . n D 2 337 GLN 337 336 336 GLN GLN D . n D 2 338 TRP 338 337 337 TRP TRP D . n D 2 339 THR 339 338 338 THR THR D . n D 2 340 TYR 340 339 339 TYR TYR D . n D 2 341 GLN 341 340 340 GLN GLN D . n D 2 342 ILE 342 341 341 ILE ILE D . n D 2 343 TYR 343 342 342 TYR TYR D . n D 2 344 GLN 344 343 343 GLN GLN D . n D 2 345 GLU 345 344 344 GLU GLU D . n D 2 346 PRO 346 345 345 PRO PRO D . n D 2 347 PHE 347 346 346 PHE PHE D . n D 2 348 LYS 348 347 347 LYS LYS D . n D 2 349 ASN 349 348 348 ASN ASN D . n D 2 350 LEU 350 349 349 LEU LEU D . n D 2 351 LYS 351 350 350 LYS LYS D . n D 2 352 THR 352 351 351 THR THR D . n D 2 353 GLY 353 352 352 GLY GLY D . n D 2 354 LYS 354 353 353 LYS LYS D . n D 2 355 TYR 355 354 354 TYR TYR D . n D 2 356 ALA 356 355 355 ALA ALA D . n D 2 357 ARG 357 356 356 ARG ARG D . n D 2 358 MET 358 357 357 MET MET D . n D 2 359 ARG 359 358 358 ARG ARG D . n D 2 360 GLY 360 359 359 GLY GLY D . n D 2 361 ALA 361 360 360 ALA ALA D . n D 2 362 HIS 362 361 361 HIS HIS D . n D 2 363 THR 363 362 362 THR THR D . n D 2 364 ASN 364 363 363 ASN ASN D . n D 2 365 ASP 365 364 364 ASP ASP D . n D 2 366 VAL 366 365 365 VAL VAL D . n D 2 367 LYS 367 366 366 LYS LYS D . n D 2 368 GLN 368 367 367 GLN GLN D . n D 2 369 LEU 369 368 368 LEU LEU D . n D 2 370 THR 370 369 369 THR THR D . n D 2 371 GLU 371 370 370 GLU GLU D . n D 2 372 ALA 372 371 371 ALA ALA D . n D 2 373 VAL 373 372 372 VAL VAL D . n D 2 374 GLN 374 373 373 GLN GLN D . n D 2 375 LYS 375 374 374 LYS LYS D . n D 2 376 ILE 376 375 375 ILE ILE D . n D 2 377 THR 377 376 376 THR THR D . n D 2 378 THR 378 377 377 THR THR D . n D 2 379 GLU 379 378 378 GLU GLU D . n D 2 380 SER 380 379 379 SER SER D . n D 2 381 ILE 381 380 380 ILE ILE D . n D 2 382 VAL 382 381 381 VAL VAL D . n D 2 383 ILE 383 382 382 ILE ILE D . n D 2 384 TRP 384 383 383 TRP TRP D . n D 2 385 GLY 385 384 384 GLY GLY D . n D 2 386 LYS 386 385 385 LYS LYS D . n D 2 387 THR 387 386 386 THR THR D . n D 2 388 PRO 388 387 387 PRO PRO D . n D 2 389 LYS 389 388 388 LYS LYS D . n D 2 390 PHE 390 389 389 PHE PHE D . n D 2 391 LYS 391 390 390 LYS LYS D . n D 2 392 LEU 392 391 391 LEU LEU D . n D 2 393 PRO 393 392 392 PRO PRO D . n D 2 394 ILE 394 393 393 ILE ILE D . n D 2 395 GLN 395 394 394 GLN GLN D . n D 2 396 LYS 396 395 395 LYS LYS D . n D 2 397 GLU 397 396 396 GLU GLU D . n D 2 398 THR 398 397 397 THR THR D . n D 2 399 TRP 399 398 398 TRP TRP D . n D 2 400 GLU 400 399 399 GLU GLU D . n D 2 401 THR 401 400 400 THR THR D . n D 2 402 TRP 402 401 401 TRP TRP D . n D 2 403 TRP 403 402 402 TRP TRP D . n D 2 404 THR 404 403 403 THR THR D . n D 2 405 GLU 405 404 404 GLU GLU D . n D 2 406 TYR 406 405 405 TYR TYR D . n D 2 407 TRP 407 406 406 TRP TRP D . n D 2 408 GLN 408 407 407 GLN GLN D . n D 2 409 ALA 409 408 408 ALA ALA D . n D 2 410 THR 410 409 409 THR THR D . n D 2 411 TRP 411 410 410 TRP TRP D . n D 2 412 ILE 412 411 411 ILE ILE D . n D 2 413 PRO 413 412 412 PRO PRO D . n D 2 414 GLU 414 413 413 GLU GLU D . n D 2 415 TRP 415 414 414 TRP TRP D . n D 2 416 GLU 416 415 415 GLU GLU D . n D 2 417 PHE 417 416 416 PHE PHE D . n D 2 418 VAL 418 417 417 VAL VAL D . n D 2 419 ASN 419 418 418 ASN ASN D . n D 2 420 THR 420 419 419 THR THR D . n D 2 421 PRO 421 420 420 PRO PRO D . n D 2 422 PRO 422 421 421 PRO PRO D . n D 2 423 LEU 423 422 422 LEU LEU D . n D 2 424 VAL 424 423 423 VAL VAL D . n D 2 425 LYS 425 424 424 LYS LYS D . n D 2 426 LEU 426 425 425 LEU LEU D . n D 2 427 TRP 427 426 426 TRP TRP D . n D 2 428 TYR 428 427 427 TYR TYR D . n D 2 429 GLN 429 428 428 GLN GLN D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 MN 1 601 560 MN MN A . F 3 MN 1 602 561 MN MN A . G 4 ZW2 1 603 562 ZW2 ZW2 A . H 5 PGE 1 604 10 PGE PGE A . I 6 EDO 1 605 5 EDO EDO A . J 6 EDO 1 606 6 EDO EDO A . K 6 EDO 1 607 7 EDO EDO A . L 6 EDO 1 608 12 EDO EDO A . M 6 EDO 1 609 20 EDO EDO A . N 6 EDO 1 610 22 EDO EDO A . O 6 EDO 1 611 23 EDO EDO A . P 6 EDO 1 612 25 EDO EDO A . Q 6 EDO 1 613 26 EDO EDO A . R 6 EDO 1 614 27 EDO EDO A . S 6 EDO 1 615 28 EDO EDO A . T 6 EDO 1 616 84 EDO EDO A . U 6 EDO 1 617 85 EDO EDO A . V 6 EDO 1 618 90 EDO EDO A . W 5 PGE 1 501 2 PGE PGE B . X 5 PGE 1 502 5 PGE PGE B . Y 5 PGE 1 503 7 PGE PGE B . Z 5 PGE 1 504 11 PGE PGE B . AA 6 EDO 1 505 1 EDO EDO B . BA 6 EDO 1 506 2 EDO EDO B . CA 6 EDO 1 507 3 EDO EDO B . DA 6 EDO 1 508 4 EDO EDO B . EA 6 EDO 1 509 8 EDO EDO B . FA 6 EDO 1 510 9 EDO EDO B . GA 6 EDO 1 511 21 EDO EDO B . HA 6 EDO 1 512 29 EDO EDO B . IA 6 EDO 1 513 44 EDO EDO B . JA 6 EDO 1 514 45 EDO EDO B . KA 6 EDO 1 515 48 EDO EDO B . LA 6 EDO 1 516 49 EDO EDO B . MA 6 EDO 1 517 50 EDO EDO B . NA 6 EDO 1 518 51 EDO EDO B . OA 6 EDO 1 519 60 EDO EDO B . PA 6 EDO 1 520 77 EDO EDO B . QA 6 EDO 1 521 79 EDO EDO B . RA 6 EDO 1 522 80 EDO EDO B . SA 6 EDO 1 523 87 EDO EDO B . TA 3 MN 1 601 560 MN MN C . UA 3 MN 1 602 561 MN MN C . VA 4 ZW2 1 603 562 ZW2 ZW2 C . WA 6 EDO 1 604 10 EDO EDO C . XA 6 EDO 1 605 11 EDO EDO C . YA 6 EDO 1 606 13 EDO EDO C . ZA 6 EDO 1 607 14 EDO EDO C . AB 6 EDO 1 608 15 EDO EDO C . BB 6 EDO 1 609 30 EDO EDO C . CB 6 EDO 1 610 38 EDO EDO C . DB 6 EDO 1 611 39 EDO EDO C . EB 6 EDO 1 612 52 EDO EDO C . FB 6 EDO 1 613 53 EDO EDO C . GB 6 EDO 1 614 54 EDO EDO C . HB 6 EDO 1 615 56 EDO EDO C . IB 6 EDO 1 616 57 EDO EDO C . JB 6 EDO 1 617 58 EDO EDO C . KB 6 EDO 1 618 61 EDO EDO C . LB 6 EDO 1 619 62 EDO EDO C . MB 6 EDO 1 620 63 EDO EDO C . NB 6 EDO 1 621 68 EDO EDO C . OB 6 EDO 1 622 74 EDO EDO C . PB 6 EDO 1 623 75 EDO EDO C . QB 6 EDO 1 624 76 EDO EDO C . RB 6 EDO 1 625 88 EDO EDO C . SB 6 EDO 1 626 89 EDO EDO C . TB 5 PGE 1 501 1 PGE PGE D . UB 5 PGE 1 502 4 PGE PGE D . VB 6 EDO 1 503 32 EDO EDO D . WB 6 EDO 1 504 33 EDO EDO D . XB 6 EDO 1 505 34 EDO EDO D . YB 6 EDO 1 506 35 EDO EDO D . ZB 6 EDO 1 507 36 EDO EDO D . AC 6 EDO 1 508 40 EDO EDO D . BC 6 EDO 1 509 41 EDO EDO D . CC 6 EDO 1 510 42 EDO EDO D . DC 6 EDO 1 511 43 EDO EDO D . EC 6 EDO 1 512 72 EDO EDO D . FC 6 EDO 1 513 82 EDO EDO D . GC 6 EDO 1 514 83 EDO EDO D . HC 7 HOH 1 701 1327 HOH HOH A . HC 7 HOH 2 702 1469 HOH HOH A . HC 7 HOH 3 703 666 HOH HOH A . HC 7 HOH 4 704 1458 HOH HOH A . HC 7 HOH 5 705 503 HOH HOH A . HC 7 HOH 6 706 1266 HOH HOH A . HC 7 HOH 7 707 1453 HOH HOH A . HC 7 HOH 8 708 449 HOH HOH A . HC 7 HOH 9 709 211 HOH HOH A . HC 7 HOH 10 710 1322 HOH HOH A . HC 7 HOH 11 711 669 HOH HOH A . HC 7 HOH 12 712 485 HOH HOH A . HC 7 HOH 13 713 1479 HOH HOH A . HC 7 HOH 14 714 640 HOH HOH A . HC 7 HOH 15 715 481 HOH HOH A . HC 7 HOH 16 716 487 HOH HOH A . HC 7 HOH 17 717 1480 HOH HOH A . HC 7 HOH 18 718 1442 HOH HOH A . HC 7 HOH 19 719 446 HOH HOH A . HC 7 HOH 20 720 631 HOH HOH A . HC 7 HOH 21 721 1310 HOH HOH A . HC 7 HOH 22 722 444 HOH HOH A . HC 7 HOH 23 723 445 HOH HOH A . HC 7 HOH 24 724 1301 HOH HOH A . HC 7 HOH 25 725 1007 HOH HOH A . HC 7 HOH 26 726 1298 HOH HOH A . HC 7 HOH 27 727 492 HOH HOH A . HC 7 HOH 28 728 217 HOH HOH A . HC 7 HOH 29 729 1308 HOH HOH A . HC 7 HOH 30 730 1091 HOH HOH A . HC 7 HOH 31 731 206 HOH HOH A . HC 7 HOH 32 732 1230 HOH HOH A . HC 7 HOH 33 733 204 HOH HOH A . HC 7 HOH 34 734 337 HOH HOH A . HC 7 HOH 35 735 230 HOH HOH A . HC 7 HOH 36 736 200 HOH HOH A . HC 7 HOH 37 737 1312 HOH HOH A . HC 7 HOH 38 738 208 HOH HOH A . HC 7 HOH 39 739 205 HOH HOH A . HC 7 HOH 40 740 643 HOH HOH A . HC 7 HOH 41 741 645 HOH HOH A . HC 7 HOH 42 742 1233 HOH HOH A . HC 7 HOH 43 743 201 HOH HOH A . HC 7 HOH 44 744 488 HOH HOH A . HC 7 HOH 45 745 390 HOH HOH A . HC 7 HOH 46 746 460 HOH HOH A . HC 7 HOH 47 747 194 HOH HOH A . HC 7 HOH 48 748 1009 HOH HOH A . HC 7 HOH 49 749 482 HOH HOH A . HC 7 HOH 50 750 1300 HOH HOH A . HC 7 HOH 51 751 505 HOH HOH A . HC 7 HOH 52 752 637 HOH HOH A . HC 7 HOH 53 753 1197 HOH HOH A . HC 7 HOH 54 754 517 HOH HOH A . HC 7 HOH 55 755 1268 HOH HOH A . HC 7 HOH 56 756 20 HOH HOH A . HC 7 HOH 57 757 1231 HOH HOH A . HC 7 HOH 58 758 227 HOH HOH A . HC 7 HOH 59 759 6 HOH HOH A . HC 7 HOH 60 760 621 HOH HOH A . HC 7 HOH 61 761 458 HOH HOH A . HC 7 HOH 62 762 1324 HOH HOH A . HC 7 HOH 63 763 901 HOH HOH A . HC 7 HOH 64 764 674 HOH HOH A . HC 7 HOH 65 765 1474 HOH HOH A . HC 7 HOH 66 766 849 HOH HOH A . HC 7 HOH 67 767 61 HOH HOH A . HC 7 HOH 68 768 1317 HOH HOH A . HC 7 HOH 69 769 232 HOH HOH A . HC 7 HOH 70 770 195 HOH HOH A . HC 7 HOH 71 771 1325 HOH HOH A . HC 7 HOH 72 772 914 HOH HOH A . HC 7 HOH 73 773 1273 HOH HOH A . HC 7 HOH 74 774 1011 HOH HOH A . HC 7 HOH 75 775 508 HOH HOH A . HC 7 HOH 76 776 602 HOH HOH A . HC 7 HOH 77 777 832 HOH HOH A . HC 7 HOH 78 778 218 HOH HOH A . HC 7 HOH 79 779 93 HOH HOH A . HC 7 HOH 80 780 659 HOH HOH A . HC 7 HOH 81 781 1302 HOH HOH A . HC 7 HOH 82 782 833 HOH HOH A . HC 7 HOH 83 783 831 HOH HOH A . HC 7 HOH 84 784 660 HOH HOH A . HC 7 HOH 85 785 523 HOH HOH A . HC 7 HOH 86 786 12 HOH HOH A . HC 7 HOH 87 787 1468 HOH HOH A . HC 7 HOH 88 788 220 HOH HOH A . HC 7 HOH 89 789 73 HOH HOH A . HC 7 HOH 90 790 462 HOH HOH A . HC 7 HOH 91 791 1477 HOH HOH A . HC 7 HOH 92 792 507 HOH HOH A . HC 7 HOH 93 793 1013 HOH HOH A . HC 7 HOH 94 794 447 HOH HOH A . HC 7 HOH 95 795 636 HOH HOH A . HC 7 HOH 96 796 516 HOH HOH A . HC 7 HOH 97 797 193 HOH HOH A . HC 7 HOH 98 798 252 HOH HOH A . HC 7 HOH 99 799 95 HOH HOH A . HC 7 HOH 100 800 58 HOH HOH A . HC 7 HOH 101 801 226 HOH HOH A . HC 7 HOH 102 802 1008 HOH HOH A . HC 7 HOH 103 803 494 HOH HOH A . HC 7 HOH 104 804 202 HOH HOH A . HC 7 HOH 105 805 1478 HOH HOH A . HC 7 HOH 106 806 524 HOH HOH A . HC 7 HOH 107 807 936 HOH HOH A . HC 7 HOH 108 808 511 HOH HOH A . HC 7 HOH 109 809 199 HOH HOH A . HC 7 HOH 110 810 203 HOH HOH A . HC 7 HOH 111 811 80 HOH HOH A . HC 7 HOH 112 812 213 HOH HOH A . HC 7 HOH 113 813 454 HOH HOH A . HC 7 HOH 114 814 225 HOH HOH A . HC 7 HOH 115 815 667 HOH HOH A . HC 7 HOH 116 816 1251 HOH HOH A . HC 7 HOH 117 817 515 HOH HOH A . HC 7 HOH 118 818 522 HOH HOH A . HC 7 HOH 119 819 630 HOH HOH A . HC 7 HOH 120 820 389 HOH HOH A . HC 7 HOH 121 821 1258 HOH HOH A . HC 7 HOH 122 822 214 HOH HOH A . HC 7 HOH 123 823 672 HOH HOH A . HC 7 HOH 124 824 598 HOH HOH A . HC 7 HOH 125 825 221 HOH HOH A . HC 7 HOH 126 826 197 HOH HOH A . HC 7 HOH 127 827 219 HOH HOH A . HC 7 HOH 128 828 86 HOH HOH A . HC 7 HOH 129 829 90 HOH HOH A . HC 7 HOH 130 830 210 HOH HOH A . HC 7 HOH 131 831 209 HOH HOH A . HC 7 HOH 132 832 606 HOH HOH A . HC 7 HOH 133 833 611 HOH HOH A . HC 7 HOH 134 834 228 HOH HOH A . HC 7 HOH 135 835 459 HOH HOH A . HC 7 HOH 136 836 605 HOH HOH A . HC 7 HOH 137 837 183 HOH HOH A . HC 7 HOH 138 838 663 HOH HOH A . HC 7 HOH 139 839 53 HOH HOH A . HC 7 HOH 140 840 198 HOH HOH A . HC 7 HOH 141 841 520 HOH HOH A . HC 7 HOH 142 842 512 HOH HOH A . HC 7 HOH 143 843 456 HOH HOH A . HC 7 HOH 144 844 224 HOH HOH A . HC 7 HOH 145 845 665 HOH HOH A . HC 7 HOH 146 846 233 HOH HOH A . HC 7 HOH 147 847 649 HOH HOH A . HC 7 HOH 148 848 1328 HOH HOH A . HC 7 HOH 149 849 22 HOH HOH A . HC 7 HOH 150 850 91 HOH HOH A . HC 7 HOH 151 851 1402 HOH HOH A . HC 7 HOH 152 852 448 HOH HOH A . HC 7 HOH 153 853 484 HOH HOH A . HC 7 HOH 154 854 497 HOH HOH A . HC 7 HOH 155 855 1470 HOH HOH A . HC 7 HOH 156 856 668 HOH HOH A . HC 7 HOH 157 857 370 HOH HOH A . HC 7 HOH 158 858 207 HOH HOH A . HC 7 HOH 159 859 1452 HOH HOH A . HC 7 HOH 160 860 626 HOH HOH A . HC 7 HOH 161 861 1265 HOH HOH A . HC 7 HOH 162 862 623 HOH HOH A . HC 7 HOH 163 863 521 HOH HOH A . HC 7 HOH 164 864 1466 HOH HOH A . HC 7 HOH 165 865 216 HOH HOH A . HC 7 HOH 166 866 1309 HOH HOH A . HC 7 HOH 167 867 493 HOH HOH A . HC 7 HOH 168 868 1228 HOH HOH A . HC 7 HOH 169 869 506 HOH HOH A . HC 7 HOH 170 870 650 HOH HOH A . HC 7 HOH 171 871 622 HOH HOH A . HC 7 HOH 172 872 55 HOH HOH A . HC 7 HOH 173 873 821 HOH HOH A . HC 7 HOH 174 874 215 HOH HOH A . HC 7 HOH 175 875 642 HOH HOH A . HC 7 HOH 176 876 597 HOH HOH A . HC 7 HOH 177 877 1329 HOH HOH A . HC 7 HOH 178 878 1005 HOH HOH A . HC 7 HOH 179 879 662 HOH HOH A . HC 7 HOH 180 880 1475 HOH HOH A . HC 7 HOH 181 881 496 HOH HOH A . HC 7 HOH 182 882 1459 HOH HOH A . HC 7 HOH 183 883 1062 HOH HOH A . HC 7 HOH 184 884 478 HOH HOH A . HC 7 HOH 185 885 920 HOH HOH A . HC 7 HOH 186 886 1195 HOH HOH A . HC 7 HOH 187 887 1269 HOH HOH A . HC 7 HOH 188 888 457 HOH HOH A . HC 7 HOH 189 889 1010 HOH HOH A . HC 7 HOH 190 890 1014 HOH HOH A . HC 7 HOH 191 891 607 HOH HOH A . HC 7 HOH 192 892 596 HOH HOH A . HC 7 HOH 193 893 229 HOH HOH A . HC 7 HOH 194 894 652 HOH HOH A . HC 7 HOH 195 895 1401 HOH HOH A . HC 7 HOH 196 896 1227 HOH HOH A . HC 7 HOH 197 897 479 HOH HOH A . HC 7 HOH 198 898 1330 HOH HOH A . HC 7 HOH 199 899 599 HOH HOH A . HC 7 HOH 200 900 1092 HOH HOH A . HC 7 HOH 201 901 1465 HOH HOH A . HC 7 HOH 202 902 1297 HOH HOH A . HC 7 HOH 203 903 338 HOH HOH A . HC 7 HOH 204 904 921 HOH HOH A . HC 7 HOH 205 905 1295 HOH HOH A . HC 7 HOH 206 906 461 HOH HOH A . HC 7 HOH 207 907 483 HOH HOH A . HC 7 HOH 208 908 670 HOH HOH A . HC 7 HOH 209 909 1004 HOH HOH A . HC 7 HOH 210 910 1318 HOH HOH A . HC 7 HOH 211 911 609 HOH HOH A . HC 7 HOH 212 912 495 HOH HOH A . HC 7 HOH 213 913 633 HOH HOH A . HC 7 HOH 214 914 628 HOH HOH A . HC 7 HOH 215 915 1267 HOH HOH A . HC 7 HOH 216 916 918 HOH HOH A . HC 7 HOH 217 917 1303 HOH HOH A . HC 7 HOH 218 918 509 HOH HOH A . HC 7 HOH 219 919 1305 HOH HOH A . HC 7 HOH 220 920 1467 HOH HOH A . HC 7 HOH 221 921 1065 HOH HOH A . HC 7 HOH 222 922 455 HOH HOH A . HC 7 HOH 223 923 1315 HOH HOH A . HC 7 HOH 224 924 1057 HOH HOH A . HC 7 HOH 225 925 1151 HOH HOH A . HC 7 HOH 226 926 1093 HOH HOH A . HC 7 HOH 227 927 1421 HOH HOH A . HC 7 HOH 228 928 1455 HOH HOH A . HC 7 HOH 229 929 1095 HOH HOH A . HC 7 HOH 230 930 749 HOH HOH A . HC 7 HOH 231 931 408 HOH HOH A . HC 7 HOH 232 932 1331 HOH HOH A . HC 7 HOH 233 933 629 HOH HOH A . HC 7 HOH 234 934 1460 HOH HOH A . HC 7 HOH 235 935 1294 HOH HOH A . HC 7 HOH 236 936 1456 HOH HOH A . HC 7 HOH 237 937 1293 HOH HOH A . HC 7 HOH 238 938 1185 HOH HOH A . HC 7 HOH 239 939 1391 HOH HOH A . HC 7 HOH 240 940 1085 HOH HOH A . HC 7 HOH 241 941 1086 HOH HOH A . HC 7 HOH 242 942 1194 HOH HOH A . HC 7 HOH 243 943 1156 HOH HOH A . HC 7 HOH 244 944 1052 HOH HOH A . HC 7 HOH 245 945 1158 HOH HOH A . HC 7 HOH 246 946 1229 HOH HOH A . HC 7 HOH 247 947 1326 HOH HOH A . HC 7 HOH 248 948 1299 HOH HOH A . HC 7 HOH 249 949 1304 HOH HOH A . HC 7 HOH 250 950 1454 HOH HOH A . HC 7 HOH 251 951 1319 HOH HOH A . HC 7 HOH 252 952 1038 HOH HOH A . HC 7 HOH 253 953 1087 HOH HOH A . HC 7 HOH 254 954 1090 HOH HOH A . HC 7 HOH 255 955 1320 HOH HOH A . HC 7 HOH 256 956 1084 HOH HOH A . HC 7 HOH 257 957 1410 HOH HOH A . HC 7 HOH 258 958 1420 HOH HOH A . HC 7 HOH 259 959 1061 HOH HOH A . HC 7 HOH 260 960 1441 HOH HOH A . HC 7 HOH 261 961 945 HOH HOH A . HC 7 HOH 262 962 1457 HOH HOH A . IC 7 HOH 1 601 1353 HOH HOH B . IC 7 HOH 2 602 917 HOH HOH B . IC 7 HOH 3 603 554 HOH HOH B . IC 7 HOH 4 604 380 HOH HOH B . IC 7 HOH 5 605 1347 HOH HOH B . IC 7 HOH 6 606 789 HOH HOH B . IC 7 HOH 7 607 551 HOH HOH B . IC 7 HOH 8 608 1256 HOH HOH B . IC 7 HOH 9 609 500 HOH HOH B . IC 7 HOH 10 610 797 HOH HOH B . IC 7 HOH 11 611 567 HOH HOH B . IC 7 HOH 12 612 784 HOH HOH B . IC 7 HOH 13 613 1316 HOH HOH B . IC 7 HOH 14 614 1404 HOH HOH B . IC 7 HOH 15 615 387 HOH HOH B . IC 7 HOH 16 616 272 HOH HOH B . IC 7 HOH 17 617 900 HOH HOH B . IC 7 HOH 18 618 251 HOH HOH B . IC 7 HOH 19 619 1332 HOH HOH B . IC 7 HOH 20 620 796 HOH HOH B . IC 7 HOH 21 621 275 HOH HOH B . IC 7 HOH 22 622 383 HOH HOH B . IC 7 HOH 23 623 904 HOH HOH B . IC 7 HOH 24 624 257 HOH HOH B . IC 7 HOH 25 625 570 HOH HOH B . IC 7 HOH 26 626 795 HOH HOH B . IC 7 HOH 27 627 1257 HOH HOH B . IC 7 HOH 28 628 501 HOH HOH B . IC 7 HOH 29 629 552 HOH HOH B . IC 7 HOH 30 630 239 HOH HOH B . IC 7 HOH 31 631 286 HOH HOH B . IC 7 HOH 32 632 903 HOH HOH B . IC 7 HOH 33 633 783 HOH HOH B . IC 7 HOH 34 634 788 HOH HOH B . IC 7 HOH 35 635 17 HOH HOH B . IC 7 HOH 36 636 568 HOH HOH B . IC 7 HOH 37 637 982 HOH HOH B . IC 7 HOH 38 638 101 HOH HOH B . IC 7 HOH 39 639 978 HOH HOH B . IC 7 HOH 40 640 555 HOH HOH B . IC 7 HOH 41 641 254 HOH HOH B . IC 7 HOH 42 642 981 HOH HOH B . IC 7 HOH 43 643 910 HOH HOH B . IC 7 HOH 44 644 236 HOH HOH B . IC 7 HOH 45 645 653 HOH HOH B . IC 7 HOH 46 646 266 HOH HOH B . IC 7 HOH 47 647 223 HOH HOH B . IC 7 HOH 48 648 1029 HOH HOH B . IC 7 HOH 49 649 273 HOH HOH B . IC 7 HOH 50 650 35 HOH HOH B . IC 7 HOH 51 651 68 HOH HOH B . IC 7 HOH 52 652 30 HOH HOH B . IC 7 HOH 53 653 838 HOH HOH B . IC 7 HOH 54 654 1379 HOH HOH B . IC 7 HOH 55 655 88 HOH HOH B . IC 7 HOH 56 656 407 HOH HOH B . IC 7 HOH 57 657 782 HOH HOH B . IC 7 HOH 58 658 810 HOH HOH B . IC 7 HOH 59 659 5 HOH HOH B . IC 7 HOH 60 660 1344 HOH HOH B . IC 7 HOH 61 661 811 HOH HOH B . IC 7 HOH 62 662 1471 HOH HOH B . IC 7 HOH 63 663 238 HOH HOH B . IC 7 HOH 64 664 24 HOH HOH B . IC 7 HOH 65 665 222 HOH HOH B . IC 7 HOH 66 666 561 HOH HOH B . IC 7 HOH 67 667 240 HOH HOH B . IC 7 HOH 68 668 59 HOH HOH B . IC 7 HOH 69 669 264 HOH HOH B . IC 7 HOH 70 670 563 HOH HOH B . IC 7 HOH 71 671 52 HOH HOH B . IC 7 HOH 72 672 893 HOH HOH B . IC 7 HOH 73 673 104 HOH HOH B . IC 7 HOH 74 674 19 HOH HOH B . IC 7 HOH 75 675 37 HOH HOH B . IC 7 HOH 76 676 907 HOH HOH B . IC 7 HOH 77 677 1446 HOH HOH B . IC 7 HOH 78 678 38 HOH HOH B . IC 7 HOH 79 679 274 HOH HOH B . IC 7 HOH 80 680 897 HOH HOH B . IC 7 HOH 81 681 1252 HOH HOH B . IC 7 HOH 82 682 21 HOH HOH B . IC 7 HOH 83 683 50 HOH HOH B . IC 7 HOH 84 684 822 HOH HOH B . IC 7 HOH 85 685 259 HOH HOH B . IC 7 HOH 86 686 812 HOH HOH B . IC 7 HOH 87 687 905 HOH HOH B . IC 7 HOH 88 688 498 HOH HOH B . IC 7 HOH 89 689 647 HOH HOH B . IC 7 HOH 90 690 791 HOH HOH B . IC 7 HOH 91 691 639 HOH HOH B . IC 7 HOH 92 692 45 HOH HOH B . IC 7 HOH 93 693 911 HOH HOH B . IC 7 HOH 94 694 538 HOH HOH B . IC 7 HOH 95 695 604 HOH HOH B . IC 7 HOH 96 696 398 HOH HOH B . IC 7 HOH 97 697 889 HOH HOH B . IC 7 HOH 98 698 504 HOH HOH B . IC 7 HOH 99 699 823 HOH HOH B . IC 7 HOH 100 700 399 HOH HOH B . IC 7 HOH 101 701 231 HOH HOH B . IC 7 HOH 102 702 809 HOH HOH B . IC 7 HOH 103 703 234 HOH HOH B . IC 7 HOH 104 704 270 HOH HOH B . IC 7 HOH 105 705 245 HOH HOH B . IC 7 HOH 106 706 971 HOH HOH B . IC 7 HOH 107 707 906 HOH HOH B . IC 7 HOH 108 708 77 HOH HOH B . IC 7 HOH 109 709 1346 HOH HOH B . IC 7 HOH 110 710 634 HOH HOH B . IC 7 HOH 111 711 814 HOH HOH B . IC 7 HOH 112 712 942 HOH HOH B . IC 7 HOH 113 713 557 HOH HOH B . IC 7 HOH 114 714 276 HOH HOH B . IC 7 HOH 115 715 392 HOH HOH B . IC 7 HOH 116 716 1259 HOH HOH B . IC 7 HOH 117 717 780 HOH HOH B . IC 7 HOH 118 718 565 HOH HOH B . IC 7 HOH 119 719 396 HOH HOH B . IC 7 HOH 120 720 548 HOH HOH B . IC 7 HOH 121 721 785 HOH HOH B . IC 7 HOH 122 722 510 HOH HOH B . IC 7 HOH 123 723 10 HOH HOH B . IC 7 HOH 124 724 985 HOH HOH B . IC 7 HOH 125 725 255 HOH HOH B . IC 7 HOH 126 726 23 HOH HOH B . IC 7 HOH 127 727 25 HOH HOH B . IC 7 HOH 128 728 977 HOH HOH B . IC 7 HOH 129 729 29 HOH HOH B . IC 7 HOH 130 730 258 HOH HOH B . IC 7 HOH 131 731 837 HOH HOH B . IC 7 HOH 132 732 40 HOH HOH B . IC 7 HOH 133 733 3 HOH HOH B . IC 7 HOH 134 734 395 HOH HOH B . IC 7 HOH 135 735 265 HOH HOH B . IC 7 HOH 136 736 827 HOH HOH B . IC 7 HOH 137 737 263 HOH HOH B . IC 7 HOH 138 738 279 HOH HOH B . IC 7 HOH 139 739 1253 HOH HOH B . IC 7 HOH 140 740 49 HOH HOH B . IC 7 HOH 141 741 787 HOH HOH B . IC 7 HOH 142 742 284 HOH HOH B . IC 7 HOH 143 743 242 HOH HOH B . IC 7 HOH 144 744 81 HOH HOH B . IC 7 HOH 145 745 995 HOH HOH B . IC 7 HOH 146 746 556 HOH HOH B . IC 7 HOH 147 747 807 HOH HOH B . IC 7 HOH 148 748 386 HOH HOH B . IC 7 HOH 149 749 803 HOH HOH B . IC 7 HOH 150 750 970 HOH HOH B . IC 7 HOH 151 751 806 HOH HOH B . IC 7 HOH 152 752 974 HOH HOH B . IC 7 HOH 153 753 7 HOH HOH B . IC 7 HOH 154 754 402 HOH HOH B . IC 7 HOH 155 755 808 HOH HOH B . IC 7 HOH 156 756 1384 HOH HOH B . IC 7 HOH 157 757 244 HOH HOH B . IC 7 HOH 158 758 391 HOH HOH B . IC 7 HOH 159 759 553 HOH HOH B . IC 7 HOH 160 760 282 HOH HOH B . IC 7 HOH 161 761 401 HOH HOH B . IC 7 HOH 162 762 83 HOH HOH B . IC 7 HOH 163 763 378 HOH HOH B . IC 7 HOH 164 764 381 HOH HOH B . IC 7 HOH 165 765 196 HOH HOH B . IC 7 HOH 166 766 11 HOH HOH B . IC 7 HOH 167 767 394 HOH HOH B . IC 7 HOH 168 768 805 HOH HOH B . IC 7 HOH 169 769 976 HOH HOH B . IC 7 HOH 170 770 237 HOH HOH B . IC 7 HOH 171 771 385 HOH HOH B . IC 7 HOH 172 772 817 HOH HOH B . IC 7 HOH 173 773 826 HOH HOH B . IC 7 HOH 174 774 235 HOH HOH B . IC 7 HOH 175 775 781 HOH HOH B . IC 7 HOH 176 776 828 HOH HOH B . IC 7 HOH 177 777 278 HOH HOH B . IC 7 HOH 178 778 397 HOH HOH B . IC 7 HOH 179 779 1272 HOH HOH B . IC 7 HOH 180 780 28 HOH HOH B . IC 7 HOH 181 781 289 HOH HOH B . IC 7 HOH 182 782 100 HOH HOH B . IC 7 HOH 183 783 891 HOH HOH B . IC 7 HOH 184 784 1354 HOH HOH B . IC 7 HOH 185 785 502 HOH HOH B . IC 7 HOH 186 786 815 HOH HOH B . IC 7 HOH 187 787 1345 HOH HOH B . IC 7 HOH 188 788 288 HOH HOH B . IC 7 HOH 189 789 250 HOH HOH B . IC 7 HOH 190 790 896 HOH HOH B . IC 7 HOH 191 791 406 HOH HOH B . IC 7 HOH 192 792 267 HOH HOH B . IC 7 HOH 193 793 248 HOH HOH B . IC 7 HOH 194 794 243 HOH HOH B . IC 7 HOH 195 795 895 HOH HOH B . IC 7 HOH 196 796 794 HOH HOH B . IC 7 HOH 197 797 139 HOH HOH B . IC 7 HOH 198 798 103 HOH HOH B . IC 7 HOH 199 799 97 HOH HOH B . IC 7 HOH 200 800 269 HOH HOH B . IC 7 HOH 201 801 558 HOH HOH B . IC 7 HOH 202 802 792 HOH HOH B . IC 7 HOH 203 803 820 HOH HOH B . IC 7 HOH 204 804 801 HOH HOH B . IC 7 HOH 205 805 1026 HOH HOH B . IC 7 HOH 206 806 277 HOH HOH B . IC 7 HOH 207 807 1400 HOH HOH B . IC 7 HOH 208 808 714 HOH HOH B . IC 7 HOH 209 809 991 HOH HOH B . IC 7 HOH 210 810 566 HOH HOH B . IC 7 HOH 211 811 988 HOH HOH B . IC 7 HOH 212 812 379 HOH HOH B . IC 7 HOH 213 813 536 HOH HOH B . IC 7 HOH 214 814 603 HOH HOH B . IC 7 HOH 215 815 800 HOH HOH B . IC 7 HOH 216 816 892 HOH HOH B . IC 7 HOH 217 817 271 HOH HOH B . IC 7 HOH 218 818 562 HOH HOH B . IC 7 HOH 219 819 1179 HOH HOH B . IC 7 HOH 220 820 1382 HOH HOH B . IC 7 HOH 221 821 894 HOH HOH B . IC 7 HOH 222 822 793 HOH HOH B . IC 7 HOH 223 823 1380 HOH HOH B . IC 7 HOH 224 824 908 HOH HOH B . IC 7 HOH 225 825 1386 HOH HOH B . IC 7 HOH 226 826 388 HOH HOH B . IC 7 HOH 227 827 1120 HOH HOH B . IC 7 HOH 228 828 249 HOH HOH B . IC 7 HOH 229 829 944 HOH HOH B . IC 7 HOH 230 830 984 HOH HOH B . IC 7 HOH 231 831 1449 HOH HOH B . IC 7 HOH 232 832 1440 HOH HOH B . IC 7 HOH 233 833 912 HOH HOH B . IC 7 HOH 234 834 292 HOH HOH B . IC 7 HOH 235 835 260 HOH HOH B . IC 7 HOH 236 836 941 HOH HOH B . IC 7 HOH 237 837 1383 HOH HOH B . IC 7 HOH 238 838 1193 HOH HOH B . IC 7 HOH 239 839 1438 HOH HOH B . IC 7 HOH 240 840 909 HOH HOH B . IC 7 HOH 241 841 253 HOH HOH B . IC 7 HOH 242 842 1445 HOH HOH B . IC 7 HOH 243 843 1132 HOH HOH B . IC 7 HOH 244 844 393 HOH HOH B . IC 7 HOH 245 845 1028 HOH HOH B . IC 7 HOH 246 846 1171 HOH HOH B . IC 7 HOH 247 847 1139 HOH HOH B . IC 7 HOH 248 848 1076 HOH HOH B . IC 7 HOH 249 849 1149 HOH HOH B . IC 7 HOH 250 850 1169 HOH HOH B . IC 7 HOH 251 851 1050 HOH HOH B . IC 7 HOH 252 852 1051 HOH HOH B . IC 7 HOH 253 853 559 HOH HOH B . IC 7 HOH 254 854 1152 HOH HOH B . IC 7 HOH 255 855 1042 HOH HOH B . IC 7 HOH 256 856 1043 HOH HOH B . IC 7 HOH 257 857 818 HOH HOH B . IC 7 HOH 258 858 1180 HOH HOH B . IC 7 HOH 259 859 1191 HOH HOH B . IC 7 HOH 260 860 1387 HOH HOH B . IC 7 HOH 261 861 612 HOH HOH B . IC 7 HOH 262 862 1177 HOH HOH B . IC 7 HOH 263 863 1343 HOH HOH B . IC 7 HOH 264 864 1145 HOH HOH B . IC 7 HOH 265 865 1147 HOH HOH B . IC 7 HOH 266 866 1182 HOH HOH B . IC 7 HOH 267 867 1129 HOH HOH B . IC 7 HOH 268 868 1448 HOH HOH B . IC 7 HOH 269 869 1439 HOH HOH B . IC 7 HOH 270 870 786 HOH HOH B . IC 7 HOH 271 871 1176 HOH HOH B . IC 7 HOH 272 872 1069 HOH HOH B . IC 7 HOH 273 873 1083 HOH HOH B . IC 7 HOH 274 874 1146 HOH HOH B . IC 7 HOH 275 875 1333 HOH HOH B . IC 7 HOH 276 876 1082 HOH HOH B . IC 7 HOH 277 877 1073 HOH HOH B . IC 7 HOH 278 878 1059 HOH HOH B . IC 7 HOH 279 879 1381 HOH HOH B . IC 7 HOH 280 880 1313 HOH HOH B . IC 7 HOH 281 881 1314 HOH HOH B . IC 7 HOH 282 882 1192 HOH HOH B . JC 7 HOH 1 701 115 HOH HOH C . JC 7 HOH 2 702 354 HOH HOH C . JC 7 HOH 3 703 62 HOH HOH C . JC 7 HOH 4 704 1412 HOH HOH C . JC 7 HOH 5 705 1473 HOH HOH C . JC 7 HOH 6 706 767 HOH HOH C . JC 7 HOH 7 707 133 HOH HOH C . JC 7 HOH 8 708 1225 HOH HOH C . JC 7 HOH 9 709 1426 HOH HOH C . JC 7 HOH 10 710 1419 HOH HOH C . JC 7 HOH 11 711 1275 HOH HOH C . JC 7 HOH 12 712 754 HOH HOH C . JC 7 HOH 13 713 962 HOH HOH C . JC 7 HOH 14 714 757 HOH HOH C . JC 7 HOH 15 715 764 HOH HOH C . JC 7 HOH 16 716 1221 HOH HOH C . JC 7 HOH 17 717 171 HOH HOH C . JC 7 HOH 18 718 742 HOH HOH C . JC 7 HOH 19 719 842 HOH HOH C . JC 7 HOH 20 720 1286 HOH HOH C . JC 7 HOH 21 721 373 HOH HOH C . JC 7 HOH 22 722 1397 HOH HOH C . JC 7 HOH 23 723 351 HOH HOH C . JC 7 HOH 24 724 571 HOH HOH C . JC 7 HOH 25 725 950 HOH HOH C . JC 7 HOH 26 726 835 HOH HOH C . JC 7 HOH 27 727 1224 HOH HOH C . JC 7 HOH 28 728 738 HOH HOH C . JC 7 HOH 29 729 1367 HOH HOH C . JC 7 HOH 30 730 759 HOH HOH C . JC 7 HOH 31 731 1289 HOH HOH C . JC 7 HOH 32 732 469 HOH HOH C . JC 7 HOH 33 733 306 HOH HOH C . JC 7 HOH 34 734 766 HOH HOH C . JC 7 HOH 35 735 1271 HOH HOH C . JC 7 HOH 36 736 168 HOH HOH C . JC 7 HOH 37 737 1217 HOH HOH C . JC 7 HOH 38 738 755 HOH HOH C . JC 7 HOH 39 739 746 HOH HOH C . JC 7 HOH 40 740 1370 HOH HOH C . JC 7 HOH 41 741 120 HOH HOH C . JC 7 HOH 42 742 927 HOH HOH C . JC 7 HOH 43 743 592 HOH HOH C . JC 7 HOH 44 744 175 HOH HOH C . JC 7 HOH 45 745 775 HOH HOH C . JC 7 HOH 46 746 858 HOH HOH C . JC 7 HOH 47 747 956 HOH HOH C . JC 7 HOH 48 748 864 HOH HOH C . JC 7 HOH 49 749 866 HOH HOH C . JC 7 HOH 50 750 374 HOH HOH C . JC 7 HOH 51 751 117 HOH HOH C . JC 7 HOH 52 752 756 HOH HOH C . JC 7 HOH 53 753 934 HOH HOH C . JC 7 HOH 54 754 124 HOH HOH C . JC 7 HOH 55 755 829 HOH HOH C . JC 7 HOH 56 756 851 HOH HOH C . JC 7 HOH 57 757 769 HOH HOH C . JC 7 HOH 58 758 356 HOH HOH C . JC 7 HOH 59 759 1198 HOH HOH C . JC 7 HOH 60 760 513 HOH HOH C . JC 7 HOH 61 761 774 HOH HOH C . JC 7 HOH 62 762 585 HOH HOH C . JC 7 HOH 63 763 657 HOH HOH C . JC 7 HOH 64 764 1276 HOH HOH C . JC 7 HOH 65 765 355 HOH HOH C . JC 7 HOH 66 766 779 HOH HOH C . JC 7 HOH 67 767 727 HOH HOH C . JC 7 HOH 68 768 845 HOH HOH C . JC 7 HOH 69 769 36 HOH HOH C . JC 7 HOH 70 770 99 HOH HOH C . JC 7 HOH 71 771 618 HOH HOH C . JC 7 HOH 72 772 357 HOH HOH C . JC 7 HOH 73 773 777 HOH HOH C . JC 7 HOH 74 774 468 HOH HOH C . JC 7 HOH 75 775 852 HOH HOH C . JC 7 HOH 76 776 1220 HOH HOH C . JC 7 HOH 77 777 352 HOH HOH C . JC 7 HOH 78 778 760 HOH HOH C . JC 7 HOH 79 779 132 HOH HOH C . JC 7 HOH 80 780 1394 HOH HOH C . JC 7 HOH 81 781 574 HOH HOH C . JC 7 HOH 82 782 119 HOH HOH C . JC 7 HOH 83 783 1406 HOH HOH C . JC 7 HOH 84 784 857 HOH HOH C . JC 7 HOH 85 785 167 HOH HOH C . JC 7 HOH 86 786 702 HOH HOH C . JC 7 HOH 87 787 765 HOH HOH C . JC 7 HOH 88 788 613 HOH HOH C . JC 7 HOH 89 789 108 HOH HOH C . JC 7 HOH 90 790 655 HOH HOH C . JC 7 HOH 91 791 109 HOH HOH C . JC 7 HOH 92 792 177 HOH HOH C . JC 7 HOH 93 793 417 HOH HOH C . JC 7 HOH 94 794 960 HOH HOH C . JC 7 HOH 95 795 123 HOH HOH C . JC 7 HOH 96 796 593 HOH HOH C . JC 7 HOH 97 797 131 HOH HOH C . JC 7 HOH 98 798 654 HOH HOH C . JC 7 HOH 99 799 575 HOH HOH C . JC 7 HOH 100 800 1292 HOH HOH C . JC 7 HOH 101 801 112 HOH HOH C . JC 7 HOH 102 802 968 HOH HOH C . JC 7 HOH 103 803 1287 HOH HOH C . JC 7 HOH 104 804 750 HOH HOH C . JC 7 HOH 105 805 76 HOH HOH C . JC 7 HOH 106 806 182 HOH HOH C . JC 7 HOH 107 807 1016 HOH HOH C . JC 7 HOH 108 808 591 HOH HOH C . JC 7 HOH 109 809 141 HOH HOH C . JC 7 HOH 110 810 1136 HOH HOH C . JC 7 HOH 111 811 586 HOH HOH C . JC 7 HOH 112 812 184 HOH HOH C . JC 7 HOH 113 813 128 HOH HOH C . JC 7 HOH 114 814 577 HOH HOH C . JC 7 HOH 115 815 737 HOH HOH C . JC 7 HOH 116 816 729 HOH HOH C . JC 7 HOH 117 817 187 HOH HOH C . JC 7 HOH 118 818 1411 HOH HOH C . JC 7 HOH 119 819 79 HOH HOH C . JC 7 HOH 120 820 748 HOH HOH C . JC 7 HOH 121 821 113 HOH HOH C . JC 7 HOH 122 822 178 HOH HOH C . JC 7 HOH 123 823 736 HOH HOH C . JC 7 HOH 124 824 1407 HOH HOH C . JC 7 HOH 125 825 64 HOH HOH C . JC 7 HOH 126 826 957 HOH HOH C . JC 7 HOH 127 827 1110 HOH HOH C . JC 7 HOH 128 828 467 HOH HOH C . JC 7 HOH 129 829 594 HOH HOH C . JC 7 HOH 130 830 367 HOH HOH C . JC 7 HOH 131 831 576 HOH HOH C . JC 7 HOH 132 832 758 HOH HOH C . JC 7 HOH 133 833 1461 HOH HOH C . JC 7 HOH 134 834 739 HOH HOH C . JC 7 HOH 135 835 126 HOH HOH C . JC 7 HOH 136 836 584 HOH HOH C . JC 7 HOH 137 837 1348 HOH HOH C . JC 7 HOH 138 838 834 HOH HOH C . JC 7 HOH 139 839 608 HOH HOH C . JC 7 HOH 140 840 111 HOH HOH C . JC 7 HOH 141 841 545 HOH HOH C . JC 7 HOH 142 842 191 HOH HOH C . JC 7 HOH 143 843 687 HOH HOH C . JC 7 HOH 144 844 146 HOH HOH C . JC 7 HOH 145 845 114 HOH HOH C . JC 7 HOH 146 846 1290 HOH HOH C . JC 7 HOH 147 847 778 HOH HOH C . JC 7 HOH 148 848 371 HOH HOH C . JC 7 HOH 149 849 747 HOH HOH C . JC 7 HOH 150 850 46 HOH HOH C . JC 7 HOH 151 851 57 HOH HOH C . JC 7 HOH 152 852 572 HOH HOH C . JC 7 HOH 153 853 164 HOH HOH C . JC 7 HOH 154 854 776 HOH HOH C . JC 7 HOH 155 855 142 HOH HOH C . JC 7 HOH 156 856 192 HOH HOH C . JC 7 HOH 157 857 1288 HOH HOH C . JC 7 HOH 158 858 480 HOH HOH C . JC 7 HOH 159 859 762 HOH HOH C . JC 7 HOH 160 860 71 HOH HOH C . JC 7 HOH 161 861 161 HOH HOH C . JC 7 HOH 162 862 186 HOH HOH C . JC 7 HOH 163 863 18 HOH HOH C . JC 7 HOH 164 864 741 HOH HOH C . JC 7 HOH 165 865 134 HOH HOH C . JC 7 HOH 166 866 180 HOH HOH C . JC 7 HOH 167 867 1415 HOH HOH C . JC 7 HOH 168 868 1360 HOH HOH C . JC 7 HOH 169 869 138 HOH HOH C . JC 7 HOH 170 870 1285 HOH HOH C . JC 7 HOH 171 871 118 HOH HOH C . JC 7 HOH 172 872 82 HOH HOH C . JC 7 HOH 173 873 422 HOH HOH C . JC 7 HOH 174 874 188 HOH HOH C . JC 7 HOH 175 875 129 HOH HOH C . JC 7 HOH 176 876 135 HOH HOH C . JC 7 HOH 177 877 549 HOH HOH C . JC 7 HOH 178 878 137 HOH HOH C . JC 7 HOH 179 879 846 HOH HOH C . JC 7 HOH 180 880 863 HOH HOH C . JC 7 HOH 181 881 69 HOH HOH C . JC 7 HOH 182 882 830 HOH HOH C . JC 7 HOH 183 883 347 HOH HOH C . JC 7 HOH 184 884 349 HOH HOH C . JC 7 HOH 185 885 1187 HOH HOH C . JC 7 HOH 186 886 932 HOH HOH C . JC 7 HOH 187 887 614 HOH HOH C . JC 7 HOH 188 888 772 HOH HOH C . JC 7 HOH 189 889 343 HOH HOH C . JC 7 HOH 190 890 771 HOH HOH C . JC 7 HOH 191 891 295 HOH HOH C . JC 7 HOH 192 892 616 HOH HOH C . JC 7 HOH 193 893 770 HOH HOH C . JC 7 HOH 194 894 1278 HOH HOH C . JC 7 HOH 195 895 1376 HOH HOH C . JC 7 HOH 196 896 92 HOH HOH C . JC 7 HOH 197 897 166 HOH HOH C . JC 7 HOH 198 898 1481 HOH HOH C . JC 7 HOH 199 899 159 HOH HOH C . JC 7 HOH 200 900 1373 HOH HOH C . JC 7 HOH 201 901 952 HOH HOH C . JC 7 HOH 202 902 174 HOH HOH C . JC 7 HOH 203 903 740 HOH HOH C . JC 7 HOH 204 904 78 HOH HOH C . JC 7 HOH 205 905 861 HOH HOH C . JC 7 HOH 206 906 768 HOH HOH C . JC 7 HOH 207 907 346 HOH HOH C . JC 7 HOH 208 908 688 HOH HOH C . JC 7 HOH 209 909 85 HOH HOH C . JC 7 HOH 210 910 1378 HOH HOH C . JC 7 HOH 211 911 841 HOH HOH C . JC 7 HOH 212 912 761 HOH HOH C . JC 7 HOH 213 913 753 HOH HOH C . JC 7 HOH 214 914 690 HOH HOH C . JC 7 HOH 215 915 1209 HOH HOH C . JC 7 HOH 216 916 855 HOH HOH C . JC 7 HOH 217 917 110 HOH HOH C . JC 7 HOH 218 918 364 HOH HOH C . JC 7 HOH 219 919 348 HOH HOH C . JC 7 HOH 220 920 350 HOH HOH C . JC 7 HOH 221 921 185 HOH HOH C . JC 7 HOH 222 922 578 HOH HOH C . JC 7 HOH 223 923 189 HOH HOH C . JC 7 HOH 224 924 173 HOH HOH C . JC 7 HOH 225 925 744 HOH HOH C . JC 7 HOH 226 926 1483 HOH HOH C . JC 7 HOH 227 927 1284 HOH HOH C . JC 7 HOH 228 928 573 HOH HOH C . JC 7 HOH 229 929 1472 HOH HOH C . JC 7 HOH 230 930 924 HOH HOH C . JC 7 HOH 231 931 928 HOH HOH C . JC 7 HOH 232 932 130 HOH HOH C . JC 7 HOH 233 933 1165 HOH HOH C . JC 7 HOH 234 934 1142 HOH HOH C . JC 7 HOH 235 935 122 HOH HOH C . JC 7 HOH 236 936 140 HOH HOH C . JC 7 HOH 237 937 1021 HOH HOH C . JC 7 HOH 238 938 1351 HOH HOH C . JC 7 HOH 239 939 1396 HOH HOH C . JC 7 HOH 240 940 709 HOH HOH C . JC 7 HOH 241 941 1363 HOH HOH C . JC 7 HOH 242 942 368 HOH HOH C . JC 7 HOH 243 943 1350 HOH HOH C . JC 7 HOH 244 944 1398 HOH HOH C . JC 7 HOH 245 945 1352 HOH HOH C . JC 7 HOH 246 946 953 HOH HOH C . JC 7 HOH 247 947 1450 HOH HOH C . JC 7 HOH 248 948 143 HOH HOH C . JC 7 HOH 249 949 743 HOH HOH C . JC 7 HOH 250 950 710 HOH HOH C . JC 7 HOH 251 951 179 HOH HOH C . JC 7 HOH 252 952 116 HOH HOH C . JC 7 HOH 253 953 363 HOH HOH C . JC 7 HOH 254 954 345 HOH HOH C . JC 7 HOH 255 955 1451 HOH HOH C . JC 7 HOH 256 956 420 HOH HOH C . JC 7 HOH 257 957 340 HOH HOH C . JC 7 HOH 258 958 940 HOH HOH C . JC 7 HOH 259 959 854 HOH HOH C . JC 7 HOH 260 960 1349 HOH HOH C . JC 7 HOH 261 961 732 HOH HOH C . JC 7 HOH 262 962 860 HOH HOH C . JC 7 HOH 263 963 163 HOH HOH C . JC 7 HOH 264 964 929 HOH HOH C . JC 7 HOH 265 965 415 HOH HOH C . JC 7 HOH 266 966 1140 HOH HOH C . JC 7 HOH 267 967 1374 HOH HOH C . JC 7 HOH 268 968 376 HOH HOH C . JC 7 HOH 269 969 1371 HOH HOH C . JC 7 HOH 270 970 703 HOH HOH C . JC 7 HOH 271 971 590 HOH HOH C . JC 7 HOH 272 972 588 HOH HOH C . JC 7 HOH 273 973 843 HOH HOH C . JC 7 HOH 274 974 102 HOH HOH C . JC 7 HOH 275 975 341 HOH HOH C . JC 7 HOH 276 976 1424 HOH HOH C . JC 7 HOH 277 977 162 HOH HOH C . JC 7 HOH 278 978 121 HOH HOH C . JC 7 HOH 279 979 148 HOH HOH C . JC 7 HOH 280 980 587 HOH HOH C . JC 7 HOH 281 981 844 HOH HOH C . JC 7 HOH 282 982 1366 HOH HOH C . JC 7 HOH 283 983 1399 HOH HOH C . JC 7 HOH 284 984 125 HOH HOH C . JC 7 HOH 285 985 127 HOH HOH C . JC 7 HOH 286 986 658 HOH HOH C . JC 7 HOH 287 987 1414 HOH HOH C . JC 7 HOH 288 988 369 HOH HOH C . JC 7 HOH 289 989 1282 HOH HOH C . JC 7 HOH 290 990 365 HOH HOH C . JC 7 HOH 291 991 160 HOH HOH C . JC 7 HOH 292 992 581 HOH HOH C . JC 7 HOH 293 993 946 HOH HOH C . JC 7 HOH 294 994 955 HOH HOH C . JC 7 HOH 295 995 372 HOH HOH C . JC 7 HOH 296 996 1372 HOH HOH C . JC 7 HOH 297 997 943 HOH HOH C . JC 7 HOH 298 998 1079 HOH HOH C . JC 7 HOH 299 999 1377 HOH HOH C . JC 7 HOH 300 1000 145 HOH HOH C . JC 7 HOH 301 1001 344 HOH HOH C . JC 7 HOH 302 1002 1222 HOH HOH C . JC 7 HOH 303 1003 579 HOH HOH C . JC 7 HOH 304 1004 1417 HOH HOH C . JC 7 HOH 305 1005 1392 HOH HOH C . JC 7 HOH 306 1006 865 HOH HOH C . JC 7 HOH 307 1007 1408 HOH HOH C . JC 7 HOH 308 1008 1358 HOH HOH C . JC 7 HOH 309 1009 839 HOH HOH C . JC 7 HOH 310 1010 1210 HOH HOH C . JC 7 HOH 311 1011 1089 HOH HOH C . JC 7 HOH 312 1012 1364 HOH HOH C . JC 7 HOH 313 1013 1126 HOH HOH C . JC 7 HOH 314 1014 1033 HOH HOH C . JC 7 HOH 315 1015 1181 HOH HOH C . JC 7 HOH 316 1016 1032 HOH HOH C . JC 7 HOH 317 1017 1356 HOH HOH C . JC 7 HOH 318 1018 1423 HOH HOH C . JC 7 HOH 319 1019 477 HOH HOH C . JC 7 HOH 320 1020 1178 HOH HOH C . JC 7 HOH 321 1021 1157 HOH HOH C . JC 7 HOH 322 1022 1215 HOH HOH C . JC 7 HOH 323 1023 1416 HOH HOH C . JC 7 HOH 324 1024 1162 HOH HOH C . JC 7 HOH 325 1025 1422 HOH HOH C . JC 7 HOH 326 1026 1066 HOH HOH C . JC 7 HOH 327 1027 1362 HOH HOH C . JC 7 HOH 328 1028 1279 HOH HOH C . JC 7 HOH 329 1029 1137 HOH HOH C . JC 7 HOH 330 1030 1164 HOH HOH C . JC 7 HOH 331 1031 1393 HOH HOH C . JC 7 HOH 332 1032 1166 HOH HOH C . JC 7 HOH 333 1033 1482 HOH HOH C . JC 7 HOH 334 1034 1134 HOH HOH C . JC 7 HOH 335 1035 1365 HOH HOH C . JC 7 HOH 336 1036 919 HOH HOH C . JC 7 HOH 337 1037 1088 HOH HOH C . JC 7 HOH 338 1038 1077 HOH HOH C . KC 7 HOH 1 601 1236 HOH HOH D . KC 7 HOH 2 602 695 HOH HOH D . KC 7 HOH 3 603 366 HOH HOH D . KC 7 HOH 4 604 682 HOH HOH D . KC 7 HOH 5 605 677 HOH HOH D . KC 7 HOH 6 606 1436 HOH HOH D . KC 7 HOH 7 607 1053 HOH HOH D . KC 7 HOH 8 608 716 HOH HOH D . KC 7 HOH 9 609 361 HOH HOH D . KC 7 HOH 10 610 541 HOH HOH D . KC 7 HOH 11 611 319 HOH HOH D . KC 7 HOH 12 612 937 HOH HOH D . KC 7 HOH 13 613 685 HOH HOH D . KC 7 HOH 14 614 718 HOH HOH D . KC 7 HOH 15 615 318 HOH HOH D . KC 7 HOH 16 616 540 HOH HOH D . KC 7 HOH 17 617 546 HOH HOH D . KC 7 HOH 18 618 722 HOH HOH D . KC 7 HOH 19 619 60 HOH HOH D . KC 7 HOH 20 620 1444 HOH HOH D . KC 7 HOH 21 621 1405 HOH HOH D . KC 7 HOH 22 622 429 HOH HOH D . KC 7 HOH 23 623 89 HOH HOH D . KC 7 HOH 24 624 149 HOH HOH D . KC 7 HOH 25 625 529 HOH HOH D . KC 7 HOH 26 626 94 HOH HOH D . KC 7 HOH 27 627 362 HOH HOH D . KC 7 HOH 28 628 1138 HOH HOH D . KC 7 HOH 29 629 75 HOH HOH D . KC 7 HOH 30 630 681 HOH HOH D . KC 7 HOH 31 631 44 HOH HOH D . KC 7 HOH 32 632 1335 HOH HOH D . KC 7 HOH 33 633 297 HOH HOH D . KC 7 HOH 34 634 106 HOH HOH D . KC 7 HOH 35 635 697 HOH HOH D . KC 7 HOH 36 636 312 HOH HOH D . KC 7 HOH 37 637 418 HOH HOH D . KC 7 HOH 38 638 300 HOH HOH D . KC 7 HOH 39 639 1246 HOH HOH D . KC 7 HOH 40 640 47 HOH HOH D . KC 7 HOH 41 641 1020 HOH HOH D . KC 7 HOH 42 642 533 HOH HOH D . KC 7 HOH 43 643 2 HOH HOH D . KC 7 HOH 44 644 331 HOH HOH D . KC 7 HOH 45 645 1418 HOH HOH D . KC 7 HOH 46 646 294 HOH HOH D . KC 7 HOH 47 647 425 HOH HOH D . KC 7 HOH 48 648 723 HOH HOH D . KC 7 HOH 49 649 539 HOH HOH D . KC 7 HOH 50 650 705 HOH HOH D . KC 7 HOH 51 651 615 HOH HOH D . KC 7 HOH 52 652 308 HOH HOH D . KC 7 HOH 53 653 32 HOH HOH D . KC 7 HOH 54 654 301 HOH HOH D . KC 7 HOH 55 655 938 HOH HOH D . KC 7 HOH 56 656 105 HOH HOH D . KC 7 HOH 57 657 320 HOH HOH D . KC 7 HOH 58 658 107 HOH HOH D . KC 7 HOH 59 659 313 HOH HOH D . KC 7 HOH 60 660 154 HOH HOH D . KC 7 HOH 61 661 311 HOH HOH D . KC 7 HOH 62 662 646 HOH HOH D . KC 7 HOH 63 663 423 HOH HOH D . KC 7 HOH 64 664 648 HOH HOH D . KC 7 HOH 65 665 412 HOH HOH D . KC 7 HOH 66 666 33 HOH HOH D . KC 7 HOH 67 667 359 HOH HOH D . KC 7 HOH 68 668 291 HOH HOH D . KC 7 HOH 69 669 470 HOH HOH D . KC 7 HOH 70 670 34 HOH HOH D . KC 7 HOH 71 671 283 HOH HOH D . KC 7 HOH 72 672 170 HOH HOH D . KC 7 HOH 73 673 72 HOH HOH D . KC 7 HOH 74 674 1248 HOH HOH D . KC 7 HOH 75 675 327 HOH HOH D . KC 7 HOH 76 676 711 HOH HOH D . KC 7 HOH 77 677 316 HOH HOH D . KC 7 HOH 78 678 431 HOH HOH D . KC 7 HOH 79 679 96 HOH HOH D . KC 7 HOH 80 680 530 HOH HOH D . KC 7 HOH 81 681 1 HOH HOH D . KC 7 HOH 82 682 156 HOH HOH D . KC 7 HOH 83 683 413 HOH HOH D . KC 7 HOH 84 684 1390 HOH HOH D . KC 7 HOH 85 685 430 HOH HOH D . KC 7 HOH 86 686 872 HOH HOH D . KC 7 HOH 87 687 324 HOH HOH D . KC 7 HOH 88 688 181 HOH HOH D . KC 7 HOH 89 689 293 HOH HOH D . KC 7 HOH 90 690 98 HOH HOH D . KC 7 HOH 91 691 322 HOH HOH D . KC 7 HOH 92 692 961 HOH HOH D . KC 7 HOH 93 693 1247 HOH HOH D . KC 7 HOH 94 694 442 HOH HOH D . KC 7 HOH 95 695 696 HOH HOH D . KC 7 HOH 96 696 1464 HOH HOH D . KC 7 HOH 97 697 684 HOH HOH D . KC 7 HOH 98 698 726 HOH HOH D . KC 7 HOH 99 699 877 HOH HOH D . KC 7 HOH 100 700 472 HOH HOH D . KC 7 HOH 101 701 321 HOH HOH D . KC 7 HOH 102 702 190 HOH HOH D . KC 7 HOH 103 703 27 HOH HOH D . KC 7 HOH 104 704 542 HOH HOH D . KC 7 HOH 105 705 43 HOH HOH D . KC 7 HOH 106 706 1447 HOH HOH D . KC 7 HOH 107 707 527 HOH HOH D . KC 7 HOH 108 708 176 HOH HOH D . KC 7 HOH 109 709 315 HOH HOH D . KC 7 HOH 110 710 691 HOH HOH D . KC 7 HOH 111 711 280 HOH HOH D . KC 7 HOH 112 712 471 HOH HOH D . KC 7 HOH 113 713 426 HOH HOH D . KC 7 HOH 114 714 84 HOH HOH D . KC 7 HOH 115 715 16 HOH HOH D . KC 7 HOH 116 716 686 HOH HOH D . KC 7 HOH 117 717 547 HOH HOH D . KC 7 HOH 118 718 428 HOH HOH D . KC 7 HOH 119 719 165 HOH HOH D . KC 7 HOH 120 720 304 HOH HOH D . KC 7 HOH 121 721 305 HOH HOH D . KC 7 HOH 122 722 281 HOH HOH D . KC 7 HOH 123 723 377 HOH HOH D . KC 7 HOH 124 724 438 HOH HOH D . KC 7 HOH 125 725 476 HOH HOH D . KC 7 HOH 126 726 421 HOH HOH D . KC 7 HOH 127 727 9 HOH HOH D . KC 7 HOH 128 728 317 HOH HOH D . KC 7 HOH 129 729 51 HOH HOH D . KC 7 HOH 130 730 868 HOH HOH D . KC 7 HOH 131 731 433 HOH HOH D . KC 7 HOH 132 732 157 HOH HOH D . KC 7 HOH 133 733 880 HOH HOH D . KC 7 HOH 134 734 1342 HOH HOH D . KC 7 HOH 135 735 307 HOH HOH D . KC 7 HOH 136 736 290 HOH HOH D . KC 7 HOH 137 737 26 HOH HOH D . KC 7 HOH 138 738 1001 HOH HOH D . KC 7 HOH 139 739 694 HOH HOH D . KC 7 HOH 140 740 725 HOH HOH D . KC 7 HOH 141 741 700 HOH HOH D . KC 7 HOH 142 742 150 HOH HOH D . KC 7 HOH 143 743 707 HOH HOH D . KC 7 HOH 144 744 699 HOH HOH D . KC 7 HOH 145 745 886 HOH HOH D . KC 7 HOH 146 746 326 HOH HOH D . KC 7 HOH 147 747 693 HOH HOH D . KC 7 HOH 148 748 1463 HOH HOH D . KC 7 HOH 149 749 1341 HOH HOH D . KC 7 HOH 150 750 309 HOH HOH D . KC 7 HOH 151 751 302 HOH HOH D . KC 7 HOH 152 752 1223 HOH HOH D . KC 7 HOH 153 753 1435 HOH HOH D . KC 7 HOH 154 754 65 HOH HOH D . KC 7 HOH 155 755 528 HOH HOH D . KC 7 HOH 156 756 310 HOH HOH D . KC 7 HOH 157 757 671 HOH HOH D . KC 7 HOH 158 758 299 HOH HOH D . KC 7 HOH 159 759 414 HOH HOH D . KC 7 HOH 160 760 155 HOH HOH D . KC 7 HOH 161 761 169 HOH HOH D . KC 7 HOH 162 762 314 HOH HOH D . KC 7 HOH 163 763 375 HOH HOH D . KC 7 HOH 164 764 1462 HOH HOH D . KC 7 HOH 165 765 432 HOH HOH D . KC 7 HOH 166 766 1240 HOH HOH D . KC 7 HOH 167 767 411 HOH HOH D . KC 7 HOH 168 768 678 HOH HOH D . KC 7 HOH 169 769 323 HOH HOH D . KC 7 HOH 170 770 298 HOH HOH D . KC 7 HOH 171 771 409 HOH HOH D . KC 7 HOH 172 772 419 HOH HOH D . KC 7 HOH 173 773 325 HOH HOH D . KC 7 HOH 174 774 692 HOH HOH D . KC 7 HOH 175 775 404 HOH HOH D . KC 7 HOH 176 776 147 HOH HOH D . KC 7 HOH 177 777 303 HOH HOH D . KC 7 HOH 178 778 151 HOH HOH D . KC 7 HOH 179 779 525 HOH HOH D . KC 7 HOH 180 780 475 HOH HOH D . KC 7 HOH 181 781 925 HOH HOH D . KC 7 HOH 182 782 41 HOH HOH D . KC 7 HOH 183 783 256 HOH HOH D . KC 7 HOH 184 784 676 HOH HOH D . KC 7 HOH 185 785 883 HOH HOH D . KC 7 HOH 186 786 437 HOH HOH D . KC 7 HOH 187 787 1388 HOH HOH D . KC 7 HOH 188 788 330 HOH HOH D . KC 7 HOH 189 789 1109 HOH HOH D . KC 7 HOH 190 790 1025 HOH HOH D . KC 7 HOH 191 791 1334 HOH HOH D . KC 7 HOH 192 792 875 HOH HOH D . KC 7 HOH 193 793 713 HOH HOH D . KC 7 HOH 194 794 410 HOH HOH D . KC 7 HOH 195 795 440 HOH HOH D . KC 7 HOH 196 796 158 HOH HOH D . KC 7 HOH 197 797 720 HOH HOH D . KC 7 HOH 198 798 416 HOH HOH D . KC 7 HOH 199 799 1338 HOH HOH D . KC 7 HOH 200 800 42 HOH HOH D . KC 7 HOH 201 801 997 HOH HOH D . KC 7 HOH 202 802 152 HOH HOH D . KC 7 HOH 203 803 882 HOH HOH D . KC 7 HOH 204 804 427 HOH HOH D . KC 7 HOH 205 805 212 HOH HOH D . KC 7 HOH 206 806 1339 HOH HOH D . KC 7 HOH 207 807 543 HOH HOH D . KC 7 HOH 208 808 931 HOH HOH D . KC 7 HOH 209 809 534 HOH HOH D . KC 7 HOH 210 810 1476 HOH HOH D . KC 7 HOH 211 811 405 HOH HOH D . KC 7 HOH 212 812 1337 HOH HOH D . KC 7 HOH 213 813 719 HOH HOH D . KC 7 HOH 214 814 329 HOH HOH D . KC 7 HOH 215 815 1241 HOH HOH D . KC 7 HOH 216 816 441 HOH HOH D . KC 7 HOH 217 817 1243 HOH HOH D . KC 7 HOH 218 818 544 HOH HOH D . KC 7 HOH 219 819 473 HOH HOH D . KC 7 HOH 220 820 721 HOH HOH D . KC 7 HOH 221 821 724 HOH HOH D . KC 7 HOH 222 822 537 HOH HOH D . KC 7 HOH 223 823 679 HOH HOH D . KC 7 HOH 224 824 939 HOH HOH D . KC 7 HOH 225 825 1443 HOH HOH D . KC 7 HOH 226 826 1239 HOH HOH D . KC 7 HOH 227 827 1159 HOH HOH D . KC 7 HOH 228 828 876 HOH HOH D . KC 7 HOH 229 829 474 HOH HOH D . KC 7 HOH 230 830 1067 HOH HOH D . KC 7 HOH 231 831 1113 HOH HOH D . KC 7 HOH 232 832 1071 HOH HOH D . KC 7 HOH 233 833 644 HOH HOH D . KC 7 HOH 234 834 1046 HOH HOH D . KC 7 HOH 235 835 998 HOH HOH D . KC 7 HOH 236 836 870 HOH HOH D . KC 7 HOH 237 837 1068 HOH HOH D . KC 7 HOH 238 838 1098 HOH HOH D . KC 7 HOH 239 839 1107 HOH HOH D . KC 7 HOH 240 840 1234 HOH HOH D . KC 7 HOH 241 841 1102 HOH HOH D . KC 7 HOH 242 842 1114 HOH HOH D . KC 7 HOH 243 843 1055 HOH HOH D . KC 7 HOH 244 844 874 HOH HOH D . KC 7 HOH 245 845 1054 HOH HOH D . KC 7 HOH 246 846 1112 HOH HOH D . KC 7 HOH 247 847 1104 HOH HOH D . KC 7 HOH 248 848 1101 HOH HOH D . KC 7 HOH 249 849 708 HOH HOH D . KC 7 HOH 250 850 1108 HOH HOH D . KC 7 HOH 251 851 1190 HOH HOH D . KC 7 HOH 252 852 1099 HOH HOH D . KC 7 HOH 253 853 1144 HOH HOH D . KC 7 HOH 254 854 1235 HOH HOH D . KC 7 HOH 255 855 1034 HOH HOH D . KC 7 HOH 256 856 1103 HOH HOH D . KC 7 HOH 257 857 1030 HOH HOH D . KC 7 HOH 258 858 1105 HOH HOH D . KC 7 HOH 259 859 1100 HOH HOH D . KC 7 HOH 260 860 1336 HOH HOH D . KC 7 HOH 261 861 1111 HOH HOH D . KC 7 HOH 262 862 1063 HOH HOH D . KC 7 HOH 263 863 1389 HOH HOH D . KC 7 HOH 264 864 1428 HOH HOH D . KC 7 HOH 265 865 1044 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,HC,IC 2 1 C,D,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB,UB,VB,WB,XB,YB,ZB,AC,BC,CC,DC,EC,FC,GC,JC,KC # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11170 ? 1 MORE 46 ? 1 'SSA (A^2)' 47030 ? 2 'ABSA (A^2)' 13950 ? 2 MORE 84 ? 2 'SSA (A^2)' 47420 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 OE1 ? A GLU 480 ? A GLU 478 ? 1_555 99.7 ? 2 OD1 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 OD1 ? A ASP 500 ? A ASP 498 ? 1_555 109.0 ? 3 OE1 ? A GLU 480 ? A GLU 478 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 OD1 ? A ASP 500 ? A ASP 498 ? 1_555 105.7 ? 4 OD1 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 83.6 ? 5 OE1 ? A GLU 480 ? A GLU 478 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 121.1 ? 6 OD1 ? A ASP 500 ? A ASP 498 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 128.9 ? 7 OD1 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O2 ? G ZW2 . ? A ZW2 603 ? 1_555 158.1 ? 8 OE1 ? A GLU 480 ? A GLU 478 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O2 ? G ZW2 . ? A ZW2 603 ? 1_555 91.6 ? 9 OD1 ? A ASP 500 ? A ASP 498 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O2 ? G ZW2 . ? A ZW2 603 ? 1_555 85.6 ? 10 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? E MN . ? A MN 601 ? 1_555 O2 ? G ZW2 . ? A ZW2 603 ? 1_555 74.5 ? 11 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 102.7 ? 12 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 174.9 ? 13 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 81.8 ? 14 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 121.9 ? 15 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 134.2 ? 16 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 54.3 ? 17 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 93.9 ? 18 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 163.4 ? 19 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 81.8 ? 20 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 29.4 ? 21 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 777 ? 1_555 91.3 ? 22 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 777 ? 1_555 88.8 ? 23 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 777 ? 1_555 91.3 ? 24 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 777 ? 1_555 80.7 ? 25 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 777 ? 1_555 89.1 ? 26 OD2 ? A ASP 445 ? A ASP 443 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 88.2 ? 27 OD1 ? A ASP 551 ? A ASP 549 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 99.8 ? 28 O3 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 88.6 ? 29 N1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 92.2 ? 30 O1 ? G ZW2 . ? A ZW2 603 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 82.3 ? 31 O ? HC HOH . ? A HOH 777 ? 1_555 MN ? F MN . ? A MN 602 ? 1_555 O ? HC HOH . ? A HOH 783 ? 1_555 171.3 ? 32 OD1 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 OE1 ? C GLU 480 ? C GLU 478 ? 1_555 92.1 ? 33 OD1 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 OD1 ? C ASP 500 ? C ASP 498 ? 1_555 107.3 ? 34 OE1 ? C GLU 480 ? C GLU 478 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 OD1 ? C ASP 500 ? C ASP 498 ? 1_555 104.3 ? 35 OD1 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 83.3 ? 36 OE1 ? C GLU 480 ? C GLU 478 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 117.1 ? 37 OD1 ? C ASP 500 ? C ASP 498 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 137.0 ? 38 OD1 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 N1 ? VA ZW2 . ? C ZW2 603 ? 1_555 110.6 ? 39 OE1 ? C GLU 480 ? C GLU 478 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 N1 ? VA ZW2 . ? C ZW2 603 ? 1_555 118.8 ? 40 OD1 ? C ASP 500 ? C ASP 498 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 N1 ? VA ZW2 . ? C ZW2 603 ? 1_555 119.9 ? 41 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 N1 ? VA ZW2 . ? C ZW2 603 ? 1_555 27.7 ? 42 OD1 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O3 ? VA ZW2 . ? C ZW2 603 ? 1_555 161.4 ? 43 OE1 ? C GLU 480 ? C GLU 478 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O3 ? VA ZW2 . ? C ZW2 603 ? 1_555 91.6 ? 44 OD1 ? C ASP 500 ? C ASP 498 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O3 ? VA ZW2 . ? C ZW2 603 ? 1_555 89.5 ? 45 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O3 ? VA ZW2 . ? C ZW2 603 ? 1_555 78.7 ? 46 N1 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? TA MN . ? C MN 601 ? 1_555 O3 ? VA ZW2 . ? C ZW2 603 ? 1_555 52.1 ? 47 OD2 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 OD1 ? C ASP 551 ? C ASP 549 ? 1_555 102.3 ? 48 OD2 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O2 ? VA ZW2 . ? C ZW2 603 ? 1_555 166.5 ? 49 OD1 ? C ASP 551 ? C ASP 549 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O2 ? VA ZW2 . ? C ZW2 603 ? 1_555 91.0 ? 50 OD2 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 91.1 ? 51 OD1 ? C ASP 551 ? C ASP 549 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 165.7 ? 52 O2 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 76.0 ? 53 OD2 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 755 ? 1_555 92.0 ? 54 OD1 ? C ASP 551 ? C ASP 549 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 755 ? 1_555 88.5 ? 55 O2 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 755 ? 1_555 90.9 ? 56 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 755 ? 1_555 85.8 ? 57 OD2 ? C ASP 445 ? C ASP 443 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 882 ? 1_555 91.2 ? 58 OD1 ? C ASP 551 ? C ASP 549 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 882 ? 1_555 98.0 ? 59 O2 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 882 ? 1_555 84.4 ? 60 O1 ? VA ZW2 . ? C ZW2 603 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 882 ? 1_555 86.8 ? 61 O ? JC HOH . ? C HOH 755 ? 1_555 MN ? UA MN . ? C MN 602 ? 1_555 O ? JC HOH . ? C HOH 882 ? 1_555 172.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-08 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.value' 15 3 'Structure model' '_struct_conn.pdbx_dist_value' 16 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -12.6082 _pdbx_refine_tls.origin_y 29.8951 _pdbx_refine_tls.origin_z -11.1644 _pdbx_refine_tls.T[1][1] 0.2257 _pdbx_refine_tls.T[2][2] 0.3088 _pdbx_refine_tls.T[3][3] 0.3325 _pdbx_refine_tls.T[1][2] -0.0231 _pdbx_refine_tls.T[1][3] 0.0286 _pdbx_refine_tls.T[2][3] -0.0115 _pdbx_refine_tls.L[1][1] 0.0302 _pdbx_refine_tls.L[2][2] 0.2402 _pdbx_refine_tls.L[3][3] 0.3924 _pdbx_refine_tls.L[1][2] -0.1207 _pdbx_refine_tls.L[1][3] 0.2069 _pdbx_refine_tls.L[2][3] -0.1516 _pdbx_refine_tls.S[1][1] -0.0046 _pdbx_refine_tls.S[2][2] -0.0050 _pdbx_refine_tls.S[3][3] 0.0195 _pdbx_refine_tls.S[1][2] 0.0361 _pdbx_refine_tls.S[1][3] 0.0006 _pdbx_refine_tls.S[2][3] -0.0824 _pdbx_refine_tls.S[2][1] 0.0018 _pdbx_refine_tls.S[3][1] -0.0477 _pdbx_refine_tls.S[3][2] 0.0284 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 562 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 0 B 428 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C -1 C 562 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 D 4 D 428 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 L 1 L 11 all ? ? ? ? ? 'X-RAY DIFFRACTION' 6 1 W 1 W 1483 all ? ? ? ? ? 'X-RAY DIFFRACTION' 7 1 I 1 I 90 all ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? 0.4.0.338 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MrBUMP ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 C GLU 122 ? ? O C HOH 701 ? ? 1.82 2 1 OG1 C THR 7 ? ? O C HOH 701 ? ? 1.82 3 1 O D HOH 750 ? ? O D HOH 842 ? ? 1.88 4 1 O A TYR 56 ? ? NH2 A ARG 143 ? ? 1.88 5 1 OE1 A GLN 500 ? ? O A HOH 701 ? ? 2.00 6 1 O C HOH 760 ? ? O C HOH 1011 ? ? 2.01 7 1 O D HOH 648 ? ? O D HOH 821 ? ? 2.02 8 1 OG1 A THR 131 ? ? NH1 A ARG 143 ? ? 2.03 9 1 OE2 B GLU 415 ? ? O B HOH 601 ? ? 2.03 10 1 O B HOH 839 ? ? O B HOH 869 ? ? 2.03 11 1 O A HOH 850 ? ? O A HOH 929 ? ? 2.03 12 1 O C HOH 896 ? ? O C HOH 931 ? ? 2.04 13 1 O A LYS 353 ? ? O A HOH 702 ? ? 2.04 14 1 O D HOH 783 ? ? O D HOH 861 ? ? 2.04 15 1 O D VAL 75 ? ? O4 D PGE 501 ? ? 2.06 16 1 OE1 A GLN 475 ? ? O A HOH 703 ? ? 2.08 17 1 OE2 B GLU 404 ? ? O B HOH 602 ? ? 2.09 18 1 O A LYS 249 ? ? O A HOH 704 ? ? 2.12 19 1 O A HOH 833 ? ? O A HOH 943 ? ? 2.12 20 1 OD2 C ASP 364 ? ? O C HOH 702 ? ? 2.13 21 1 OE1 B GLU 42 ? ? O B HOH 603 ? ? 2.13 22 1 NE2 C GLN 373 ? ? O C HOH 703 ? ? 2.13 23 1 OD1 D ASP 177 ? ? O D HOH 602 ? ? 2.14 24 1 NZ A LYS 64 ? ? O A LYS 70 ? ? 2.14 25 1 O C HOH 831 ? ? O C HOH 1029 ? ? 2.14 26 1 O A HOH 938 ? ? O A HOH 941 ? ? 2.14 27 1 O C PRO 247 ? ? NH2 C ARG 307 ? B 2.15 28 1 NE2 A GLN 509 ? B O A HOH 705 ? ? 2.16 29 1 NZ A LYS 323 ? ? OE2 A GLU 344 ? ? 2.16 30 1 O A TRP 153 ? ? O A HOH 706 ? ? 2.16 31 1 NZ A LYS 374 ? ? O A HOH 702 ? ? 2.16 32 1 O B MET 230 ? ? O B HOH 604 ? ? 2.16 33 1 O B HOH 656 ? ? O B HOH 865 ? ? 2.17 34 1 N B VAL 423 ? ? OE1 C GLU 138 ? ? 2.17 35 1 O2 C EDO 620 ? ? O C HOH 704 ? ? 2.18 36 1 O C SER 134 ? B O C HOH 705 ? ? 2.18 37 1 O B HOH 762 ? ? O B HOH 802 ? ? 2.18 38 1 NH2 A ARG 211 ? ? O A HOH 707 ? ? 2.19 39 1 NZ C LYS 374 ? ? O C HOH 703 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 908 ? ? 1_555 O D HOH 757 ? ? 1_656 2.08 2 1 OE1 A GLU 399 ? ? 1_555 O D HOH 662 ? ? 1_656 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 67 ? ? 56.52 74.81 2 1 GLN A 85 ? ? -47.96 156.22 3 1 GLU A 138 ? ? -140.76 -49.01 4 1 MET A 184 ? ? 49.32 -124.51 5 1 THR A 286 ? ? -89.48 37.22 6 1 GLN B 85 ? ? -43.15 150.57 7 1 GLN B 91 ? ? 76.15 33.21 8 1 ASP B 121 ? ? -39.38 123.86 9 1 MET B 184 ? ? 50.73 -122.55 10 1 GLU B 224 ? ? -140.14 20.70 11 1 LYS B 347 ? ? -118.00 79.11 12 1 THR B 362 ? ? -142.73 -30.17 13 1 GLN C 85 ? ? -49.78 157.41 14 1 SER C 134 ? B -28.46 -99.56 15 1 ILE C 135 ? B 154.71 -37.90 16 1 ASN C 137 ? ? 60.94 -6.67 17 1 MET C 184 ? ? 56.09 -128.85 18 1 GLN C 332 ? ? -110.62 74.90 19 1 GLN D 91 ? ? 70.66 42.93 20 1 ASP D 121 ? ? -37.80 127.71 21 1 ILE D 142 ? ? -66.21 96.86 22 1 MET D 184 ? ? 50.19 -117.17 23 1 MET D 184 ? ? 49.17 -116.53 24 1 PRO D 225 ? ? -113.97 72.11 25 1 PRO D 226 ? ? -102.20 -157.82 26 1 LYS D 347 ? ? -118.70 79.20 27 1 ARG D 356 ? ? -44.90 103.01 28 1 MET D 357 ? ? -57.01 8.01 29 1 THR D 419 ? ? -34.60 127.03 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 67 ? ? SER A 68 ? ? 146.14 2 1 MET D 357 ? ? ARG D 358 ? ? -141.41 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 B GLY 93 ? N A B GLY 94 N 2 1 Y 0 B GLY 93 ? CA A B GLY 94 CA 3 1 Y 0 B GLY 93 ? C A B GLY 94 C 4 1 Y 0 B GLY 93 ? O A B GLY 94 O 5 1 Y 0 D PRO 140 ? N A D PRO 141 N 6 1 Y 0 D PRO 140 ? CA A D PRO 141 CA 7 1 Y 0 D PRO 140 ? C A D PRO 141 C 8 1 Y 0 D PRO 140 ? O A D PRO 141 O 9 1 Y 0 D PRO 140 ? CB A D PRO 141 CB 10 1 Y 0 D PRO 140 ? CG A D PRO 141 CG 11 1 Y 0 D PRO 140 ? CD A D PRO 141 CD 12 1 Y 0 D GLY 141 ? N A D GLY 142 N 13 1 Y 0 D GLY 141 ? CA A D GLY 142 CA 14 1 Y 0 D GLY 141 ? C A D GLY 142 C 15 1 Y 0 D GLY 141 ? O A D GLY 142 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -1 ? A MET 1 2 1 Y 1 A VAL 0 ? A VAL 2 3 1 Y 1 B LYS 218 A B LYS 220 4 1 Y 1 B LYS 218 B B LYS 221 5 1 Y 1 B HIS 218 C B HIS 222 6 1 Y 1 B GLN 218 D B GLN 223 7 1 Y 1 D GLY 0 ? D GLY 1 8 1 Y 1 D PRO 1 ? D PRO 2 9 1 Y 1 D ILE 2 ? D ILE 3 10 1 Y 1 D SER 3 ? D SER 4 11 1 Y 1 D THR 215 ? D THR 216 12 1 Y 1 D THR 216 ? D THR 217 13 1 Y 1 D PRO 217 ? D PRO 218 14 1 Y 1 D ASP 218 ? D ASP 219 15 1 Y 1 D LYS 219 ? D LYS 220 16 1 Y 1 D LYS 220 ? D LYS 221 17 1 Y 1 D HIS 221 ? D HIS 222 18 1 Y 1 D GLN 222 ? D GLN 223 19 1 Y 1 D LYS 223 ? D LYS 224 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 MN MN MN N N 260 PGE C1 C N N 261 PGE O1 O N N 262 PGE C2 C N N 263 PGE O2 O N N 264 PGE C3 C N N 265 PGE C4 C N N 266 PGE O4 O N N 267 PGE C6 C N N 268 PGE C5 C N N 269 PGE O3 O N N 270 PGE H1 H N N 271 PGE H12 H N N 272 PGE HO1 H N N 273 PGE H2 H N N 274 PGE H22 H N N 275 PGE H3 H N N 276 PGE H32 H N N 277 PGE H4 H N N 278 PGE H42 H N N 279 PGE HO4 H N N 280 PGE H6 H N N 281 PGE H62 H N N 282 PGE H5 H N N 283 PGE H52 H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 ZW2 C1 C N N 426 ZW2 C10 C Y N 427 ZW2 C11 C Y N 428 ZW2 C12 C Y N 429 ZW2 C13 C Y N 430 ZW2 C2 C Y N 431 ZW2 C3 C Y N 432 ZW2 C4 C N N 433 ZW2 C5 C Y N 434 ZW2 C6 C Y N 435 ZW2 C7 C N N 436 ZW2 C8 C Y N 437 ZW2 C9 C Y N 438 ZW2 N1 N N N 439 ZW2 N2 N N N 440 ZW2 O1 O N N 441 ZW2 O2 O N N 442 ZW2 O3 O N N 443 ZW2 S S Y N 444 ZW2 H1 H N N 445 ZW2 H2 H N N 446 ZW2 H3 H N N 447 ZW2 H4 H N N 448 ZW2 H5 H N N 449 ZW2 H6 H N N 450 ZW2 H7 H N N 451 ZW2 H8 H N N 452 ZW2 H9 H N N 453 ZW2 H10 H N N 454 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PGE C1 O1 sing N N 246 PGE C1 C2 sing N N 247 PGE C1 H1 sing N N 248 PGE C1 H12 sing N N 249 PGE O1 HO1 sing N N 250 PGE C2 O2 sing N N 251 PGE C2 H2 sing N N 252 PGE C2 H22 sing N N 253 PGE O2 C3 sing N N 254 PGE C3 C4 sing N N 255 PGE C3 H3 sing N N 256 PGE C3 H32 sing N N 257 PGE C4 O3 sing N N 258 PGE C4 H4 sing N N 259 PGE C4 H42 sing N N 260 PGE O4 C6 sing N N 261 PGE O4 HO4 sing N N 262 PGE C6 C5 sing N N 263 PGE C6 H6 sing N N 264 PGE C6 H62 sing N N 265 PGE C5 O3 sing N N 266 PGE C5 H5 sing N N 267 PGE C5 H52 sing N N 268 PHE N CA sing N N 269 PHE N H sing N N 270 PHE N H2 sing N N 271 PHE CA C sing N N 272 PHE CA CB sing N N 273 PHE CA HA sing N N 274 PHE C O doub N N 275 PHE C OXT sing N N 276 PHE CB CG sing N N 277 PHE CB HB2 sing N N 278 PHE CB HB3 sing N N 279 PHE CG CD1 doub Y N 280 PHE CG CD2 sing Y N 281 PHE CD1 CE1 sing Y N 282 PHE CD1 HD1 sing N N 283 PHE CD2 CE2 doub Y N 284 PHE CD2 HD2 sing N N 285 PHE CE1 CZ doub Y N 286 PHE CE1 HE1 sing N N 287 PHE CE2 CZ sing Y N 288 PHE CE2 HE2 sing N N 289 PHE CZ HZ sing N N 290 PHE OXT HXT sing N N 291 PRO N CA sing N N 292 PRO N CD sing N N 293 PRO N H sing N N 294 PRO CA C sing N N 295 PRO CA CB sing N N 296 PRO CA HA sing N N 297 PRO C O doub N N 298 PRO C OXT sing N N 299 PRO CB CG sing N N 300 PRO CB HB2 sing N N 301 PRO CB HB3 sing N N 302 PRO CG CD sing N N 303 PRO CG HG2 sing N N 304 PRO CG HG3 sing N N 305 PRO CD HD2 sing N N 306 PRO CD HD3 sing N N 307 PRO OXT HXT sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 ZW2 C12 C13 doub Y N 408 ZW2 C12 C11 sing Y N 409 ZW2 C13 C8 sing Y N 410 ZW2 C11 C10 doub Y N 411 ZW2 C8 C7 sing N N 412 ZW2 C8 C9 doub Y N 413 ZW2 C10 C9 sing Y N 414 ZW2 C7 C6 sing N N 415 ZW2 C6 S sing Y N 416 ZW2 C6 C5 doub Y N 417 ZW2 S C3 sing Y N 418 ZW2 C5 C2 sing Y N 419 ZW2 C3 C2 doub Y N 420 ZW2 C3 N2 sing N N 421 ZW2 C2 C1 sing N N 422 ZW2 N2 C4 sing N N 423 ZW2 C1 O2 doub N N 424 ZW2 C1 N1 sing N N 425 ZW2 C4 N1 sing N N 426 ZW2 C4 O3 doub N N 427 ZW2 N1 O1 sing N N 428 ZW2 C10 H1 sing N N 429 ZW2 C11 H2 sing N N 430 ZW2 C12 H3 sing N N 431 ZW2 C13 H4 sing N N 432 ZW2 C5 H5 sing N N 433 ZW2 C7 H6 sing N N 434 ZW2 C7 H7 sing N N 435 ZW2 C9 H8 sing N N 436 ZW2 N2 H9 sing N N 437 ZW2 O1 H10 sing N N 438 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI100890 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MANGANESE (II) ION' MN 4 '6-benzyl-3-hydroxythieno[2,3-d]pyrimidine-2,4(1H,3H)-dione' ZW2 5 'TRIETHYLENE GLYCOL' PGE 6 1,2-ETHANEDIOL EDO 7 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KFB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Determined by PISA v1.52 to be dimeric.' #