data_6AS9 # _entry.id 6AS9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6AS9 WWPDB D_1000229750 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same protein with different packing' 5HGE unspecified PDB 'same protein with different packing' 5HBD unspecified PDB 'same protein with different packing' 5HW9 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AS9 _pdbx_database_status.recvd_initial_deposition_date 2017-08-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sawaya, M.R.' 1 0000-0003-0874-9043 'Heller, D.M.' 2 ? 'McPartland, L.' 3 ? 'Hochschild, A.' 4 ? 'Eisenberg, D.S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Struct. Mol. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first 705 _citation.page_last 714 _citation.title 'Atomic insights into the genesis of cellular filaments by globular proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-018-0096-7 _citation.pdbx_database_id_PubMed 30076408 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McPartland, L.' 1 ? primary 'Heller, D.M.' 2 ? primary 'Eisenberg, D.S.' 3 0000-0003-2432-5419 primary 'Hochschild, A.' 4 0000-0003-4807-9865 primary 'Sawaya, M.R.' 5 0000-0003-0874-9043 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6AS9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.100 _cell.length_a_esd ? _cell.length_b 54.520 _cell.length_b_esd ? _cell.length_c 85.470 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AS9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 28950.619 1 ? ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 2 ? ? ? ? 4 water nat water 18.015 212 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF(PIA)LQCFARYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQK NGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK AMAKETAAAKFDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFAYGLQCFARYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKAM AKETAAAKFDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 PHE n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 VAL n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 GLY n 1 25 HIS n 1 26 LYS n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 SER n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ALA n 1 38 THR n 1 39 TYR n 1 40 GLY n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 LEU n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 PRO n 1 57 TRP n 1 58 PRO n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 THR n 1 63 THR n 1 64 PHE n 1 65 PIA n 1 66 LEU n 1 67 GLN n 1 68 CYS n 1 69 PHE n 1 70 ALA n 1 71 ARG n 1 72 TYR n 1 73 PRO n 1 74 ASP n 1 75 HIS n 1 76 MET n 1 77 LYS n 1 78 GLN n 1 79 HIS n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 SER n 1 85 ALA n 1 86 MET n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 TYR n 1 91 VAL n 1 92 GLN n 1 93 GLU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PHE n 1 98 PHE n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 GLY n 1 103 ASN n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 ASP n 1 116 THR n 1 117 LEU n 1 118 VAL n 1 119 ASN n 1 120 ARG n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ASP n 1 128 PHE n 1 129 LYS n 1 130 GLU n 1 131 ASP n 1 132 GLY n 1 133 ASN n 1 134 ILE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 GLU n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 ASN n 1 145 SER n 1 146 HIS n 1 147 ASN n 1 148 VAL n 1 149 TYR n 1 150 ILE n 1 151 MET n 1 152 ALA n 1 153 ASP n 1 154 LYS n 1 155 GLN n 1 156 LYS n 1 157 ASN n 1 158 GLY n 1 159 ILE n 1 160 LYS n 1 161 VAL n 1 162 ASN n 1 163 PHE n 1 164 LYS n 1 165 ILE n 1 166 ARG n 1 167 HIS n 1 168 ASN n 1 169 ILE n 1 170 GLU n 1 171 ASP n 1 172 GLY n 1 173 SER n 1 174 VAL n 1 175 GLN n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 HIS n 1 180 TYR n 1 181 GLN n 1 182 GLN n 1 183 ASN n 1 184 THR n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 ASP n 1 189 GLY n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 ASP n 1 196 ASN n 1 197 HIS n 1 198 TYR n 1 199 LEU n 1 200 SER n 1 201 THR n 1 202 GLN n 1 203 SER n 1 204 ALA n 1 205 LEU n 1 206 SER n 1 207 LYS n 1 208 ASP n 1 209 PRO n 1 210 ASN n 1 211 GLU n 1 212 LYS n 1 213 ARG n 1 214 ASP n 1 215 HIS n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LEU n 1 220 GLU n 1 221 PHE n 1 222 VAL n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ILE n 1 228 THR n 1 229 HIS n 1 230 GLY n 1 231 MET n 1 232 ASP n 1 233 GLU n 1 234 LEU n 1 235 TYR n 1 236 LYS n 1 237 ALA n 1 238 MET n 1 239 ALA n 1 240 LYS n 1 241 GLU n 1 242 THR n 1 243 ALA n 1 244 ALA n 1 245 ALA n 1 246 LYS n 1 247 PHE n 1 248 ASP n 1 249 HIS n 1 250 HIS n 1 251 HIS n 1 252 HIS n 1 253 HIS n 1 254 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 254 _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AS9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AS9 PIA A 65 ? UNP P42212 SER 65 chromophore 66 1 1 6AS9 PIA A 65 ? UNP P42212 TYR 66 chromophore 66 2 1 6AS9 PIA A 65 ? UNP P42212 GLY 67 chromophore 66 3 1 6AS9 LEU A 66 ? UNP P42212 VAL 68 conflict 68 4 1 6AS9 ALA A 70 ? UNP P42212 SER 72 conflict 72 5 1 6AS9 ALA A 237 ? UNP P42212 ? ? 'expression tag' 239 6 1 6AS9 MET A 238 ? UNP P42212 ? ? 'expression tag' 240 7 1 6AS9 ALA A 239 ? UNP P42212 ? ? 'expression tag' 241 8 1 6AS9 LYS A 240 ? UNP P42212 ? ? 'expression tag' 242 9 1 6AS9 GLU A 241 ? UNP P42212 ? ? 'expression tag' 243 10 1 6AS9 THR A 242 ? UNP P42212 ? ? 'expression tag' 244 11 1 6AS9 ALA A 243 ? UNP P42212 ? ? 'expression tag' 245 12 1 6AS9 ALA A 244 ? UNP P42212 ? ? 'expression tag' 246 13 1 6AS9 ALA A 245 ? UNP P42212 ? ? 'expression tag' 247 14 1 6AS9 LYS A 246 ? UNP P42212 ? ? 'expression tag' 248 15 1 6AS9 PHE A 247 ? UNP P42212 ? ? 'expression tag' 249 16 1 6AS9 ASP A 248 ? UNP P42212 ? ? 'expression tag' 250 17 1 6AS9 HIS A 249 ? UNP P42212 ? ? 'expression tag' 251 18 1 6AS9 HIS A 250 ? UNP P42212 ? ? 'expression tag' 252 19 1 6AS9 HIS A 251 ? UNP P42212 ? ? 'expression tag' 253 20 1 6AS9 HIS A 252 ? UNP P42212 ? ? 'expression tag' 254 21 1 6AS9 HIS A 253 ? UNP P42212 ? ? 'expression tag' 255 22 1 6AS9 HIS A 254 ? UNP P42212 ? ? 'expression tag' 256 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PIA 'L-peptide linking' n '[(4Z)-2-[(1S)-1-aminoethyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 'C14 H15 N3 O4' 289.287 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AS9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium acetate, pH 5.0 and 65% (v/v) 2-methyl-2,4-pentanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 13.630 _reflns.entry_id 6AS9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.750 _reflns.d_resolution_low 45.960 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24417 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.170 _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.070 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.963 _reflns.pdbx_scaling_rejects 8 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.126 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 175062 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.750 1.800 ? 3.760 ? ? ? ? 1743 98.500 ? ? ? ? 0.585 ? ? ? ? ? ? ? ? 7.009 ? ? ? ? 0.630 ? ? 1 1 0.857 ? 1.800 1.850 ? 4.640 ? ? ? ? 1722 98.300 ? ? ? ? 0.481 ? ? ? ? ? ? ? ? 7.162 ? ? ? ? 0.518 ? ? 2 1 0.913 ? 1.850 1.900 ? 5.850 ? ? ? ? 1670 98.700 ? ? ? ? 0.383 ? ? ? ? ? ? ? ? 7.199 ? ? ? ? 0.412 ? ? 3 1 0.946 ? 1.900 1.960 ? 7.720 ? ? ? ? 1631 99.100 ? ? ? ? 0.288 ? ? ? ? ? ? ? ? 7.231 ? ? ? ? 0.310 ? ? 4 1 0.970 ? 1.960 2.030 ? 9.240 ? ? ? ? 1609 99.600 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 7.331 ? ? ? ? 0.255 ? ? 5 1 0.979 ? 2.030 2.100 ? 10.550 ? ? ? ? 1516 99.100 ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 7.342 ? ? ? ? 0.215 ? ? 6 1 0.982 ? 2.100 2.180 ? 11.520 ? ? ? ? 1490 99.100 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 7.332 ? ? ? ? 0.193 ? ? 7 1 0.986 ? 2.180 2.260 ? 12.640 ? ? ? ? 1451 99.500 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 7.306 ? ? ? ? 0.172 ? ? 8 1 0.988 ? 2.260 2.370 ? 12.970 ? ? ? ? 1381 99.500 ? ? ? ? 0.151 ? ? ? ? ? ? ? ? 7.299 ? ? ? ? 0.163 ? ? 9 1 0.989 ? 2.370 2.480 ? 14.690 ? ? ? ? 1316 99.700 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 7.264 ? ? ? ? 0.136 ? ? 10 1 0.991 ? 2.480 2.610 ? 15.260 ? ? ? ? 1263 99.800 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 7.266 ? ? ? ? 0.132 ? ? 11 1 0.991 ? 2.610 2.770 ? 16.460 ? ? ? ? 1204 99.800 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 7.225 ? ? ? ? 0.115 ? ? 12 1 0.995 ? 2.770 2.960 ? 19.010 ? ? ? ? 1126 99.700 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 7.182 ? ? ? ? 0.102 ? ? 13 1 0.995 ? 2.960 3.200 ? 22.390 ? ? ? ? 1070 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 7.036 ? ? ? ? 0.082 ? ? 14 1 0.996 ? 3.200 3.510 ? 25.460 ? ? ? ? 973 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.948 ? ? ? ? 0.072 ? ? 15 1 0.996 ? 3.510 3.920 ? 28.380 ? ? ? ? 909 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 7.013 ? ? ? ? 0.063 ? ? 16 1 0.997 ? 3.920 4.530 ? 30.220 ? ? ? ? 790 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.996 ? ? ? ? 0.059 ? ? 17 1 0.997 ? 4.530 5.550 ? 29.840 ? ? ? ? 684 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 6.974 ? ? ? ? 0.055 ? ? 18 1 0.998 ? 5.550 7.840 ? 26.450 ? ? ? ? 543 99.800 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 6.781 ? ? ? ? 0.062 ? ? 19 1 0.997 ? 7.840 45.960 ? 28.900 ? ? ? ? 326 99.700 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 6.132 ? ? ? ? 0.057 ? ? 20 1 0.996 ? # _refine.aniso_B[1][1] -0.4214 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.1361 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.2853 _refine.B_iso_max 124.400 _refine.B_iso_mean 15.7600 _refine.B_iso_min 3.490 _refine.correlation_coeff_Fo_to_Fc 0.9561 _refine.correlation_coeff_Fo_to_Fc_free 0.9429 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AS9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7500 _refine.ls_d_res_low 45.9600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24416 _refine.ls_number_reflns_R_free 1247 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7200 _refine.ls_percent_reflns_R_free 5.1100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1572 _refine.ls_R_factor_R_free 0.1831 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1559 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.0960 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1000 _refine.pdbx_overall_SU_R_Blow_DPI 0.1100 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1030 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6AS9 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.167 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7500 _refine_hist.d_res_low 45.9600 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 213 _refine_hist.number_atoms_total 2189 _refine_hist.pdbx_number_residues_total 245 _refine_hist.pdbx_B_iso_mean_ligand 32.61 _refine_hist.pdbx_B_iso_mean_solvent 25.18 _refine_hist.pdbx_number_atoms_protein 1952 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 722 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 56 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 291 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2032 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 257 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2459 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 2032 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.100 ? 2743 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 4.050 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 15.530 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.7500 _refine_ls_shell.d_res_low 1.8300 _refine_ls_shell.number_reflns_all 2754 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 150 _refine_ls_shell.number_reflns_R_work 2604 _refine_ls_shell.percent_reflns_obs 98.7200 _refine_ls_shell.percent_reflns_R_free 5.4500 _refine_ls_shell.R_factor_all 0.1881 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2491 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.1846 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 12 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6AS9 _struct.title ;Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P212121 form 2 ; _struct.pdbx_descriptor 'Green fluorescent protein' _struct.pdbx_model_details ;An 18-residue C-terminal fusion forms an alpha helix which binds to surface of neighboring protomer, supporting a filamentous assembly with 2 sub 1 screw symmetry ; _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AS9 _struct_keywords.text 'filament, protofilament, 2 sub 1 screw symmetry, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 3 ? THR A 9 ? LYS A 3 THR A 9 5 ? 7 HELX_P HELX_P2 AA2 ALA A 37 ? TYR A 39 ? ALA A 37 TYR A 39 5 ? 3 HELX_P HELX_P3 AA3 PRO A 56 ? VAL A 61 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P4 AA4 LEU A 66 ? ALA A 70 ? LEU A 68 ALA A 72 5 ? 5 HELX_P HELX_P5 AA5 PRO A 73 ? HIS A 79 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P6 AA6 ASP A 80 ? ALA A 85 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P7 AA7 LYS A 154 ? ASN A 157 ? LYS A 156 ASN A 159 5 ? 4 HELX_P HELX_P8 AA8 GLY A 230 ? LYS A 246 ? GLY A 232 LYS A 248 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale one ? A PHE 64 C ? ? ? 1_555 A PIA 65 N1 ? ? A PHE 64 A PIA 66 1_555 ? ? ? ? ? ? ? 1.351 ? covale2 covale both ? A PIA 65 C3 ? ? ? 1_555 A LEU 66 N ? ? A PIA 66 A LEU 68 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.65 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? VAL A 22 ? VAL A 12 VAL A 22 AA1 2 HIS A 25 ? ASP A 36 ? HIS A 25 ASP A 36 AA1 3 LYS A 41 ? CYS A 48 ? LYS A 41 CYS A 48 AA1 4 HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 AA1 5 HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 AA1 6 HIS A 146 ? ASP A 153 ? HIS A 148 ASP A 155 AA1 7 GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 AA1 8 VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 AA1 9 TYR A 90 ? PHE A 98 ? TYR A 92 PHE A 100 AA1 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 AA1 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 AA1 12 VAL A 12 ? VAL A 22 ? VAL A 12 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 20 ? N GLY A 20 O PHE A 27 ? O PHE A 27 AA1 2 3 N SER A 30 ? N SER A 30 O ILE A 47 ? O ILE A 47 AA1 3 4 N LEU A 44 ? N LEU A 44 O LEU A 218 ? O LEU A 220 AA1 4 5 O THR A 223 ? O THR A 225 N SER A 200 ? N SER A 202 AA1 5 6 O HIS A 197 ? O HIS A 199 N ILE A 150 ? N ILE A 152 AA1 6 7 N ASP A 153 ? N ASP A 155 O GLY A 158 ? O GLY A 160 AA1 7 8 N PHE A 163 ? N PHE A 165 O HIS A 179 ? O HIS A 181 AA1 8 9 O THR A 184 ? O THR A 186 N VAL A 91 ? N VAL A 93 AA1 9 10 N ILE A 96 ? N ILE A 98 O TYR A 104 ? O TYR A 106 AA1 10 11 N GLU A 113 ? N GLU A 115 O THR A 116 ? O THR A 118 AA1 11 12 O ILE A 121 ? O ILE A 123 N GLU A 17 ? N GLU A 17 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 301 ? 6 'binding site for residue ACT A 301' AC2 Software A ACT 302 ? 5 'binding site for residue ACT A 302' AC3 Software A MPD 303 ? 7 'binding site for residue MPD A 303' AC4 Software A MPD 304 ? 6 'binding site for residue MPD A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 99 ? LYS A 101 . ? 1_555 ? 2 AC1 6 VAL A 174 ? VAL A 176 . ? 1_555 ? 3 AC1 6 LEU A 176 ? LEU A 178 . ? 1_555 ? 4 AC1 6 ASP A 195 ? ASP A 197 . ? 3_655 ? 5 AC1 6 ASN A 196 ? ASN A 198 . ? 3_655 ? 6 AC1 6 HOH F . ? HOH A 497 . ? 1_555 ? 7 AC2 5 LYS A 52 ? LYS A 52 . ? 1_555 ? 8 AC2 5 LEU A 53 ? LEU A 53 . ? 1_555 ? 9 AC2 5 VAL A 55 ? VAL A 55 . ? 1_555 ? 10 AC2 5 HIS A 137 ? HIS A 139 . ? 1_555 ? 11 AC2 5 ASP A 214 ? ASP A 216 . ? 1_555 ? 12 AC3 7 TYR A 180 ? TYR A 182 . ? 2_564 ? 13 AC3 7 ASP A 208 ? ASP A 210 . ? 1_555 ? 14 AC3 7 PRO A 209 ? PRO A 211 . ? 1_555 ? 15 AC3 7 ASN A 210 ? ASN A 212 . ? 1_555 ? 16 AC3 7 HIS A 229 ? HIS A 231 . ? 4_455 ? 17 AC3 7 GLY A 230 ? GLY A 232 . ? 4_455 ? 18 AC3 7 MPD E . ? MPD A 304 . ? 2_564 ? 19 AC4 6 GLU A 93 ? GLU A 95 . ? 1_555 ? 20 AC4 6 THR A 95 ? THR A 97 . ? 1_555 ? 21 AC4 6 TYR A 180 ? TYR A 182 . ? 1_555 ? 22 AC4 6 GLN A 182 ? GLN A 184 . ? 1_555 ? 23 AC4 6 ASN A 210 ? ASN A 212 . ? 2_565 ? 24 AC4 6 MPD D . ? MPD A 303 . ? 2_565 ? # _atom_sites.entry_id 6AS9 _atom_sites.fract_transf_matrix[1][1] 0.019569 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018342 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011700 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PIA 65 66 66 PIA PIA A . n A 1 66 LEU 66 68 68 LEU LEU A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 CYS 68 70 70 CYS CYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 ALA 70 72 72 ALA ALA A . n A 1 71 ARG 71 73 73 ARG ARG A . n A 1 72 TYR 72 74 74 TYR TYR A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 HIS 75 77 77 HIS HIS A . n A 1 76 MET 76 78 78 MET MET A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 GLN 78 80 80 GLN GLN A . n A 1 79 HIS 79 81 81 HIS HIS A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 PHE 81 83 83 PHE PHE A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 TYR 90 92 92 TYR TYR A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 GLN 92 94 94 GLN GLN A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 THR 95 97 97 THR THR A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 LYS 99 101 101 LYS LYS A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 ASP 101 103 103 ASP ASP A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ASN 103 105 105 ASN ASN A . n A 1 104 TYR 104 106 106 TYR TYR A . n A 1 105 LYS 105 107 107 LYS LYS A . n A 1 106 THR 106 108 108 THR THR A . n A 1 107 ARG 107 109 109 ARG ARG A . n A 1 108 ALA 108 110 110 ALA ALA A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 VAL 110 112 112 VAL VAL A . n A 1 111 LYS 111 113 113 LYS LYS A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 ASP 115 117 117 ASP ASP A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASN 119 121 121 ASN ASN A . n A 1 120 ARG 120 122 122 ARG ARG A . n A 1 121 ILE 121 123 123 ILE ILE A . n A 1 122 GLU 122 124 124 GLU GLU A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 LYS 124 126 126 LYS LYS A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 LYS 129 131 131 LYS LYS A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 ASN 133 135 135 ASN ASN A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 LEU 135 137 137 LEU LEU A . n A 1 136 GLY 136 138 138 GLY GLY A . n A 1 137 HIS 137 139 139 HIS HIS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 LEU 139 141 141 LEU LEU A . n A 1 140 GLU 140 142 142 GLU GLU A . n A 1 141 TYR 141 143 143 TYR TYR A . n A 1 142 ASN 142 144 144 ASN ASN A . n A 1 143 TYR 143 145 145 TYR TYR A . n A 1 144 ASN 144 146 146 ASN ASN A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 HIS 146 148 148 HIS HIS A . n A 1 147 ASN 147 149 149 ASN ASN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 TYR 149 151 151 TYR TYR A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 MET 151 153 153 MET MET A . n A 1 152 ALA 152 154 154 ALA ALA A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 GLN 155 157 157 GLN GLN A . n A 1 156 LYS 156 158 158 LYS LYS A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ILE 159 161 161 ILE ILE A . n A 1 160 LYS 160 162 162 LYS LYS A . n A 1 161 VAL 161 163 163 VAL VAL A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 PHE 163 165 165 PHE PHE A . n A 1 164 LYS 164 166 166 LYS LYS A . n A 1 165 ILE 165 167 167 ILE ILE A . n A 1 166 ARG 166 168 168 ARG ARG A . n A 1 167 HIS 167 169 169 HIS HIS A . n A 1 168 ASN 168 170 170 ASN ASN A . n A 1 169 ILE 169 171 171 ILE ILE A . n A 1 170 GLU 170 172 172 GLU GLU A . n A 1 171 ASP 171 173 173 ASP ASP A . n A 1 172 GLY 172 174 174 GLY GLY A . n A 1 173 SER 173 175 175 SER SER A . n A 1 174 VAL 174 176 176 VAL VAL A . n A 1 175 GLN 175 177 177 GLN GLN A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 HIS 179 181 181 HIS HIS A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 GLN 181 183 183 GLN GLN A . n A 1 182 GLN 182 184 184 GLN GLN A . n A 1 183 ASN 183 185 185 ASN ASN A . n A 1 184 THR 184 186 186 THR THR A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 ILE 186 188 188 ILE ILE A . n A 1 187 GLY 187 189 189 GLY GLY A . n A 1 188 ASP 188 190 190 ASP ASP A . n A 1 189 GLY 189 191 191 GLY GLY A . n A 1 190 PRO 190 192 192 PRO PRO A . n A 1 191 VAL 191 193 193 VAL VAL A . n A 1 192 LEU 192 194 194 LEU LEU A . n A 1 193 LEU 193 195 195 LEU LEU A . n A 1 194 PRO 194 196 196 PRO PRO A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ASN 196 198 198 ASN ASN A . n A 1 197 HIS 197 199 199 HIS HIS A . n A 1 198 TYR 198 200 200 TYR TYR A . n A 1 199 LEU 199 201 201 LEU LEU A . n A 1 200 SER 200 202 202 SER SER A . n A 1 201 THR 201 203 203 THR THR A . n A 1 202 GLN 202 204 204 GLN GLN A . n A 1 203 SER 203 205 205 SER SER A . n A 1 204 ALA 204 206 206 ALA ALA A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 SER 206 208 208 SER SER A . n A 1 207 LYS 207 209 209 LYS LYS A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ASN 210 212 212 ASN ASN A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 LYS 212 214 214 LYS LYS A . n A 1 213 ARG 213 215 215 ARG ARG A . n A 1 214 ASP 214 216 216 ASP ASP A . n A 1 215 HIS 215 217 217 HIS HIS A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 VAL 217 219 219 VAL VAL A . n A 1 218 LEU 218 220 220 LEU LEU A . n A 1 219 LEU 219 221 221 LEU LEU A . n A 1 220 GLU 220 222 222 GLU GLU A . n A 1 221 PHE 221 223 223 PHE PHE A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 ALA 224 226 226 ALA ALA A . n A 1 225 ALA 225 227 227 ALA ALA A . n A 1 226 GLY 226 228 228 GLY GLY A . n A 1 227 ILE 227 229 229 ILE ILE A . n A 1 228 THR 228 230 230 THR THR A . n A 1 229 HIS 229 231 231 HIS HIS A . n A 1 230 GLY 230 232 232 GLY GLY A . n A 1 231 MET 231 233 233 MET MET A . n A 1 232 ASP 232 234 234 ASP ASP A . n A 1 233 GLU 233 235 235 GLU GLU A . n A 1 234 LEU 234 236 236 LEU LEU A . n A 1 235 TYR 235 237 237 TYR TYR A . n A 1 236 LYS 236 238 238 LYS LYS A . n A 1 237 ALA 237 239 239 ALA ALA A . n A 1 238 MET 238 240 240 MET MET A . n A 1 239 ALA 239 241 241 ALA ALA A . n A 1 240 LYS 240 242 242 LYS LYS A . n A 1 241 GLU 241 243 243 GLU GLU A . n A 1 242 THR 242 244 244 THR THR A . n A 1 243 ALA 243 245 245 ALA ALA A . n A 1 244 ALA 244 246 246 ALA ALA A . n A 1 245 ALA 245 247 247 ALA ALA A . n A 1 246 LYS 246 248 248 LYS LYS A . n A 1 247 PHE 247 249 ? ? ? A . n A 1 248 ASP 248 250 ? ? ? A . n A 1 249 HIS 249 251 ? ? ? A . n A 1 250 HIS 250 252 ? ? ? A . n A 1 251 HIS 251 253 ? ? ? A . n A 1 252 HIS 252 254 ? ? ? A . n A 1 253 HIS 253 255 ? ? ? A . n A 1 254 HIS 254 256 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 301 301 ACT ACT A . C 2 ACT 1 302 302 ACT ACT A . D 3 MPD 1 303 303 MPD MPD A . E 3 MPD 1 304 304 MPD MPD A . F 4 HOH 1 401 387 HOH HOH A . F 4 HOH 2 402 351 HOH HOH A . F 4 HOH 3 403 477 HOH HOH A . F 4 HOH 4 404 402 HOH HOH A . F 4 HOH 5 405 371 HOH HOH A . F 4 HOH 6 406 516 HOH HOH A . F 4 HOH 7 407 409 HOH HOH A . F 4 HOH 8 408 336 HOH HOH A . F 4 HOH 9 409 417 HOH HOH A . F 4 HOH 10 410 401 HOH HOH A . F 4 HOH 11 411 347 HOH HOH A . F 4 HOH 12 412 424 HOH HOH A . F 4 HOH 13 413 318 HOH HOH A . F 4 HOH 14 414 479 HOH HOH A . F 4 HOH 15 415 508 HOH HOH A . F 4 HOH 16 416 501 HOH HOH A . F 4 HOH 17 417 456 HOH HOH A . F 4 HOH 18 418 465 HOH HOH A . F 4 HOH 19 419 349 HOH HOH A . F 4 HOH 20 420 385 HOH HOH A . F 4 HOH 21 421 418 HOH HOH A . F 4 HOH 22 422 454 HOH HOH A . F 4 HOH 23 423 455 HOH HOH A . F 4 HOH 24 424 497 HOH HOH A . F 4 HOH 25 425 404 HOH HOH A . F 4 HOH 26 426 391 HOH HOH A . F 4 HOH 27 427 310 HOH HOH A . F 4 HOH 28 428 427 HOH HOH A . F 4 HOH 29 429 432 HOH HOH A . F 4 HOH 30 430 431 HOH HOH A . F 4 HOH 31 431 331 HOH HOH A . F 4 HOH 32 432 364 HOH HOH A . F 4 HOH 33 433 460 HOH HOH A . F 4 HOH 34 434 415 HOH HOH A . F 4 HOH 35 435 348 HOH HOH A . F 4 HOH 36 436 335 HOH HOH A . F 4 HOH 37 437 471 HOH HOH A . F 4 HOH 38 438 416 HOH HOH A . F 4 HOH 39 439 342 HOH HOH A . F 4 HOH 40 440 311 HOH HOH A . F 4 HOH 41 441 332 HOH HOH A . F 4 HOH 42 442 467 HOH HOH A . F 4 HOH 43 443 308 HOH HOH A . F 4 HOH 44 444 330 HOH HOH A . F 4 HOH 45 445 380 HOH HOH A . F 4 HOH 46 446 502 HOH HOH A . F 4 HOH 47 447 458 HOH HOH A . F 4 HOH 48 448 514 HOH HOH A . F 4 HOH 49 449 406 HOH HOH A . F 4 HOH 50 450 327 HOH HOH A . F 4 HOH 51 451 513 HOH HOH A . F 4 HOH 52 452 426 HOH HOH A . F 4 HOH 53 453 423 HOH HOH A . F 4 HOH 54 454 306 HOH HOH A . F 4 HOH 55 455 494 HOH HOH A . F 4 HOH 56 456 320 HOH HOH A . F 4 HOH 57 457 457 HOH HOH A . F 4 HOH 58 458 442 HOH HOH A . F 4 HOH 59 459 486 HOH HOH A . F 4 HOH 60 460 307 HOH HOH A . F 4 HOH 61 461 395 HOH HOH A . F 4 HOH 62 462 383 HOH HOH A . F 4 HOH 63 463 448 HOH HOH A . F 4 HOH 64 464 344 HOH HOH A . F 4 HOH 65 465 428 HOH HOH A . F 4 HOH 66 466 425 HOH HOH A . F 4 HOH 67 467 334 HOH HOH A . F 4 HOH 68 468 359 HOH HOH A . F 4 HOH 69 469 316 HOH HOH A . F 4 HOH 70 470 337 HOH HOH A . F 4 HOH 71 471 314 HOH HOH A . F 4 HOH 72 472 407 HOH HOH A . F 4 HOH 73 473 452 HOH HOH A . F 4 HOH 74 474 354 HOH HOH A . F 4 HOH 75 475 317 HOH HOH A . F 4 HOH 76 476 504 HOH HOH A . F 4 HOH 77 477 315 HOH HOH A . F 4 HOH 78 478 341 HOH HOH A . F 4 HOH 79 479 498 HOH HOH A . F 4 HOH 80 480 444 HOH HOH A . F 4 HOH 81 481 481 HOH HOH A . F 4 HOH 82 482 345 HOH HOH A . F 4 HOH 83 483 507 HOH HOH A . F 4 HOH 84 484 338 HOH HOH A . F 4 HOH 85 485 324 HOH HOH A . F 4 HOH 86 486 346 HOH HOH A . F 4 HOH 87 487 353 HOH HOH A . F 4 HOH 88 488 362 HOH HOH A . F 4 HOH 89 489 329 HOH HOH A . F 4 HOH 90 490 321 HOH HOH A . F 4 HOH 91 491 340 HOH HOH A . F 4 HOH 92 492 413 HOH HOH A . F 4 HOH 93 493 382 HOH HOH A . F 4 HOH 94 494 384 HOH HOH A . F 4 HOH 95 495 414 HOH HOH A . F 4 HOH 96 496 488 HOH HOH A . F 4 HOH 97 497 447 HOH HOH A . F 4 HOH 98 498 309 HOH HOH A . F 4 HOH 99 499 487 HOH HOH A . F 4 HOH 100 500 328 HOH HOH A . F 4 HOH 101 501 363 HOH HOH A . F 4 HOH 102 502 375 HOH HOH A . F 4 HOH 103 503 476 HOH HOH A . F 4 HOH 104 504 389 HOH HOH A . F 4 HOH 105 505 357 HOH HOH A . F 4 HOH 106 506 453 HOH HOH A . F 4 HOH 107 507 378 HOH HOH A . F 4 HOH 108 508 450 HOH HOH A . F 4 HOH 109 509 333 HOH HOH A . F 4 HOH 110 510 400 HOH HOH A . F 4 HOH 111 511 312 HOH HOH A . F 4 HOH 112 512 492 HOH HOH A . F 4 HOH 113 513 408 HOH HOH A . F 4 HOH 114 514 392 HOH HOH A . F 4 HOH 115 515 325 HOH HOH A . F 4 HOH 116 516 429 HOH HOH A . F 4 HOH 117 517 319 HOH HOH A . F 4 HOH 118 518 443 HOH HOH A . F 4 HOH 119 519 440 HOH HOH A . F 4 HOH 120 520 511 HOH HOH A . F 4 HOH 121 521 403 HOH HOH A . F 4 HOH 122 522 483 HOH HOH A . F 4 HOH 123 523 323 HOH HOH A . F 4 HOH 124 524 326 HOH HOH A . F 4 HOH 125 525 441 HOH HOH A . F 4 HOH 126 526 369 HOH HOH A . F 4 HOH 127 527 394 HOH HOH A . F 4 HOH 128 528 393 HOH HOH A . F 4 HOH 129 529 451 HOH HOH A . F 4 HOH 130 530 381 HOH HOH A . F 4 HOH 131 531 495 HOH HOH A . F 4 HOH 132 532 412 HOH HOH A . F 4 HOH 133 533 358 HOH HOH A . F 4 HOH 134 534 399 HOH HOH A . F 4 HOH 135 535 377 HOH HOH A . F 4 HOH 136 536 491 HOH HOH A . F 4 HOH 137 537 489 HOH HOH A . F 4 HOH 138 538 350 HOH HOH A . F 4 HOH 139 539 361 HOH HOH A . F 4 HOH 140 540 474 HOH HOH A . F 4 HOH 141 541 436 HOH HOH A . F 4 HOH 142 542 499 HOH HOH A . F 4 HOH 143 543 366 HOH HOH A . F 4 HOH 144 544 493 HOH HOH A . F 4 HOH 145 545 367 HOH HOH A . F 4 HOH 146 546 422 HOH HOH A . F 4 HOH 147 547 356 HOH HOH A . F 4 HOH 148 548 509 HOH HOH A . F 4 HOH 149 549 379 HOH HOH A . F 4 HOH 150 550 360 HOH HOH A . F 4 HOH 151 551 397 HOH HOH A . F 4 HOH 152 552 396 HOH HOH A . F 4 HOH 153 553 506 HOH HOH A . F 4 HOH 154 554 374 HOH HOH A . F 4 HOH 155 555 439 HOH HOH A . F 4 HOH 156 556 437 HOH HOH A . F 4 HOH 157 557 480 HOH HOH A . F 4 HOH 158 558 478 HOH HOH A . F 4 HOH 159 559 470 HOH HOH A . F 4 HOH 160 560 386 HOH HOH A . F 4 HOH 161 561 430 HOH HOH A . F 4 HOH 162 562 459 HOH HOH A . F 4 HOH 163 563 365 HOH HOH A . F 4 HOH 164 564 372 HOH HOH A . F 4 HOH 165 565 373 HOH HOH A . F 4 HOH 166 566 468 HOH HOH A . F 4 HOH 167 567 370 HOH HOH A . F 4 HOH 168 568 461 HOH HOH A . F 4 HOH 169 569 390 HOH HOH A . F 4 HOH 170 570 322 HOH HOH A . F 4 HOH 171 571 421 HOH HOH A . F 4 HOH 172 572 368 HOH HOH A . F 4 HOH 173 573 352 HOH HOH A . F 4 HOH 174 574 490 HOH HOH A . F 4 HOH 175 575 355 HOH HOH A . F 4 HOH 176 576 485 HOH HOH A . F 4 HOH 177 577 305 HOH HOH A . F 4 HOH 178 578 505 HOH HOH A . F 4 HOH 179 579 472 HOH HOH A . F 4 HOH 180 580 411 HOH HOH A . F 4 HOH 181 581 388 HOH HOH A . F 4 HOH 182 582 313 HOH HOH A . F 4 HOH 183 583 466 HOH HOH A . F 4 HOH 184 584 462 HOH HOH A . F 4 HOH 185 585 419 HOH HOH A . F 4 HOH 186 586 473 HOH HOH A . F 4 HOH 187 587 398 HOH HOH A . F 4 HOH 188 588 376 HOH HOH A . F 4 HOH 189 589 438 HOH HOH A . F 4 HOH 190 590 446 HOH HOH A . F 4 HOH 191 591 464 HOH HOH A . F 4 HOH 192 592 463 HOH HOH A . F 4 HOH 193 593 500 HOH HOH A . F 4 HOH 194 594 420 HOH HOH A . F 4 HOH 195 595 435 HOH HOH A . F 4 HOH 196 596 433 HOH HOH A . F 4 HOH 197 597 469 HOH HOH A . F 4 HOH 198 598 449 HOH HOH A . F 4 HOH 199 599 434 HOH HOH A . F 4 HOH 200 600 496 HOH HOH A . F 4 HOH 201 601 515 HOH HOH A . F 4 HOH 202 602 510 HOH HOH A . F 4 HOH 203 603 445 HOH HOH A . F 4 HOH 204 604 410 HOH HOH A . F 4 HOH 205 605 339 HOH HOH A . F 4 HOH 206 606 405 HOH HOH A . F 4 HOH 207 607 512 HOH HOH A . F 4 HOH 208 608 343 HOH HOH A . F 4 HOH 209 609 482 HOH HOH A . F 4 HOH 210 610 475 HOH HOH A . F 4 HOH 211 611 484 HOH HOH A . F 4 HOH 212 612 503 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PIA _pdbx_struct_mod_residue.label_seq_id 65 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PIA _pdbx_struct_mod_residue.auth_seq_id 66 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLY _pdbx_struct_mod_residue.details chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details pentameric _pdbx_struct_assembly.oligomeric_count 5 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 1_655 x+1,y,z 1.0000000000 0.0000000000 0.0000000000 51.1000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 1_455 x-1,y,z 1.0000000000 0.0000000000 0.0000000000 -51.1000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x+1/2,-y+1/2,-z 1.0000000000 0.0000000000 0.0000000000 25.5500000000 0.0000000000 -1.0000000000 0.0000000000 27.2600000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 4_455 x-1/2,-y+1/2,-z 1.0000000000 0.0000000000 0.0000000000 -25.5500000000 0.0000000000 -1.0000000000 0.0000000000 27.2600000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-30 2 'Structure model' 1 1 2018-12-12 3 'Structure model' 1 2 2019-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_pdbx_audit_support.funding_organization' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.9763 _pdbx_refine_tls.origin_y 21.3132 _pdbx_refine_tls.origin_z 9.6328 _pdbx_refine_tls.T[1][1] -0.0214 _pdbx_refine_tls.T[2][2] -0.0263 _pdbx_refine_tls.T[3][3] -0.0186 _pdbx_refine_tls.T[1][2] -0.0064 _pdbx_refine_tls.T[1][3] -0.0021 _pdbx_refine_tls.T[2][3] -0.0033 _pdbx_refine_tls.L[1][1] 0.5103 _pdbx_refine_tls.L[2][2] 0.1806 _pdbx_refine_tls.L[3][3] 0.2986 _pdbx_refine_tls.L[1][2] -0.1006 _pdbx_refine_tls.L[1][3] 0.0249 _pdbx_refine_tls.L[2][3] 0.1119 _pdbx_refine_tls.S[1][1] 0.0223 _pdbx_refine_tls.S[2][2] -0.0410 _pdbx_refine_tls.S[3][3] 0.0188 _pdbx_refine_tls.S[1][2] -0.0096 _pdbx_refine_tls.S[1][3] 0.0007 _pdbx_refine_tls.S[2][3] 0.0389 _pdbx_refine_tls.S[2][1] 0.0145 _pdbx_refine_tls.S[3][1] -0.0117 _pdbx_refine_tls.S[3][2] 0.0093 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 516 _pdbx_refine_tls_group.selection_details '{ A|* }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # _pdbx_phasing_MR.entry_id 6AS9 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.000 _pdbx_phasing_MR.d_res_low_rotation 42.890 _pdbx_phasing_MR.d_res_high_translation 2.000 _pdbx_phasing_MR.d_res_low_translation 42.890 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 20160517 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.1 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.0 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20160517 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PHE 249 ? A PHE 247 3 1 Y 1 A ASP 250 ? A ASP 248 4 1 Y 1 A HIS 251 ? A HIS 249 5 1 Y 1 A HIS 252 ? A HIS 250 6 1 Y 1 A HIS 253 ? A HIS 251 7 1 Y 1 A HIS 254 ? A HIS 252 8 1 Y 1 A HIS 255 ? A HIS 253 9 1 Y 1 A HIS 256 ? A HIS 254 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' 1616265 1 'National Institutes of Health/Office of the Director' 'United States' OD003806 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM115941 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? #