data_6AX2 # _entry.id 6AX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AX2 pdb_00006ax2 10.2210/pdb6ax2/pdb WWPDB D_1000229941 ? ? BMRB 30339 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of Magi3 a specific insect toxin from the spider Macrothele gigas' _pdbx_database_related.db_id 30339 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6AX2 _pdbx_database_status.recvd_initial_deposition_date 2017-09-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'del Rio-Portilla, F.' 1 0000-0001-8672-0567 'Titaux-Delgado, G.A.' 2 0000-0002-3103-9085 'Escobedo-Gonzalez, F.C.' 3 0000-0003-0778-2255 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 692 _citation.page_last 701 _citation.title 'Successful refolding and NMR structure of rMagi3: A disulfide-rich insecticidal spider toxin.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3363 _citation.pdbx_database_id_PubMed 29247580 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Titaux-Delgado, G.' 1 ? primary 'Carrillo, E.' 2 ? primary 'Mendoza, A.' 3 ? primary 'Mayorga-Flores, M.' 4 ? primary 'Escobedo-Gonzalez, F.C.' 5 ? primary 'Cano-Sanchez, P.' 6 ? primary 'Lopez-Vera, E.' 7 ? primary 'Corzo, G.' 8 ? primary 'Del Rio-Portilla, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Mu-hexatoxin-Mg2a _entity.formula_weight 5241.110 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mu-HXTX-Mg2a,Neurotoxin magi-3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGCIKWNHSCQTTTLKCCGKCVVCYCHTPWGTNCRCDRTRLFCTED _entity_poly.pdbx_seq_one_letter_code_can GGCIKWNHSCQTTTLKCCGKCVVCYCHTPWGTNCRCDRTRLFCTED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 CYS n 1 4 ILE n 1 5 LYS n 1 6 TRP n 1 7 ASN n 1 8 HIS n 1 9 SER n 1 10 CYS n 1 11 GLN n 1 12 THR n 1 13 THR n 1 14 THR n 1 15 LEU n 1 16 LYS n 1 17 CYS n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 CYS n 1 22 VAL n 1 23 VAL n 1 24 CYS n 1 25 TYR n 1 26 CYS n 1 27 HIS n 1 28 THR n 1 29 PRO n 1 30 TRP n 1 31 GLY n 1 32 THR n 1 33 ASN n 1 34 CYS n 1 35 ARG n 1 36 CYS n 1 37 ASP n 1 38 ARG n 1 39 THR n 1 40 ARG n 1 41 LEU n 1 42 PHE n 1 43 CYS n 1 44 THR n 1 45 GLU n 1 46 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 46 _entity_src_gen.gene_src_common_name Spider _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Macrothele gigas' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 223896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXMG3_MACGS _struct_ref.pdbx_db_accession P83559 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GGCIKWNHSCQTTTLKCCGKCVVCYCHTPWGTNCRCDRTRLFCTED _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83559 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D DQF-COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-1H NOESY' 1 isotropic 8 1 1 '2D 1H-1H TOCSY' 2 isotropic 7 1 1 '2D 1H-1H NOESY' 2 isotropic 6 1 1 '2D 1H-1H NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 297 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength . _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label ` _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM NA- Magi3, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 'Natural enriched' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 500 '3 mm triple channel' 2 'AVANCE III' ? Bruker 700 '5 mm cryo probe' # _pdbx_nmr_refine.entry_id 6AX2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6AX2 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6AX2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber 9 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, and Kollman' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 1.5 'Keller and Wuthrich' 4 'peak picking' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 5 processing NMRPipe 2014 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AX2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6AX2 _struct.title 'Solution structure of Magi3 a specific insect toxin from the spider Macrothele gigas' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AX2 _struct_keywords.text 'Refolding, spider toxin, insecticidal peptide, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 3 A CYS 18 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 10 A CYS 24 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 17 A CYS 36 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf4 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 21 A CYS 43 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf5 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 26 A CYS 34 1_555 ? ? ? ? ? ? ? 2.038 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 22 ? TYR A 25 ? VAL A 22 TYR A 25 AA1 2 ARG A 35 ? THR A 39 ? ARG A 35 THR A 39 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # _atom_sites.entry_id 6AX2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ASP 46 46 46 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-10 2 'Structure model' 1 1 2018-01-24 3 'Structure model' 1 2 2018-01-31 4 'Structure model' 1 3 2018-02-28 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 3 'Structure model' audit_author 3 4 'Structure model' citation 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_status 6 5 'Structure model' pdbx_nmr_software 7 5 'Structure model' pdbx_nmr_spectrometer 8 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 3 'Structure model' '_audit_author.name' 3 4 'Structure model' '_citation.journal_volume' 4 4 'Structure model' '_citation.page_first' 5 4 'Structure model' '_citation.page_last' 6 4 'Structure model' '_citation.year' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 5 'Structure model' '_pdbx_nmr_software.name' 11 5 'Structure model' '_pdbx_nmr_spectrometer.model' 12 5 'Structure model' '_struct_conn.pdbx_dist_value' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Magi3 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.53 120.30 4.23 0.50 N 2 2 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 125.43 120.30 5.13 0.50 N 3 2 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 123.81 120.30 3.51 0.50 N 4 3 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.17 120.30 3.87 0.50 N 5 3 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.15 118.30 5.85 0.90 N 6 3 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 123.40 120.30 3.10 0.50 N 7 4 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.17 120.30 3.87 0.50 N 8 5 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.15 120.30 3.85 0.50 N 9 6 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.59 120.30 3.29 0.50 N 10 6 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.49 120.30 4.19 0.50 N 11 6 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.04 120.30 3.74 0.50 N 12 7 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.53 120.30 3.23 0.50 N 13 7 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 123.58 120.30 3.28 0.50 N 14 8 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.46 120.30 3.16 0.50 N 15 8 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 123.46 120.30 3.16 0.50 N 16 9 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 123.77 120.30 3.47 0.50 N 17 10 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.65 120.30 3.35 0.50 N 18 10 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.01 120.30 3.71 0.50 N 19 12 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.35 120.30 3.05 0.50 N 20 12 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.53 120.30 4.23 0.50 N 21 12 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.68 120.30 4.38 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 11 ? ? 56.69 5.82 2 1 ASN A 33 ? ? -76.10 35.96 3 1 THR A 44 ? ? -82.53 31.21 4 2 ASN A 7 ? ? 58.01 18.76 5 2 CYS A 10 ? ? -143.36 11.47 6 2 THR A 12 ? ? 57.23 5.64 7 2 CYS A 21 ? ? -151.75 53.31 8 2 ASN A 33 ? ? 53.37 71.78 9 3 CYS A 18 ? ? -65.65 -174.98 10 3 ASP A 37 ? ? -142.67 26.40 11 4 ASN A 7 ? ? 62.08 -5.77 12 4 CYS A 24 ? ? -117.22 72.15 13 4 ASN A 33 ? ? -154.84 6.53 14 4 GLU A 45 ? ? -72.97 30.15 15 5 ASN A 7 ? ? 53.39 16.01 16 5 CYS A 18 ? ? -71.62 42.26 17 5 THR A 32 ? ? -110.70 57.72 18 5 CYS A 36 ? ? -68.49 90.97 19 5 ASP A 37 ? ? -142.88 -10.58 20 6 ASN A 7 ? ? 55.92 16.08 21 6 THR A 12 ? ? 64.84 -44.89 22 6 CYS A 24 ? ? -69.49 65.22 23 6 TRP A 30 ? ? 59.62 9.77 24 6 ASN A 33 ? ? -75.37 29.03 25 7 THR A 28 ? ? 53.34 80.51 26 7 ARG A 38 ? ? 61.29 62.68 27 8 ASN A 7 ? ? 56.82 13.42 28 8 CYS A 10 ? ? -156.82 57.40 29 8 THR A 12 ? ? -160.29 110.20 30 8 CYS A 18 ? ? -75.16 42.57 31 8 PRO A 29 ? ? -59.11 -8.81 32 8 TRP A 30 ? ? -69.53 27.21 33 8 ASP A 37 ? ? -147.32 34.05 34 9 HIS A 27 ? ? -158.15 -9.11 35 9 THR A 28 ? ? 49.89 74.54 36 9 TRP A 30 ? ? -144.62 -24.06 37 9 GLU A 45 ? ? -145.68 -62.38 38 10 ASP A 37 ? ? -148.81 14.46 39 11 ASN A 7 ? ? 57.98 10.72 40 11 PHE A 42 ? ? -90.84 40.32 # _pdbx_audit_support.funding_organization 'Direccion General del Personal Academico, UNAM' _pdbx_audit_support.country Mexico _pdbx_audit_support.grant_number IN207516 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #