data_6B3U # _entry.id 6B3U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6B3U pdb_00006b3u 10.2210/pdb6b3u/pdb WWPDB D_1000230228 ? ? BMRB 30349 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of HIV-1 GP41 Transmembrane Domain in Bicelles' _pdbx_database_related.db_id 30349 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6B3U _pdbx_database_status.recvd_initial_deposition_date 2017-09-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chiliveri, S.C.' 1 ? 'Louis, J.M.' 2 ? 'Ghirlando, R.' 3 ? 'Baber, J.L.' 4 ? 'Bax, A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 140 _citation.language ? _citation.page_first 34 _citation.page_last 37 _citation.title 'Tilted, Uninterrupted, Monomeric HIV-1 gp41 Transmembrane Helix from Residual Dipolar Couplings.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.7b10245 _citation.pdbx_database_id_PubMed 29277995 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chiliveri, S.C.' 1 ? primary 'Louis, J.M.' 2 ? primary 'Ghirlando, R.' 3 ? primary 'Baber, J.L.' 4 ? primary 'Bax, A.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIV-1 GP41 Transmembrane Domain' _entity.formula_weight 4650.604 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'Polypeptide sequence for the solution structure corresponds to GP160 (677-716; HXB2 numbering).' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS _entity_poly.pdbx_seq_one_letter_code_can NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 TRP n 1 3 LEU n 1 4 TRP n 1 5 TYR n 1 6 ILE n 1 7 ARG n 1 8 ILE n 1 9 PHE n 1 10 ILE n 1 11 ILE n 1 12 ILE n 1 13 VAL n 1 14 GLY n 1 15 SER n 1 16 LEU n 1 17 ILE n 1 18 GLY n 1 19 LEU n 1 20 ARG n 1 21 ILE n 1 22 VAL n 1 23 PHE n 1 24 ALA n 1 25 VAL n 1 26 LEU n 1 27 SER n 1 28 LEU n 1 29 VAL n 1 30 ASN n 1 31 ARG n 1 32 VAL n 1 33 ARG n 1 34 GLN n 1 35 GLY n 1 36 TYR n 1 37 SER n 1 38 PRO n 1 39 LEU n 1 40 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 40 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene env _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q74849_9HIV1 _struct_ref.pdbx_db_accession Q74849 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS _struct_ref.pdbx_align_begin 670 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6B3U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q74849 _struct_ref_seq.db_align_beg 670 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 709 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 677 _struct_ref_seq.pdbx_auth_seq_align_end 716 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 1 1 '2D TROSY' 1 isotropic 5 1 1 '2D ARTSY' 1 isotropic 6 1 2 '2D ARTSY' 1 anisotropic 7 1 3 '2D ARTSY' 1 anisotropic 8 1 4 '2D ARTSY' 2 anisotropic 9 1 5 '2D ARTSY' 2 isotropic 10 1 6 '2D TROSY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label ambient _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '500 uM [U-100% 13C; U-100% 15N; U-100% 2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'Backbone assignments' bicelle '500uM TM in 150mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5)' 2 '100 uM [U-100% 15N; 80%-2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'Positive charged gel' 'gel solid' ;100uM TM in 100mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5) Polyacrylamide gel made with 1.4% (w/v) (3-Acrylamidopropyl)-trimethylammonium chloride ; 3 '100 uM [U-100% 15N; 80%-2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'Neutral charged gel' 'gel solid' ;100uM TM in 100mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5) Neutral polyacrylamide gel ; 4 '40 uM [U-100% 15N; U-80% 2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'TM R707C Thulium' bicelle 'TM R707C-ThuliumDOTAM8 in 100mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5)' 5 '70 uM [U-100% 15N; U-80% 2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'TM R707C Lutetium' bicelle 'TM R707C-LutetiumDOTAM8 in 100mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5)' 6 '300 uM [U-100% 15N; U-80% 2H] HIV-1 GP41 Transmembrane domain, 93% H2O/7% D2O' '93% H2O/7% D2O' 'Mixed labeled TM' bicelle '100uM 15N-TM and 200uM 14NTM-R707C in 100mM DMPC/DHPC (q=0.4), 25mM MES (pH6.5)' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE II' ? Bruker 900 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 6B3U _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6B3U _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6B3U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CcpNMR ? CCPN 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 'data analysis' NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6B3U _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6B3U _struct.title 'Solution Structure of HIV-1 GP41 Transmembrane Domain in Bicelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6B3U _struct_keywords.text 'HIV-1, Transmembrane domain, GP41, solution structure, residual dipolar couplings, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id TRP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TRP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 678 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 709 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6B3U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 677 677 ASN ASN A . n A 1 2 TRP 2 678 678 TRP TRP A . n A 1 3 LEU 3 679 679 LEU LEU A . n A 1 4 TRP 4 680 680 TRP TRP A . n A 1 5 TYR 5 681 681 TYR TYR A . n A 1 6 ILE 6 682 682 ILE ILE A . n A 1 7 ARG 7 683 683 ARG ARG A . n A 1 8 ILE 8 684 684 ILE ILE A . n A 1 9 PHE 9 685 685 PHE PHE A . n A 1 10 ILE 10 686 686 ILE ILE A . n A 1 11 ILE 11 687 687 ILE ILE A . n A 1 12 ILE 12 688 688 ILE ILE A . n A 1 13 VAL 13 689 689 VAL VAL A . n A 1 14 GLY 14 690 690 GLY GLY A . n A 1 15 SER 15 691 691 SER SER A . n A 1 16 LEU 16 692 692 LEU LEU A . n A 1 17 ILE 17 693 693 ILE ILE A . n A 1 18 GLY 18 694 694 GLY GLY A . n A 1 19 LEU 19 695 695 LEU LEU A . n A 1 20 ARG 20 696 696 ARG ARG A . n A 1 21 ILE 21 697 697 ILE ILE A . n A 1 22 VAL 22 698 698 VAL VAL A . n A 1 23 PHE 23 699 699 PHE PHE A . n A 1 24 ALA 24 700 700 ALA ALA A . n A 1 25 VAL 25 701 701 VAL VAL A . n A 1 26 LEU 26 702 702 LEU LEU A . n A 1 27 SER 27 703 703 SER SER A . n A 1 28 LEU 28 704 704 LEU LEU A . n A 1 29 VAL 29 705 705 VAL VAL A . n A 1 30 ASN 30 706 706 ASN ASN A . n A 1 31 ARG 31 707 707 ARG ARG A . n A 1 32 VAL 32 708 708 VAL VAL A . n A 1 33 ARG 33 709 709 ARG ARG A . n A 1 34 GLN 34 710 710 GLN GLN A . n A 1 35 GLY 35 711 711 GLY GLY A . n A 1 36 TYR 36 712 712 TYR TYR A . n A 1 37 SER 37 713 713 SER SER A . n A 1 38 PRO 38 714 714 PRO PRO A . n A 1 39 LEU 39 715 715 LEU LEU A . n A 1 40 SER 40 716 716 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4320 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-24 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_nmr_spectrometer.model' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'HIV-1 GP41 Transmembrane domain' 500 ? uM '[U-100% 13C; U-100% 15N; U-80% 2H]' 2 'HIV-1 GP41 Transmembrane domain' 100 ? uM '[U-100% 15N; 80%-2H]' 3 'HIV-1 GP41 Transmembrane domain' 100 ? uM '[U-100% 15N; 80%-2H]' 4 'HIV-1 GP41 Transmembrane domain' 40 ? uM '[U-100% 15N; U-80% 2H]' 5 'HIV-1 GP41 Transmembrane domain' 70 ? uM '[U-100% 15N; U-80% 2H]' 6 'HIV-1 GP41 Transmembrane domain' 300 ? uM '[U-100% 15N; U-80% 2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 GLN A 710 ? ? -161.58 98.18 2 4 GLN A 710 ? ? 54.12 84.92 3 5 TYR A 712 ? ? 54.09 -88.28 4 6 SER A 713 ? ? -151.23 39.30 5 7 SER A 713 ? ? -104.62 -62.26 6 15 GLN A 710 ? ? 50.24 -172.53 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number DK075023-08 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #