data_6B8C # _entry.id 6B8C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6B8C pdb_00006b8c 10.2210/pdb6b8c/pdb WWPDB D_1000229067 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6B8C _pdbx_database_status.recvd_initial_deposition_date 2017-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, B.' 1 ? 'Oren, D.A.' 2 ? 'Hang, H.C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Enterococcus faeciumsecreted antigen A generates muropeptides to enhance host immunity and limit bacterial pathogenesis.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.45343 _citation.pdbx_database_id_PubMed 30969170 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, B.' 1 0000-0002-0207-7357 primary 'Wang, Y.C.' 2 ? primary 'Hespen, C.W.' 3 0000-0001-5466-0280 primary 'Espinosa, J.' 4 0000-0003-2104-5331 primary 'Salje, J.' 5 ? primary 'Rangan, K.J.' 6 ? primary 'Oren, D.A.' 7 ? primary 'Kang, J.Y.' 8 ? primary 'Pedicord, V.A.' 9 ? primary 'Hang, H.C.' 10 0000-0003-4053-5547 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6B8C _cell.details ? _cell.formula_units_Z ? _cell.length_a 100.385 _cell.length_a_esd ? _cell.length_b 100.385 _cell.length_b_esd ? _cell.length_c 100.385 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6B8C _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NLP/P60 15715.212 1 ? ? ? ? 2 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SagA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PGNSTGSNATNNTTNTTPTPTPSGSVNGAAIVAEAYKYIGTPYVWGGKDPSGFDCSGFTRYVYLQVTGRDIGGWTVPQES AGTKISVSQAKAGDLLFWGSPGGTYHVAIALGGGQYIHAPQPGESVKVGSVQWFAPDFAVSMLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;PGNSTGSNATNNTTNTTPTPTPSGSVNGAAIVAEAYKYIGTPYVWGGKDPSGFDCSGFTRYVYLQVTGRDIGGWTVPQES AGTKISVSQAKAGDLLFWGSPGGTYHVAIALGGGQYIHAPQPGESVKVGSVQWFAPDFAVSMLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLY n 1 3 ASN n 1 4 SER n 1 5 THR n 1 6 GLY n 1 7 SER n 1 8 ASN n 1 9 ALA n 1 10 THR n 1 11 ASN n 1 12 ASN n 1 13 THR n 1 14 THR n 1 15 ASN n 1 16 THR n 1 17 THR n 1 18 PRO n 1 19 THR n 1 20 PRO n 1 21 THR n 1 22 PRO n 1 23 SER n 1 24 GLY n 1 25 SER n 1 26 VAL n 1 27 ASN n 1 28 GLY n 1 29 ALA n 1 30 ALA n 1 31 ILE n 1 32 VAL n 1 33 ALA n 1 34 GLU n 1 35 ALA n 1 36 TYR n 1 37 LYS n 1 38 TYR n 1 39 ILE n 1 40 GLY n 1 41 THR n 1 42 PRO n 1 43 TYR n 1 44 VAL n 1 45 TRP n 1 46 GLY n 1 47 GLY n 1 48 LYS n 1 49 ASP n 1 50 PRO n 1 51 SER n 1 52 GLY n 1 53 PHE n 1 54 ASP n 1 55 CYS n 1 56 SER n 1 57 GLY n 1 58 PHE n 1 59 THR n 1 60 ARG n 1 61 TYR n 1 62 VAL n 1 63 TYR n 1 64 LEU n 1 65 GLN n 1 66 VAL n 1 67 THR n 1 68 GLY n 1 69 ARG n 1 70 ASP n 1 71 ILE n 1 72 GLY n 1 73 GLY n 1 74 TRP n 1 75 THR n 1 76 VAL n 1 77 PRO n 1 78 GLN n 1 79 GLU n 1 80 SER n 1 81 ALA n 1 82 GLY n 1 83 THR n 1 84 LYS n 1 85 ILE n 1 86 SER n 1 87 VAL n 1 88 SER n 1 89 GLN n 1 90 ALA n 1 91 LYS n 1 92 ALA n 1 93 GLY n 1 94 ASP n 1 95 LEU n 1 96 LEU n 1 97 PHE n 1 98 TRP n 1 99 GLY n 1 100 SER n 1 101 PRO n 1 102 GLY n 1 103 GLY n 1 104 THR n 1 105 TYR n 1 106 HIS n 1 107 VAL n 1 108 ALA n 1 109 ILE n 1 110 ALA n 1 111 LEU n 1 112 GLY n 1 113 GLY n 1 114 GLY n 1 115 GLN n 1 116 TYR n 1 117 ILE n 1 118 HIS n 1 119 ALA n 1 120 PRO n 1 121 GLN n 1 122 PRO n 1 123 GLY n 1 124 GLU n 1 125 SER n 1 126 VAL n 1 127 LYS n 1 128 VAL n 1 129 GLY n 1 130 SER n 1 131 VAL n 1 132 GLN n 1 133 TRP n 1 134 PHE n 1 135 ALA n 1 136 PRO n 1 137 ASP n 1 138 PHE n 1 139 ALA n 1 140 VAL n 1 141 SER n 1 142 MET n 1 143 LEU n 1 144 GLU n 1 145 HIS n 1 146 HIS n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name 'Streptococcus faecium' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FM130_01170 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1352 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1T4J4N4_ENTFC _struct_ref.pdbx_db_accession A0A1T4J4N4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PGNSTGSNATNNTTNTTPTPTPSGSVNGAAIVAEAYKYIGTPYVWGGKDPSGFDCSGFTRYVYLQVTGRDIGGWTVPQES AGTKISVSQAKAGDLLFWGSPGGTYHVAIALGGGQYIHAPQPGESVKVGSVQWFAPDFAVSM ; _struct_ref.pdbx_align_begin 369 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6B8C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1T4J4N4 _struct_ref_seq.db_align_beg 369 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 510 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 389 _struct_ref_seq.pdbx_auth_seq_align_end 530 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6B8C LEU A 143 ? UNP A0A1T4J4N4 ? ? 'expression tag' 531 1 1 6B8C GLU A 144 ? UNP A0A1T4J4N4 ? ? 'expression tag' 532 2 1 6B8C HIS A 145 ? UNP A0A1T4J4N4 ? ? 'expression tag' 533 3 1 6B8C HIS A 146 ? UNP A0A1T4J4N4 ? ? 'expression tag' 534 4 1 6B8C HIS A 147 ? UNP A0A1T4J4N4 ? ? 'expression tag' 535 5 1 6B8C HIS A 148 ? UNP A0A1T4J4N4 ? ? 'expression tag' 536 6 1 6B8C HIS A 149 ? UNP A0A1T4J4N4 ? ? 'expression tag' 537 7 1 6B8C HIS A 150 ? UNP A0A1T4J4N4 ? ? 'expression tag' 538 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6B8C _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M ammonium sulfate, 0.1 M Bis-Tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97930 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97930 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6B8C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8107 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.109 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.79 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.55 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6B8C _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.403 _refine.ls_d_res_low 44.894 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7155 _refine.ls_number_reflns_R_free 717 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.17 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2426 _refine.ls_R_factor_R_free 0.2692 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2395 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4FDY _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.38 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.46 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 870 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 878 _refine_hist.d_res_high 2.403 _refine_hist.d_res_low 44.894 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 898 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.640 ? 1225 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.418 ? 496 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 126 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 158 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4031 2.5886 . . 135 1200 96.00 . . . 0.4356 . 0.4447 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5886 2.8491 . . 138 1254 100.00 . . . 0.2577 . 0.2887 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8491 3.2613 . . 142 1274 100.00 . . . 0.3492 . 0.2783 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2613 4.1084 . . 144 1292 100.00 . . . 0.2400 . 0.2198 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1084 44.9014 . . 158 1418 100.00 . . . 0.2527 . 0.2171 . . . . . . . . . . # _struct.entry_id 6B8C _struct.title 'Crystal structure of NlpC/p60 domain of peptidoglycan hydrolase SagA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6B8C _struct_keywords.text 'peptidoglycan endopeptidase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 27 ? LYS A 37 ? ASN A 415 LYS A 425 1 ? 11 HELX_P HELX_P2 AA2 ASP A 54 ? GLY A 68 ? ASP A 442 GLY A 456 1 ? 15 HELX_P HELX_P3 AA3 VAL A 76 ? ALA A 81 ? VAL A 464 ALA A 469 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 48 ? ASP A 49 ? LYS A 436 ASP A 437 AA1 2 GLY A 52 ? PHE A 53 ? GLY A 440 PHE A 441 AA2 1 THR A 83 ? ILE A 85 ? THR A 471 ILE A 473 AA2 2 PHE A 138 ? SER A 141 ? PHE A 526 SER A 529 AA2 3 LEU A 95 ? TRP A 98 ? LEU A 483 TRP A 486 AA2 4 HIS A 106 ? GLY A 112 ? HIS A 494 GLY A 500 AA2 5 GLN A 115 ? HIS A 118 ? GLN A 503 HIS A 506 AA2 6 LYS A 127 ? SER A 130 ? LYS A 515 SER A 518 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 49 ? N ASP A 437 O GLY A 52 ? O GLY A 440 AA2 1 2 N THR A 83 ? N THR A 471 O SER A 141 ? O SER A 529 AA2 2 3 O PHE A 138 ? O PHE A 526 N PHE A 97 ? N PHE A 485 AA2 3 4 N LEU A 96 ? N LEU A 484 O ALA A 108 ? O ALA A 496 AA2 4 5 N LEU A 111 ? N LEU A 499 O GLN A 115 ? O GLN A 503 AA2 5 6 N HIS A 118 ? N HIS A 506 O LYS A 127 ? O LYS A 515 # _atom_sites.entry_id 6B8C _atom_sites.fract_transf_matrix[1][1] 0.009962 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009962 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009962 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 389 ? ? ? A . n A 1 2 GLY 2 390 ? ? ? A . n A 1 3 ASN 3 391 ? ? ? A . n A 1 4 SER 4 392 ? ? ? A . n A 1 5 THR 5 393 ? ? ? A . n A 1 6 GLY 6 394 ? ? ? A . n A 1 7 SER 7 395 ? ? ? A . n A 1 8 ASN 8 396 ? ? ? A . n A 1 9 ALA 9 397 ? ? ? A . n A 1 10 THR 10 398 ? ? ? A . n A 1 11 ASN 11 399 ? ? ? A . n A 1 12 ASN 12 400 ? ? ? A . n A 1 13 THR 13 401 ? ? ? A . n A 1 14 THR 14 402 ? ? ? A . n A 1 15 ASN 15 403 ? ? ? A . n A 1 16 THR 16 404 ? ? ? A . n A 1 17 THR 17 405 ? ? ? A . n A 1 18 PRO 18 406 ? ? ? A . n A 1 19 THR 19 407 ? ? ? A . n A 1 20 PRO 20 408 ? ? ? A . n A 1 21 THR 21 409 ? ? ? A . n A 1 22 PRO 22 410 ? ? ? A . n A 1 23 SER 23 411 ? ? ? A . n A 1 24 GLY 24 412 ? ? ? A . n A 1 25 SER 25 413 ? ? ? A . n A 1 26 VAL 26 414 414 VAL VAL A . n A 1 27 ASN 27 415 415 ASN ASN A . n A 1 28 GLY 28 416 416 GLY GLY A . n A 1 29 ALA 29 417 417 ALA ALA A . n A 1 30 ALA 30 418 418 ALA ALA A . n A 1 31 ILE 31 419 419 ILE ILE A . n A 1 32 VAL 32 420 420 VAL VAL A . n A 1 33 ALA 33 421 421 ALA ALA A . n A 1 34 GLU 34 422 422 GLU GLU A . n A 1 35 ALA 35 423 423 ALA ALA A . n A 1 36 TYR 36 424 424 TYR TYR A . n A 1 37 LYS 37 425 425 LYS LYS A . n A 1 38 TYR 38 426 426 TYR TYR A . n A 1 39 ILE 39 427 427 ILE ILE A . n A 1 40 GLY 40 428 428 GLY GLY A . n A 1 41 THR 41 429 429 THR THR A . n A 1 42 PRO 42 430 430 PRO PRO A . n A 1 43 TYR 43 431 431 TYR TYR A . n A 1 44 VAL 44 432 432 VAL VAL A . n A 1 45 TRP 45 433 433 TRP TRP A . n A 1 46 GLY 46 434 434 GLY GLY A . n A 1 47 GLY 47 435 435 GLY GLY A . n A 1 48 LYS 48 436 436 LYS LYS A . n A 1 49 ASP 49 437 437 ASP ASP A . n A 1 50 PRO 50 438 438 PRO PRO A . n A 1 51 SER 51 439 439 SER SER A . n A 1 52 GLY 52 440 440 GLY GLY A . n A 1 53 PHE 53 441 441 PHE PHE A . n A 1 54 ASP 54 442 442 ASP ASP A . n A 1 55 CYS 55 443 443 CYS CYS A . n A 1 56 SER 56 444 444 SER SER A . n A 1 57 GLY 57 445 445 GLY GLY A . n A 1 58 PHE 58 446 446 PHE PHE A . n A 1 59 THR 59 447 447 THR THR A . n A 1 60 ARG 60 448 448 ARG ARG A . n A 1 61 TYR 61 449 449 TYR TYR A . n A 1 62 VAL 62 450 450 VAL VAL A . n A 1 63 TYR 63 451 451 TYR TYR A . n A 1 64 LEU 64 452 452 LEU LEU A . n A 1 65 GLN 65 453 453 GLN GLN A . n A 1 66 VAL 66 454 454 VAL VAL A . n A 1 67 THR 67 455 455 THR THR A . n A 1 68 GLY 68 456 456 GLY GLY A . n A 1 69 ARG 69 457 457 ARG ARG A . n A 1 70 ASP 70 458 458 ASP ASP A . n A 1 71 ILE 71 459 459 ILE ILE A . n A 1 72 GLY 72 460 460 GLY GLY A . n A 1 73 GLY 73 461 461 GLY GLY A . n A 1 74 TRP 74 462 462 TRP TRP A . n A 1 75 THR 75 463 463 THR THR A . n A 1 76 VAL 76 464 464 VAL VAL A . n A 1 77 PRO 77 465 465 PRO PRO A . n A 1 78 GLN 78 466 466 GLN GLN A . n A 1 79 GLU 79 467 467 GLU GLU A . n A 1 80 SER 80 468 468 SER SER A . n A 1 81 ALA 81 469 469 ALA ALA A . n A 1 82 GLY 82 470 470 GLY GLY A . n A 1 83 THR 83 471 471 THR THR A . n A 1 84 LYS 84 472 472 LYS LYS A . n A 1 85 ILE 85 473 473 ILE ILE A . n A 1 86 SER 86 474 474 SER SER A . n A 1 87 VAL 87 475 475 VAL VAL A . n A 1 88 SER 88 476 476 SER SER A . n A 1 89 GLN 89 477 477 GLN GLN A . n A 1 90 ALA 90 478 478 ALA ALA A . n A 1 91 LYS 91 479 479 LYS LYS A . n A 1 92 ALA 92 480 480 ALA ALA A . n A 1 93 GLY 93 481 481 GLY GLY A . n A 1 94 ASP 94 482 482 ASP ASP A . n A 1 95 LEU 95 483 483 LEU LEU A . n A 1 96 LEU 96 484 484 LEU LEU A . n A 1 97 PHE 97 485 485 PHE PHE A . n A 1 98 TRP 98 486 486 TRP TRP A . n A 1 99 GLY 99 487 487 GLY GLY A . n A 1 100 SER 100 488 488 SER SER A . n A 1 101 PRO 101 489 489 PRO PRO A . n A 1 102 GLY 102 490 490 GLY GLY A . n A 1 103 GLY 103 491 491 GLY GLY A . n A 1 104 THR 104 492 492 THR THR A . n A 1 105 TYR 105 493 493 TYR TYR A . n A 1 106 HIS 106 494 494 HIS HIS A . n A 1 107 VAL 107 495 495 VAL VAL A . n A 1 108 ALA 108 496 496 ALA ALA A . n A 1 109 ILE 109 497 497 ILE ILE A . n A 1 110 ALA 110 498 498 ALA ALA A . n A 1 111 LEU 111 499 499 LEU LEU A . n A 1 112 GLY 112 500 500 GLY GLY A . n A 1 113 GLY 113 501 501 GLY GLY A . n A 1 114 GLY 114 502 502 GLY GLY A . n A 1 115 GLN 115 503 503 GLN GLN A . n A 1 116 TYR 116 504 504 TYR TYR A . n A 1 117 ILE 117 505 505 ILE ILE A . n A 1 118 HIS 118 506 506 HIS HIS A . n A 1 119 ALA 119 507 507 ALA ALA A . n A 1 120 PRO 120 508 508 PRO PRO A . n A 1 121 GLN 121 509 509 GLN GLN A . n A 1 122 PRO 122 510 510 PRO PRO A . n A 1 123 GLY 123 511 511 GLY GLY A . n A 1 124 GLU 124 512 512 GLU GLU A . n A 1 125 SER 125 513 513 SER SER A . n A 1 126 VAL 126 514 514 VAL VAL A . n A 1 127 LYS 127 515 515 LYS LYS A . n A 1 128 VAL 128 516 516 VAL VAL A . n A 1 129 GLY 129 517 517 GLY GLY A . n A 1 130 SER 130 518 518 SER SER A . n A 1 131 VAL 131 519 519 VAL VAL A . n A 1 132 GLN 132 520 520 GLN GLN A . n A 1 133 TRP 133 521 521 TRP TRP A . n A 1 134 PHE 134 522 522 PHE PHE A . n A 1 135 ALA 135 523 523 ALA ALA A . n A 1 136 PRO 136 524 524 PRO PRO A . n A 1 137 ASP 137 525 525 ASP ASP A . n A 1 138 PHE 138 526 526 PHE PHE A . n A 1 139 ALA 139 527 527 ALA ALA A . n A 1 140 VAL 140 528 528 VAL VAL A . n A 1 141 SER 141 529 529 SER SER A . n A 1 142 MET 142 530 530 MET MET A . n A 1 143 LEU 143 531 ? ? ? A . n A 1 144 GLU 144 532 ? ? ? A . n A 1 145 HIS 145 533 ? ? ? A . n A 1 146 HIS 146 534 ? ? ? A . n A 1 147 HIS 147 535 ? ? ? A . n A 1 148 HIS 148 536 ? ? ? A . n A 1 149 HIS 149 537 ? ? ? A . n A 1 150 HIS 150 538 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 7 HOH HOH A . B 2 HOH 2 602 8 HOH HOH A . B 2 HOH 3 603 6 HOH HOH A . B 2 HOH 4 604 2 HOH HOH A . B 2 HOH 5 605 5 HOH HOH A . B 2 HOH 6 606 1 HOH HOH A . B 2 HOH 7 607 3 HOH HOH A . B 2 HOH 8 608 4 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA octameric 8 3 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2,3,4,5,6,7,8 A,B 3 1,3 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 11030 ? 2 MORE -82 ? 2 'SSA (A^2)' 35180 ? 3 'ABSA (A^2)' 1280 ? 3 MORE -9 ? 3 'SSA (A^2)' 10270 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 200.9040000000 0.0000000000 -1.0000000000 0.0000000000 200.9040000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_758 -x+2,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 200.9040000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 301.3560000000 4 'crystal symmetry operation' 4_578 x,-y+2,-z+3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 200.9040000000 0.0000000000 0.0000000000 -1.0000000000 301.3560000000 5 'crystal symmetry operation' 13_558 y,x,-z+3 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 301.3560000000 6 'crystal symmetry operation' 14_778 -y+2,-x+2,-z+3 0.0000000000 -1.0000000000 0.0000000000 200.9040000000 -1.0000000000 0.0000000000 0.0000000000 200.9040000000 0.0000000000 0.0000000000 -1.0000000000 301.3560000000 7 'crystal symmetry operation' 15_575 y,-x+2,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 200.9040000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 8 'crystal symmetry operation' 16_755 -y+2,x,z 0.0000000000 -1.0000000000 0.0000000000 200.9040000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 607 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-16 2 'Structure model' 1 1 2019-07-31 3 'Structure model' 1 2 2019-12-04 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_pdbx_audit_support.funding_organization' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 108.8705 _pdbx_refine_tls.origin_y 79.4809 _pdbx_refine_tls.origin_z 140.5608 _pdbx_refine_tls.T[1][1] 0.8184 _pdbx_refine_tls.T[2][2] 0.5217 _pdbx_refine_tls.T[3][3] 0.6144 _pdbx_refine_tls.T[1][2] 0.1049 _pdbx_refine_tls.T[1][3] 0.3078 _pdbx_refine_tls.T[2][3] 0.0023 _pdbx_refine_tls.L[1][1] 3.3137 _pdbx_refine_tls.L[2][2] 4.0585 _pdbx_refine_tls.L[3][3] 3.0088 _pdbx_refine_tls.L[1][2] -0.3359 _pdbx_refine_tls.L[1][3] -0.1809 _pdbx_refine_tls.L[2][3] -0.2465 _pdbx_refine_tls.S[1][1] -0.5963 _pdbx_refine_tls.S[1][2] 0.2273 _pdbx_refine_tls.S[1][3] -0.7064 _pdbx_refine_tls.S[2][1] -0.2560 _pdbx_refine_tls.S[2][2] -0.0270 _pdbx_refine_tls.S[2][3] -0.2792 _pdbx_refine_tls.S[3][1] 1.0093 _pdbx_refine_tls.S[3][2] 0.3578 _pdbx_refine_tls.S[3][3] 0.4618 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TRP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 521 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.34 _pdbx_validate_torsion.psi -61.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 389 ? A PRO 1 2 1 Y 1 A GLY 390 ? A GLY 2 3 1 Y 1 A ASN 391 ? A ASN 3 4 1 Y 1 A SER 392 ? A SER 4 5 1 Y 1 A THR 393 ? A THR 5 6 1 Y 1 A GLY 394 ? A GLY 6 7 1 Y 1 A SER 395 ? A SER 7 8 1 Y 1 A ASN 396 ? A ASN 8 9 1 Y 1 A ALA 397 ? A ALA 9 10 1 Y 1 A THR 398 ? A THR 10 11 1 Y 1 A ASN 399 ? A ASN 11 12 1 Y 1 A ASN 400 ? A ASN 12 13 1 Y 1 A THR 401 ? A THR 13 14 1 Y 1 A THR 402 ? A THR 14 15 1 Y 1 A ASN 403 ? A ASN 15 16 1 Y 1 A THR 404 ? A THR 16 17 1 Y 1 A THR 405 ? A THR 17 18 1 Y 1 A PRO 406 ? A PRO 18 19 1 Y 1 A THR 407 ? A THR 19 20 1 Y 1 A PRO 408 ? A PRO 20 21 1 Y 1 A THR 409 ? A THR 21 22 1 Y 1 A PRO 410 ? A PRO 22 23 1 Y 1 A SER 411 ? A SER 23 24 1 Y 1 A GLY 412 ? A GLY 24 25 1 Y 1 A SER 413 ? A SER 25 26 1 Y 1 A LEU 531 ? A LEU 143 27 1 Y 1 A GLU 532 ? A GLU 144 28 1 Y 1 A HIS 533 ? A HIS 145 29 1 Y 1 A HIS 534 ? A HIS 146 30 1 Y 1 A HIS 535 ? A HIS 147 31 1 Y 1 A HIS 536 ? A HIS 148 32 1 Y 1 A HIS 537 ? A HIS 149 33 1 Y 1 A HIS 538 ? A HIS 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Center for Advancing Translational Sciences (NIH/NCATS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'UL1 TR0018663' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4FDY _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 homology ? 2 1 'gel filtration' 'Based on size-exclusion chromatography, it seems it is a monomer in solution.' #