data_6BCS # _entry.id 6BCS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BCS pdb_00006bcs 10.2210/pdb6bcs/pdb WWPDB D_1000230686 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BCS _pdbx_database_status.recvd_initial_deposition_date 2017-10-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cao, Q.' 1 ? 'Sawaya, M.R.' 2 ? 'Eisenberg, D.S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1755-4349 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 1213 _citation.page_last 1221 _citation.title 'Inhibiting amyloid-beta cytotoxicity through its interaction with the cell surface receptor LilrB2 by structure-based design.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41557-018-0147-z _citation.pdbx_database_id_PubMed 30297750 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cao, Q.' 1 ? primary 'Shin, W.S.' 2 ? primary 'Chan, H.' 3 ? primary 'Vuong, C.K.' 4 ? primary 'Dubois, B.' 5 ? primary 'Li, B.' 6 ? primary 'Murray, K.A.' 7 ? primary 'Sawaya, M.R.' 8 ? primary 'Feigon, J.' 9 ? primary 'Black, D.L.' 10 ? primary 'Eisenberg, D.S.' 11 ? primary 'Jiang, L.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6BCS _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.050 _cell.length_a_esd ? _cell.length_b 57.050 _cell.length_b_esd ? _cell.length_c 101.180 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BCS _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Leukocyte immunoglobulin-like receptor subfamily B member 2' 22065.891 1 ? ? ? ? 2 non-polymer syn BENZAMIDINE 120.152 4 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 2 ? ? ? ? 5 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYS RARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFS VGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYS RARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFS VGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 ILE n 1 5 PRO n 1 6 LYS n 1 7 PRO n 1 8 THR n 1 9 LEU n 1 10 TRP n 1 11 ALA n 1 12 GLU n 1 13 PRO n 1 14 ASP n 1 15 SER n 1 16 VAL n 1 17 ILE n 1 18 THR n 1 19 GLN n 1 20 GLY n 1 21 SER n 1 22 PRO n 1 23 VAL n 1 24 THR n 1 25 LEU n 1 26 SER n 1 27 CYS n 1 28 GLN n 1 29 GLY n 1 30 SER n 1 31 LEU n 1 32 GLU n 1 33 ALA n 1 34 GLN n 1 35 GLU n 1 36 TYR n 1 37 ARG n 1 38 LEU n 1 39 TYR n 1 40 ARG n 1 41 GLU n 1 42 LYS n 1 43 LYS n 1 44 SER n 1 45 ALA n 1 46 SER n 1 47 TRP n 1 48 ILE n 1 49 THR n 1 50 ARG n 1 51 ILE n 1 52 ARG n 1 53 PRO n 1 54 GLU n 1 55 LEU n 1 56 VAL n 1 57 LYS n 1 58 ASN n 1 59 GLY n 1 60 GLN n 1 61 PHE n 1 62 HIS n 1 63 ILE n 1 64 PRO n 1 65 SER n 1 66 ILE n 1 67 THR n 1 68 TRP n 1 69 GLU n 1 70 HIS n 1 71 THR n 1 72 GLY n 1 73 ARG n 1 74 TYR n 1 75 GLY n 1 76 CYS n 1 77 GLN n 1 78 TYR n 1 79 TYR n 1 80 SER n 1 81 ARG n 1 82 ALA n 1 83 ARG n 1 84 TRP n 1 85 SER n 1 86 GLU n 1 87 LEU n 1 88 SER n 1 89 ASP n 1 90 PRO n 1 91 LEU n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 MET n 1 96 THR n 1 97 GLY n 1 98 ALA n 1 99 TYR n 1 100 PRO n 1 101 LYS n 1 102 PRO n 1 103 THR n 1 104 LEU n 1 105 SER n 1 106 ALA n 1 107 GLN n 1 108 PRO n 1 109 SER n 1 110 PRO n 1 111 VAL n 1 112 VAL n 1 113 THR n 1 114 SER n 1 115 GLY n 1 116 GLY n 1 117 ARG n 1 118 VAL n 1 119 THR n 1 120 LEU n 1 121 GLN n 1 122 CYS n 1 123 GLU n 1 124 SER n 1 125 GLN n 1 126 VAL n 1 127 ALA n 1 128 PHE n 1 129 GLY n 1 130 GLY n 1 131 PHE n 1 132 ILE n 1 133 LEU n 1 134 CYS n 1 135 LYS n 1 136 GLU n 1 137 GLY n 1 138 GLU n 1 139 ASP n 1 140 GLU n 1 141 HIS n 1 142 PRO n 1 143 GLN n 1 144 CYS n 1 145 LEU n 1 146 ASN n 1 147 SER n 1 148 GLN n 1 149 PRO n 1 150 HIS n 1 151 ALA n 1 152 ARG n 1 153 GLY n 1 154 SER n 1 155 SER n 1 156 ARG n 1 157 ALA n 1 158 ILE n 1 159 PHE n 1 160 SER n 1 161 VAL n 1 162 GLY n 1 163 PRO n 1 164 VAL n 1 165 SER n 1 166 PRO n 1 167 ASN n 1 168 ARG n 1 169 ARG n 1 170 TRP n 1 171 SER n 1 172 HIS n 1 173 ARG n 1 174 CYS n 1 175 TYR n 1 176 GLY n 1 177 TYR n 1 178 ASP n 1 179 LEU n 1 180 ASN n 1 181 SER n 1 182 PRO n 1 183 TYR n 1 184 VAL n 1 185 TRP n 1 186 SER n 1 187 SER n 1 188 PRO n 1 189 SER n 1 190 ASP n 1 191 LEU n 1 192 LEU n 1 193 GLU n 1 194 LEU n 1 195 LEU n 1 196 VAL n 1 197 PRO n 1 198 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 198 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LILRB2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0G2JNQ7_HUMAN _struct_ref.pdbx_db_accession A0A0G2JNQ7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSR ARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSV GPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPG ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BCS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 198 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0G2JNQ7 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 198 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6BCS _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0G2JNQ7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BCS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.53 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.03 M Ammonium sulfate, 0.1 M Bis-Tris pH 5.53, 2.76% PEG 3350, 1.4% w/v benzamidine' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 34.750 _reflns.entry_id 6BCS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 49.695 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10310 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.269 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.980 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.896 _reflns.pdbx_scaling_rejects 55 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.093 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 126498 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.150 ? 3.900 ? ? ? ? 745 99.900 ? ? ? ? 0.737 ? ? ? ? ? ? ? ? 12.034 ? ? ? ? 0.769 ? ? 1 1 0.909 ? 2.150 2.210 ? 4.620 ? ? ? ? 718 100.000 ? ? ? ? 0.574 ? ? ? ? ? ? ? ? 11.340 ? ? ? ? 0.602 ? ? 2 1 0.933 ? 2.210 2.280 ? 6.410 ? ? ? ? 716 100.000 ? ? ? ? 0.432 ? ? ? ? ? ? ? ? 13.127 ? ? ? ? 0.449 ? ? 3 1 0.967 ? 2.280 2.350 ? 6.970 ? ? ? ? 679 100.000 ? ? ? ? 0.393 ? ? ? ? ? ? ? ? 13.225 ? ? ? ? 0.408 ? ? 4 1 0.961 ? 2.350 2.420 ? 8.160 ? ? ? ? 661 100.000 ? ? ? ? 0.334 ? ? ? ? ? ? ? ? 13.051 ? ? ? ? 0.348 ? ? 5 1 0.981 ? 2.420 2.510 ? 9.550 ? ? ? ? 647 100.000 ? ? ? ? 0.271 ? ? ? ? ? ? ? ? 12.938 ? ? ? ? 0.282 ? ? 6 1 0.981 ? 2.510 2.600 ? 10.720 ? ? ? ? 633 100.000 ? ? ? ? 0.233 ? ? ? ? ? ? ? ? 12.782 ? ? ? ? 0.242 ? ? 7 1 0.991 ? 2.600 2.710 ? 12.830 ? ? ? ? 599 100.000 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 12.419 ? ? ? ? 0.194 ? ? 8 1 0.992 ? 2.710 2.830 ? 14.430 ? ? ? ? 575 99.800 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 11.346 ? ? ? ? 0.160 ? ? 9 1 0.993 ? 2.830 2.970 ? 18.320 ? ? ? ? 558 100.000 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 12.857 ? ? ? ? 0.127 ? ? 10 1 0.996 ? 2.970 3.130 ? 22.600 ? ? ? ? 528 99.800 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 13.184 ? ? ? ? 0.098 ? ? 11 1 0.997 ? 3.130 3.320 ? 28.290 ? ? ? ? 512 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 12.975 ? ? ? ? 0.073 ? ? 12 1 0.999 ? 3.320 3.550 ? 30.760 ? ? ? ? 469 99.800 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 12.776 ? ? ? ? 0.070 ? ? 13 1 0.999 ? 3.550 3.830 ? 33.840 ? ? ? ? 450 100.000 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 11.824 ? ? ? ? 0.063 ? ? 14 1 0.999 ? 3.830 4.200 ? 33.550 ? ? ? ? 416 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 10.394 ? ? ? ? 0.061 ? ? 15 1 0.997 ? 4.200 4.700 ? 41.200 ? ? ? ? 379 99.700 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 12.077 ? ? ? ? 0.056 ? ? 16 1 0.998 ? 4.700 5.420 ? 40.070 ? ? ? ? 345 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 11.470 ? ? ? ? 0.053 ? ? 17 1 0.999 ? 5.420 6.640 ? 38.000 ? ? ? ? 291 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 10.986 ? ? ? ? 0.055 ? ? 18 1 0.997 ? 6.640 9.390 ? 36.210 ? ? ? ? 239 98.400 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 9.665 ? ? ? ? 0.057 ? ? 19 1 0.997 ? 9.390 49.695 ? 40.220 ? ? ? ? 150 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 10.027 ? ? ? ? 0.047 ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 97.140 _refine.B_iso_mean 37.5477 _refine.B_iso_min 17.340 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BCS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 49.6950 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10309 _refine.ls_number_reflns_R_free 1031 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9000 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1872 _refine.ls_R_factor_R_free 0.2328 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1821 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2GW5 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.3500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 49.6950 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1579 _refine_hist.pdbx_number_residues_total 196 _refine_hist.pdbx_B_iso_mean_ligand 44.93 _refine_hist.pdbx_B_iso_mean_solvent 38.36 _refine_hist.pdbx_number_atoms_protein 1471 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1581 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.023 ? 2171 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 234 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 280 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.187 ? 934 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0999 2.2106 1428 . 142 1286 100.0000 . . . 0.3192 0.0000 0.2237 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.2106 2.3491 1440 . 144 1296 100.0000 . . . 0.2711 0.0000 0.2040 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.3491 2.5305 1439 . 144 1295 100.0000 . . . 0.3173 0.0000 0.2111 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5305 2.7851 1448 . 145 1303 100.0000 . . . 0.2582 0.0000 0.1957 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.7851 3.1881 1474 . 148 1326 100.0000 . . . 0.2628 0.0000 0.2028 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1881 4.0164 1485 . 148 1337 100.0000 . . . 0.2129 0.0000 0.1678 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.0164 49.7087 1595 . 160 1435 100.0000 . . . 0.1918 0.0000 0.1636 . . . . . . 7 . . . # _struct.entry_id 6BCS _struct.title 'LilrB2 D1D2 domains complexed with benzamidine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BCS _struct_keywords.text 'receptor, IG LIKE DOMAINS, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 3 ? H N N 4 ? I N N 4 ? J N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 52 ? GLU A 54 ? ARG A 51 GLU A 53 5 ? 3 HELX_P HELX_P2 AA2 THR A 67 ? THR A 71 ? THR A 66 THR A 70 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 26 A CYS 75 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf2 disulf ? ? A CYS 122 SG A ? ? 1_555 A CYS 174 SG A ? A CYS 122 A CYS 174 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf3 disulf ? ? A CYS 122 SG B ? ? 1_555 A CYS 174 SG B ? A CYS 122 A CYS 174 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf4 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 144 SG ? ? A CYS 134 A CYS 144 1_555 ? ? ? ? ? ? ? 2.067 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 12 A . ? GLU 11 A PRO 13 A ? PRO 12 A 1 5.01 2 GLN 107 A . ? GLN 107 A PRO 108 A ? PRO 108 A 1 4.04 3 GLY 162 A . ? GLY 162 A PRO 163 A ? PRO 163 A 1 5.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 4 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 8 ? GLU A 12 ? THR A 7 GLU A 11 AA1 2 VAL A 23 ? GLN A 28 ? VAL A 22 GLN A 27 AA1 3 GLN A 60 ? ILE A 63 ? GLN A 59 ILE A 62 AA1 4 VAL A 56 ? LYS A 57 ? VAL A 55 LYS A 56 AA2 1 VAL A 16 ? THR A 18 ? VAL A 15 THR A 17 AA2 2 LEU A 91 ? THR A 96 ? LEU A 91 THR A 96 AA2 3 GLY A 72 ? SER A 80 ? GLY A 71 SER A 79 AA2 4 GLU A 35 ? GLU A 41 ? GLU A 34 GLU A 40 AA2 5 ILE A 48 ? ARG A 50 ? ILE A 47 ARG A 49 AA3 1 VAL A 16 ? THR A 18 ? VAL A 15 THR A 17 AA3 2 LEU A 91 ? THR A 96 ? LEU A 91 THR A 96 AA3 3 GLY A 72 ? SER A 80 ? GLY A 71 SER A 79 AA3 4 ARG A 83 ? TRP A 84 ? ARG A 82 TRP A 84 AA4 1 THR A 103 ? GLN A 107 ? THR A 103 GLN A 107 AA4 2 VAL A 118 ? PHE A 128 ? VAL A 118 PHE A 128 AA4 3 SER A 154 ? VAL A 161 ? SER A 154 VAL A 161 AA5 1 GLN A 143 ? ASN A 146 ? GLN A 143 ASN A 146 AA5 2 GLY A 130 ? GLU A 136 ? GLY A 130 GLU A 136 AA5 3 TRP A 170 ? ASP A 178 ? TRP A 170 ASP A 178 AA5 4 SER A 181 ? TRP A 185 ? SER A 181 TRP A 185 AA6 1 GLN A 143 ? ASN A 146 ? GLN A 143 ASN A 146 AA6 2 GLY A 130 ? GLU A 136 ? GLY A 130 GLU A 136 AA6 3 TRP A 170 ? ASP A 178 ? TRP A 170 ASP A 178 AA6 4 LEU A 192 ? LEU A 194 ? LEU A 192 LEU A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 10 ? N TRP A 9 O SER A 26 ? O SER A 25 AA1 2 3 N VAL A 23 ? N VAL A 22 O ILE A 63 ? O ILE A 62 AA1 3 4 O GLN A 60 ? O GLN A 59 N LYS A 57 ? N LYS A 56 AA2 1 2 N ILE A 17 ? N ILE A 16 O VAL A 94 ? O VAL A 94 AA2 2 3 O LEU A 91 ? O LEU A 91 N TYR A 74 ? N TYR A 73 AA2 3 4 O GLY A 75 ? O GLY A 74 N TYR A 39 ? N TYR A 38 AA2 4 5 N ARG A 40 ? N ARG A 39 O THR A 49 ? O THR A 48 AA3 1 2 N ILE A 17 ? N ILE A 16 O VAL A 94 ? O VAL A 94 AA3 2 3 O LEU A 91 ? O LEU A 91 N TYR A 74 ? N TYR A 73 AA3 3 4 N SER A 80 ? N SER A 79 O ARG A 83 ? O ARG A 82 AA4 1 2 N THR A 103 ? N THR A 103 O GLU A 123 ? O GLU A 123 AA4 2 3 N LEU A 120 ? N LEU A 120 O PHE A 159 ? O PHE A 159 AA5 1 2 O LEU A 145 ? O LEU A 145 N LEU A 133 ? N LEU A 133 AA5 2 3 N CYS A 134 ? N CYS A 134 O ARG A 173 ? O ARG A 173 AA5 3 4 N ASP A 178 ? N ASP A 178 O SER A 181 ? O SER A 181 AA6 1 2 O LEU A 145 ? O LEU A 145 N LEU A 133 ? N LEU A 133 AA6 2 3 N CYS A 134 ? N CYS A 134 O ARG A 173 ? O ARG A 173 AA6 3 4 N HIS A 172 ? N HIS A 172 O LEU A 192 ? O LEU A 192 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BEN 201 ? 8 'binding site for residue BEN A 201' AC2 Software A BEN 202 ? 6 'binding site for residue BEN A 202' AC3 Software A BEN 203 ? 6 'binding site for residue BEN A 203' AC4 Software A BEN 204 ? 5 'binding site for residue BEN A 204' AC5 Software A CL 205 ? 6 'binding site for residue CL A 205' AC6 Software A CL 206 ? 1 'binding site for residue CL A 206' AC7 Software A DMS 208 ? 5 'binding site for residue DMS A 208' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 THR A 67 ? THR A 66 . ? 7_465 ? 2 AC1 8 TYR A 99 ? TYR A 99 . ? 1_555 ? 3 AC1 8 PRO A 100 ? PRO A 100 . ? 1_555 ? 4 AC1 8 VAL A 126 ? VAL A 126 . ? 1_555 ? 5 AC1 8 ALA A 127 ? ALA A 127 . ? 1_555 ? 6 AC1 8 PHE A 128 ? PHE A 128 . ? 1_555 ? 7 AC1 8 ASP A 178 ? ASP A 178 . ? 1_555 ? 8 AC1 8 CL F . ? CL A 205 . ? 7_465 ? 9 AC2 6 GLU A 41 ? GLU A 40 . ? 1_555 ? 10 AC2 6 ARG A 73 ? ARG A 72 . ? 1_555 ? 11 AC2 6 TYR A 74 ? TYR A 73 . ? 1_555 ? 12 AC2 6 GLY A 75 ? GLY A 74 . ? 1_555 ? 13 AC2 6 LEU A 195 ? LEU A 195 . ? 7_455 ? 14 AC2 6 DMS I . ? DMS A 208 . ? 1_555 ? 15 AC3 6 GLY A 29 ? GLY A 28 . ? 3_455 ? 16 AC3 6 ILE A 132 ? ILE A 132 . ? 1_555 ? 17 AC3 6 ASN A 146 ? ASN A 146 . ? 1_555 ? 18 AC3 6 TYR A 177 ? TYR A 177 . ? 1_555 ? 19 AC3 6 PRO A 182 ? PRO A 182 . ? 1_555 ? 20 AC3 6 HOH J . ? HOH A 321 . ? 1_555 ? 21 AC4 5 ASP A 14 ? ASP A 13 . ? 1_555 ? 22 AC4 5 SER A 15 ? SER A 14 . ? 1_555 ? 23 AC4 5 VAL A 16 ? VAL A 15 . ? 1_555 ? 24 AC4 5 PRO A 142 ? PRO A 142 . ? 1_555 ? 25 AC4 5 CYS A 144 ? CYS A 144 . ? 1_555 ? 26 AC5 6 GLN A 19 ? GLN A 18 . ? 1_555 ? 27 AC5 6 THR A 67 ? THR A 66 . ? 1_555 ? 28 AC5 6 TRP A 68 ? TRP A 67 . ? 1_555 ? 29 AC5 6 MET A 95 ? MET A 95 . ? 1_555 ? 30 AC5 6 TYR A 99 ? TYR A 99 . ? 7_465 ? 31 AC5 6 BEN B . ? BEN A 201 . ? 7_465 ? 32 AC6 1 ILE A 158 ? ILE A 158 . ? 1_555 ? 33 AC7 5 ASN A 58 ? ASN A 57 . ? 3_455 ? 34 AC7 5 ARG A 73 ? ARG A 72 . ? 1_555 ? 35 AC7 5 BEN C . ? BEN A 202 . ? 1_555 ? 36 AC7 5 HOH J . ? HOH A 314 . ? 1_555 ? 37 AC7 5 HOH J . ? HOH A 317 . ? 3_455 ? # _atom_sites.entry_id 6BCS _atom_sites.fract_transf_matrix[1][1] 0.017528 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017528 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009883 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 PRO 7 6 6 PRO PRO A . n A 1 8 THR 8 7 7 THR THR A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 TRP 10 9 9 TRP TRP A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 THR 18 17 17 THR THR A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 PRO 22 21 21 PRO PRO A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 THR 24 23 23 THR THR A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 CYS 27 26 26 CYS CYS A . n A 1 28 GLN 28 27 27 GLN GLN A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 GLN 34 33 33 GLN GLN A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 TYR 36 35 35 TYR TYR A . n A 1 37 ARG 37 36 36 ARG ARG A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 ALA 45 44 44 ALA ALA A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 TRP 47 46 46 TRP TRP A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 THR 49 48 48 THR THR A . n A 1 50 ARG 50 49 49 ARG ARG A . n A 1 51 ILE 51 50 50 ILE ILE A . n A 1 52 ARG 52 51 51 ARG ARG A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ASN 58 57 57 ASN ASN A . n A 1 59 GLY 59 58 58 GLY GLY A . n A 1 60 GLN 60 59 59 GLN GLN A . n A 1 61 PHE 61 60 60 PHE PHE A . n A 1 62 HIS 62 61 61 HIS HIS A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 SER 65 64 64 SER SER A . n A 1 66 ILE 66 65 65 ILE ILE A . n A 1 67 THR 67 66 66 THR THR A . n A 1 68 TRP 68 67 67 TRP TRP A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 HIS 70 69 69 HIS HIS A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 GLY 72 71 71 GLY GLY A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 TYR 74 73 73 TYR TYR A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 CYS 76 75 75 CYS CYS A . n A 1 77 GLN 77 76 76 GLN GLN A . n A 1 78 TYR 78 77 77 TYR TYR A . n A 1 79 TYR 79 78 78 TYR TYR A . n A 1 80 SER 80 79 79 SER SER A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 ARG 83 82 82 ARG ARG A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 TYR 183 183 183 TYR TYR A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 TRP 185 185 185 TRP TRP A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 GLY 198 198 198 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BEN 1 201 1 BEN BEN A . C 2 BEN 1 202 2 BEN BEN A . D 2 BEN 1 203 3 BEN BEN A . E 2 BEN 1 204 4 BEN BEN A . F 3 CL 1 205 2 CL CL A . G 3 CL 1 206 3 CL CL A . H 4 DMS 1 207 1 DMS DMS A . I 4 DMS 1 208 2 DMS DMS A . J 5 HOH 1 301 31 HOH HOH A . J 5 HOH 2 302 45 HOH HOH A . J 5 HOH 3 303 105 HOH HOH A . J 5 HOH 4 304 26 HOH HOH A . J 5 HOH 5 305 50 HOH HOH A . J 5 HOH 6 306 14 HOH HOH A . J 5 HOH 7 307 29 HOH HOH A . J 5 HOH 8 308 81 HOH HOH A . J 5 HOH 9 309 46 HOH HOH A . J 5 HOH 10 310 74 HOH HOH A . J 5 HOH 11 311 24 HOH HOH A . J 5 HOH 12 312 21 HOH HOH A . J 5 HOH 13 313 92 HOH HOH A . J 5 HOH 14 314 55 HOH HOH A . J 5 HOH 15 315 82 HOH HOH A . J 5 HOH 16 316 28 HOH HOH A . J 5 HOH 17 317 83 HOH HOH A . J 5 HOH 18 318 8 HOH HOH A . J 5 HOH 19 319 52 HOH HOH A . J 5 HOH 20 320 59 HOH HOH A . J 5 HOH 21 321 77 HOH HOH A . J 5 HOH 22 322 11 HOH HOH A . J 5 HOH 23 323 17 HOH HOH A . J 5 HOH 24 324 15 HOH HOH A . J 5 HOH 25 325 86 HOH HOH A . J 5 HOH 26 326 39 HOH HOH A . J 5 HOH 27 327 67 HOH HOH A . J 5 HOH 28 328 73 HOH HOH A . J 5 HOH 29 329 2 HOH HOH A . J 5 HOH 30 330 30 HOH HOH A . J 5 HOH 31 331 89 HOH HOH A . J 5 HOH 32 332 18 HOH HOH A . J 5 HOH 33 333 38 HOH HOH A . J 5 HOH 34 334 90 HOH HOH A . J 5 HOH 35 335 80 HOH HOH A . J 5 HOH 36 336 13 HOH HOH A . J 5 HOH 37 337 103 HOH HOH A . J 5 HOH 38 338 37 HOH HOH A . J 5 HOH 39 339 16 HOH HOH A . J 5 HOH 40 340 97 HOH HOH A . J 5 HOH 41 341 32 HOH HOH A . J 5 HOH 42 342 43 HOH HOH A . J 5 HOH 43 343 54 HOH HOH A . J 5 HOH 44 344 78 HOH HOH A . J 5 HOH 45 345 102 HOH HOH A . J 5 HOH 46 346 5 HOH HOH A . J 5 HOH 47 347 72 HOH HOH A . J 5 HOH 48 348 91 HOH HOH A . J 5 HOH 49 349 4 HOH HOH A . J 5 HOH 50 350 101 HOH HOH A . J 5 HOH 51 351 84 HOH HOH A . J 5 HOH 52 352 7 HOH HOH A . J 5 HOH 53 353 1 HOH HOH A . J 5 HOH 54 354 76 HOH HOH A . J 5 HOH 55 355 104 HOH HOH A . J 5 HOH 56 356 93 HOH HOH A . J 5 HOH 57 357 85 HOH HOH A . J 5 HOH 58 358 75 HOH HOH A . J 5 HOH 59 359 48 HOH HOH A . J 5 HOH 60 360 71 HOH HOH A . J 5 HOH 61 361 79 HOH HOH A . J 5 HOH 62 362 95 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id DMS _pdbx_struct_special_symmetry.auth_seq_id 207 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id DMS _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-05 2 'Structure model' 1 1 2018-10-24 3 'Structure model' 1 2 2018-12-05 4 'Structure model' 1 3 2019-02-20 5 'Structure model' 1 4 2019-12-18 6 'Structure model' 1 5 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 4 'Structure model' 'Author supporting evidence' 7 4 'Structure model' 'Data collection' 8 5 'Structure model' 'Author supporting evidence' 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity_src_gen 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' pdbx_audit_support 7 5 'Structure model' pdbx_audit_support 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 11 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 6 2 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation_author.identifier_ORCID' 11 4 'Structure model' '_pdbx_audit_support.funding_organization' 12 5 'Structure model' '_pdbx_audit_support.funding_organization' 13 6 'Structure model' '_database_2.pdbx_DOI' 14 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -24.2388 _pdbx_refine_tls.origin_y 10.7851 _pdbx_refine_tls.origin_z -2.4184 _pdbx_refine_tls.T[1][1] 0.2051 _pdbx_refine_tls.T[2][2] 0.2274 _pdbx_refine_tls.T[3][3] 0.2330 _pdbx_refine_tls.T[1][2] -0.0010 _pdbx_refine_tls.T[1][3] 0.0182 _pdbx_refine_tls.T[2][3] -0.0033 _pdbx_refine_tls.L[1][1] 0.3594 _pdbx_refine_tls.L[2][2] 0.4338 _pdbx_refine_tls.L[3][3] 0.4631 _pdbx_refine_tls.L[1][2] 0.2321 _pdbx_refine_tls.L[1][3] 0.2260 _pdbx_refine_tls.L[2][3] 0.0394 _pdbx_refine_tls.S[1][1] 0.0510 _pdbx_refine_tls.S[2][2] -0.0164 _pdbx_refine_tls.S[3][3] 0.0000 _pdbx_refine_tls.S[1][2] -0.0169 _pdbx_refine_tls.S[1][3] -0.0383 _pdbx_refine_tls.S[2][3] -0.0731 _pdbx_refine_tls.S[2][1] -0.0355 _pdbx_refine_tls.S[3][1] 0.0240 _pdbx_refine_tls.S[3][2] 0.0319 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 2 A 198 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 1 B 4 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C 1 C 105 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 E 2 E 3 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 F 1 F 2 all ? ? ? ? ? # _pdbx_phasing_MR.entry_id 6BCS _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 1.690 _pdbx_phasing_MR.d_res_low_rotation 50.580 _pdbx_phasing_MR.d_res_high_translation 1.690 _pdbx_phasing_MR.d_res_low_translation 50.580 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.1 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 152 ? ? -109.80 42.16 2 1 PRO A 163 ? ? -6.27 94.77 3 1 TRP A 170 ? ? -117.82 71.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 2 ? OG1 ? A THR 3 OG1 2 1 Y 1 A THR 2 ? CG2 ? A THR 3 CG2 3 1 Y 1 A GLU 34 ? CD ? A GLU 35 CD 4 1 Y 1 A GLU 34 ? OE1 ? A GLU 35 OE1 5 1 Y 1 A GLU 34 ? OE2 ? A GLU 35 OE2 6 1 Y 1 A LYS 56 ? CG ? A LYS 57 CG 7 1 Y 1 A LYS 56 ? CD ? A LYS 57 CD 8 1 Y 1 A LYS 56 ? CE ? A LYS 57 CE 9 1 Y 1 A LYS 56 ? NZ ? A LYS 57 NZ 10 1 Y 1 A ARG 80 ? CG ? A ARG 81 CG 11 1 Y 1 A ARG 80 ? CD ? A ARG 81 CD 12 1 Y 1 A ARG 80 ? NE ? A ARG 81 NE 13 1 Y 1 A ARG 80 ? CZ ? A ARG 81 CZ 14 1 Y 1 A ARG 80 ? NH1 ? A ARG 81 NH1 15 1 Y 1 A ARG 80 ? NH2 ? A ARG 81 NH2 16 1 Y 1 A GLU 86 ? CG ? A GLU 86 CG 17 1 Y 1 A GLU 86 ? CD ? A GLU 86 CD 18 1 Y 1 A GLU 86 ? OE1 ? A GLU 86 OE1 19 1 Y 1 A GLU 86 ? OE2 ? A GLU 86 OE2 20 1 Y 1 A ARG 117 ? CG ? A ARG 117 CG 21 1 Y 1 A ARG 117 ? CD ? A ARG 117 CD 22 1 Y 1 A ARG 117 ? NE ? A ARG 117 NE 23 1 Y 1 A ARG 117 ? CZ ? A ARG 117 CZ 24 1 Y 1 A ARG 117 ? NH1 ? A ARG 117 NH1 25 1 Y 1 A ARG 117 ? NH2 ? A ARG 117 NH2 26 1 Y 1 A GLN 125 ? CD ? A GLN 125 CD 27 1 Y 1 A GLN 125 ? OE1 ? A GLN 125 OE1 28 1 Y 1 A GLN 125 ? NE2 ? A GLN 125 NE2 29 1 Y 1 A GLU 136 ? CG ? A GLU 136 CG 30 1 Y 1 A GLU 136 ? CD ? A GLU 136 CD 31 1 Y 1 A GLU 136 ? OE1 ? A GLU 136 OE1 32 1 Y 1 A GLU 136 ? OE2 ? A GLU 136 OE2 33 1 Y 1 A GLU 138 ? CG ? A GLU 138 CG 34 1 Y 1 A GLU 138 ? CD ? A GLU 138 CD 35 1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 36 1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 37 1 Y 1 A GLU 140 ? CG ? A GLU 140 CG 38 1 Y 1 A GLU 140 ? CD ? A GLU 140 CD 39 1 Y 1 A GLU 140 ? OE1 ? A GLU 140 OE1 40 1 Y 1 A GLU 140 ? OE2 ? A GLU 140 OE2 41 1 Y 1 A GLN 143 ? CD ? A GLN 143 CD 42 1 Y 1 A GLN 143 ? OE1 ? A GLN 143 OE1 43 1 Y 1 A GLN 143 ? NE2 ? A GLN 143 NE2 44 1 Y 1 A GLN 148 ? CG ? A GLN 148 CG 45 1 Y 1 A GLN 148 ? CD ? A GLN 148 CD 46 1 Y 1 A GLN 148 ? OE1 ? A GLN 148 OE1 47 1 Y 1 A GLN 148 ? NE2 ? A GLN 148 NE2 48 1 Y 1 A ARG 152 ? CG ? A ARG 152 CG 49 1 Y 1 A ARG 152 ? CD ? A ARG 152 CD 50 1 Y 1 A ARG 152 ? NE ? A ARG 152 NE 51 1 Y 1 A ARG 152 ? CZ ? A ARG 152 CZ 52 1 Y 1 A ARG 152 ? NH1 ? A ARG 152 NH1 53 1 Y 1 A ARG 152 ? NH2 ? A ARG 152 NH2 54 1 Y 1 A ARG 156 ? CD ? A ARG 156 CD 55 1 Y 1 A ARG 156 ? NE ? A ARG 156 NE 56 1 Y 1 A ARG 156 ? CZ ? A ARG 156 CZ 57 1 Y 1 A ARG 156 ? NH1 ? A ARG 156 NH1 58 1 Y 1 A ARG 156 ? NH2 ? A ARG 156 NH2 59 1 Y 1 A ARG 168 ? CG ? A ARG 168 CG 60 1 Y 1 A ARG 168 ? CD ? A ARG 168 CD 61 1 Y 1 A ARG 168 ? NE ? A ARG 168 NE 62 1 Y 1 A ARG 168 ? CZ ? A ARG 168 CZ 63 1 Y 1 A ARG 168 ? NH1 ? A ARG 168 NH1 64 1 Y 1 A ARG 168 ? NH2 ? A ARG 168 NH2 65 1 Y 1 A ARG 169 ? CG ? A ARG 169 CG 66 1 Y 1 A ARG 169 ? CD ? A ARG 169 CD 67 1 Y 1 A ARG 169 ? NE ? A ARG 169 NE 68 1 Y 1 A ARG 169 ? CZ ? A ARG 169 CZ 69 1 Y 1 A ARG 169 ? NH1 ? A ARG 169 NH1 70 1 Y 1 A ARG 169 ? NH2 ? A ARG 169 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEN C1 C Y N 74 BEN C2 C Y N 75 BEN C3 C Y N 76 BEN C4 C Y N 77 BEN C5 C Y N 78 BEN C6 C Y N 79 BEN C C N N 80 BEN N1 N N N 81 BEN N2 N N N 82 BEN H2 H N N 83 BEN H3 H N N 84 BEN H4 H N N 85 BEN H5 H N N 86 BEN H6 H N N 87 BEN HN1 H N N 88 BEN HN21 H N N 89 BEN HN22 H N N 90 CL CL CL N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 DMS S S N N 106 DMS O O N N 107 DMS C1 C N N 108 DMS C2 C N N 109 DMS H11 H N N 110 DMS H12 H N N 111 DMS H13 H N N 112 DMS H21 H N N 113 DMS H22 H N N 114 DMS H23 H N N 115 GLN N N N N 116 GLN CA C N S 117 GLN C C N N 118 GLN O O N N 119 GLN CB C N N 120 GLN CG C N N 121 GLN CD C N N 122 GLN OE1 O N N 123 GLN NE2 N N N 124 GLN OXT O N N 125 GLN H H N N 126 GLN H2 H N N 127 GLN HA H N N 128 GLN HB2 H N N 129 GLN HB3 H N N 130 GLN HG2 H N N 131 GLN HG3 H N N 132 GLN HE21 H N N 133 GLN HE22 H N N 134 GLN HXT H N N 135 GLU N N N N 136 GLU CA C N S 137 GLU C C N N 138 GLU O O N N 139 GLU CB C N N 140 GLU CG C N N 141 GLU CD C N N 142 GLU OE1 O N N 143 GLU OE2 O N N 144 GLU OXT O N N 145 GLU H H N N 146 GLU H2 H N N 147 GLU HA H N N 148 GLU HB2 H N N 149 GLU HB3 H N N 150 GLU HG2 H N N 151 GLU HG3 H N N 152 GLU HE2 H N N 153 GLU HXT H N N 154 GLY N N N N 155 GLY CA C N N 156 GLY C C N N 157 GLY O O N N 158 GLY OXT O N N 159 GLY H H N N 160 GLY H2 H N N 161 GLY HA2 H N N 162 GLY HA3 H N N 163 GLY HXT H N N 164 HIS N N N N 165 HIS CA C N S 166 HIS C C N N 167 HIS O O N N 168 HIS CB C N N 169 HIS CG C Y N 170 HIS ND1 N Y N 171 HIS CD2 C Y N 172 HIS CE1 C Y N 173 HIS NE2 N Y N 174 HIS OXT O N N 175 HIS H H N N 176 HIS H2 H N N 177 HIS HA H N N 178 HIS HB2 H N N 179 HIS HB3 H N N 180 HIS HD1 H N N 181 HIS HD2 H N N 182 HIS HE1 H N N 183 HIS HE2 H N N 184 HIS HXT H N N 185 HOH O O N N 186 HOH H1 H N N 187 HOH H2 H N N 188 ILE N N N N 189 ILE CA C N S 190 ILE C C N N 191 ILE O O N N 192 ILE CB C N S 193 ILE CG1 C N N 194 ILE CG2 C N N 195 ILE CD1 C N N 196 ILE OXT O N N 197 ILE H H N N 198 ILE H2 H N N 199 ILE HA H N N 200 ILE HB H N N 201 ILE HG12 H N N 202 ILE HG13 H N N 203 ILE HG21 H N N 204 ILE HG22 H N N 205 ILE HG23 H N N 206 ILE HD11 H N N 207 ILE HD12 H N N 208 ILE HD13 H N N 209 ILE HXT H N N 210 LEU N N N N 211 LEU CA C N S 212 LEU C C N N 213 LEU O O N N 214 LEU CB C N N 215 LEU CG C N N 216 LEU CD1 C N N 217 LEU CD2 C N N 218 LEU OXT O N N 219 LEU H H N N 220 LEU H2 H N N 221 LEU HA H N N 222 LEU HB2 H N N 223 LEU HB3 H N N 224 LEU HG H N N 225 LEU HD11 H N N 226 LEU HD12 H N N 227 LEU HD13 H N N 228 LEU HD21 H N N 229 LEU HD22 H N N 230 LEU HD23 H N N 231 LEU HXT H N N 232 LYS N N N N 233 LYS CA C N S 234 LYS C C N N 235 LYS O O N N 236 LYS CB C N N 237 LYS CG C N N 238 LYS CD C N N 239 LYS CE C N N 240 LYS NZ N N N 241 LYS OXT O N N 242 LYS H H N N 243 LYS H2 H N N 244 LYS HA H N N 245 LYS HB2 H N N 246 LYS HB3 H N N 247 LYS HG2 H N N 248 LYS HG3 H N N 249 LYS HD2 H N N 250 LYS HD3 H N N 251 LYS HE2 H N N 252 LYS HE3 H N N 253 LYS HZ1 H N N 254 LYS HZ2 H N N 255 LYS HZ3 H N N 256 LYS HXT H N N 257 MET N N N N 258 MET CA C N S 259 MET C C N N 260 MET O O N N 261 MET CB C N N 262 MET CG C N N 263 MET SD S N N 264 MET CE C N N 265 MET OXT O N N 266 MET H H N N 267 MET H2 H N N 268 MET HA H N N 269 MET HB2 H N N 270 MET HB3 H N N 271 MET HG2 H N N 272 MET HG3 H N N 273 MET HE1 H N N 274 MET HE2 H N N 275 MET HE3 H N N 276 MET HXT H N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEN C1 C2 doub Y N 70 BEN C1 C6 sing Y N 71 BEN C1 C sing N N 72 BEN C2 C3 sing Y N 73 BEN C2 H2 sing N N 74 BEN C3 C4 doub Y N 75 BEN C3 H3 sing N N 76 BEN C4 C5 sing Y N 77 BEN C4 H4 sing N N 78 BEN C5 C6 doub Y N 79 BEN C5 H5 sing N N 80 BEN C6 H6 sing N N 81 BEN C N1 doub N E 82 BEN C N2 sing N N 83 BEN N1 HN1 sing N N 84 BEN N2 HN21 sing N N 85 BEN N2 HN22 sing N N 86 CYS N CA sing N N 87 CYS N H sing N N 88 CYS N H2 sing N N 89 CYS CA C sing N N 90 CYS CA CB sing N N 91 CYS CA HA sing N N 92 CYS C O doub N N 93 CYS C OXT sing N N 94 CYS CB SG sing N N 95 CYS CB HB2 sing N N 96 CYS CB HB3 sing N N 97 CYS SG HG sing N N 98 CYS OXT HXT sing N N 99 DMS S O doub N N 100 DMS S C1 sing N N 101 DMS S C2 sing N N 102 DMS C1 H11 sing N N 103 DMS C1 H12 sing N N 104 DMS C1 H13 sing N N 105 DMS C2 H21 sing N N 106 DMS C2 H22 sing N N 107 DMS C2 H23 sing N N 108 GLN N CA sing N N 109 GLN N H sing N N 110 GLN N H2 sing N N 111 GLN CA C sing N N 112 GLN CA CB sing N N 113 GLN CA HA sing N N 114 GLN C O doub N N 115 GLN C OXT sing N N 116 GLN CB CG sing N N 117 GLN CB HB2 sing N N 118 GLN CB HB3 sing N N 119 GLN CG CD sing N N 120 GLN CG HG2 sing N N 121 GLN CG HG3 sing N N 122 GLN CD OE1 doub N N 123 GLN CD NE2 sing N N 124 GLN NE2 HE21 sing N N 125 GLN NE2 HE22 sing N N 126 GLN OXT HXT sing N N 127 GLU N CA sing N N 128 GLU N H sing N N 129 GLU N H2 sing N N 130 GLU CA C sing N N 131 GLU CA CB sing N N 132 GLU CA HA sing N N 133 GLU C O doub N N 134 GLU C OXT sing N N 135 GLU CB CG sing N N 136 GLU CB HB2 sing N N 137 GLU CB HB3 sing N N 138 GLU CG CD sing N N 139 GLU CG HG2 sing N N 140 GLU CG HG3 sing N N 141 GLU CD OE1 doub N N 142 GLU CD OE2 sing N N 143 GLU OE2 HE2 sing N N 144 GLU OXT HXT sing N N 145 GLY N CA sing N N 146 GLY N H sing N N 147 GLY N H2 sing N N 148 GLY CA C sing N N 149 GLY CA HA2 sing N N 150 GLY CA HA3 sing N N 151 GLY C O doub N N 152 GLY C OXT sing N N 153 GLY OXT HXT sing N N 154 HIS N CA sing N N 155 HIS N H sing N N 156 HIS N H2 sing N N 157 HIS CA C sing N N 158 HIS CA CB sing N N 159 HIS CA HA sing N N 160 HIS C O doub N N 161 HIS C OXT sing N N 162 HIS CB CG sing N N 163 HIS CB HB2 sing N N 164 HIS CB HB3 sing N N 165 HIS CG ND1 sing Y N 166 HIS CG CD2 doub Y N 167 HIS ND1 CE1 doub Y N 168 HIS ND1 HD1 sing N N 169 HIS CD2 NE2 sing Y N 170 HIS CD2 HD2 sing N N 171 HIS CE1 NE2 sing Y N 172 HIS CE1 HE1 sing N N 173 HIS NE2 HE2 sing N N 174 HIS OXT HXT sing N N 175 HOH O H1 sing N N 176 HOH O H2 sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute on Aging (NIH/NIA)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'NIH AG054022' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 BENZAMIDINE BEN 3 'CHLORIDE ION' CL 4 'DIMETHYL SULFOXIDE' DMS 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GW5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #