data_6BI5 # _entry.id 6BI5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BI5 pdb_00006bi5 10.2210/pdb6bi5/pdb WWPDB D_1000230893 ? ? BMRB 30351 ? 10.13018/BMR30351 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-26 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6BI5 _pdbx_database_status.recvd_initial_deposition_date 2017-10-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'NMR Solution structure' 30351 unspecified BMRB . 30354 unspecified PDB . 6BB6 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Escobedo-Gonzalez, F.C.' 1 0000-0003-0778-2255 'del Rio-Portilla, F.' 2 0000-0001-8672-0567 'Rodriguez-Solano, L.A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'From good defence into mortal risk: NMR studyand conversion of a defensin into a neurotoxin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Escobedo-Gonzalez, F.C.' 1 ? primary 'del Rio-Portilla, F.' 2 ? primary 'Franco-Bodek, D.' 3 ? primary 'Rodriguez-de la Vega, R.' 4 ? primary 'Carrillo-Flores, E.' 5 ? primary 'Rodriguez-Solano, L.A.' 6 ? primary 'Flores-Solis, D.' 7 ? primary 'Garaza-Garcia, A.' 8 ? primary 'Titaux-Delgado, G.A.' 9 ? primary 'Lopez-Vera, E.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Defensin-1 _entity.formula_weight 3609.173 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Cll-dlp # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GMACQFWSCNSSCISRGYRQGKCWGKYCQCY _entity_poly.pdbx_seq_one_letter_code_can GMACQFWSCNSSCISRGYRQGKCWGKYCQCY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ALA n 1 4 CYS n 1 5 GLN n 1 6 PHE n 1 7 TRP n 1 8 SER n 1 9 CYS n 1 10 ASN n 1 11 SER n 1 12 SER n 1 13 CYS n 1 14 ILE n 1 15 SER n 1 16 ARG n 1 17 GLY n 1 18 TYR n 1 19 ARG n 1 20 GLN n 1 21 GLY n 1 22 LYS n 1 23 CYS n 1 24 TRP n 1 25 GLY n 1 26 LYS n 1 27 TYR n 1 28 CYS n 1 29 GLN n 1 30 CYS n 1 31 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name 'Mexican scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Centruroides limpidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6876 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BI5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6BI5 _struct.title 'NMR solution structure of Defensin1 from Centruroides limpidus limpidus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BI5 _struct_keywords.text 'Toxin, Scorpion, Centruroides limpidus limpidus, Defensin' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEFL1_CENLI _struct_ref.pdbx_db_accession Q6GU94 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACQFWSCNSSCISRGYRQGYCWGIQYKYCQCQ _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BI5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6GU94 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BI5 GLY A 1 ? UNP Q6GU94 ? ? 'expression tag' 1 1 1 6BI5 MET A 2 ? UNP Q6GU94 ? ? 'expression tag' 2 2 1 6BI5 LYS A 22 ? UNP Q6GU94 TYR 44 'engineered mutation' 22 3 1 6BI5 ? A ? ? UNP Q6GU94 ILE 48 deletion ? 4 1 6BI5 ? A ? ? UNP Q6GU94 GLN 49 deletion ? 5 1 6BI5 ? A ? ? UNP Q6GU94 TYR 50 deletion ? 6 1 6BI5 TYR A 31 ? UNP Q6GU94 GLN 56 'engineered mutation' 31 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2670 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 4 A CYS 23 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 9 A CYS 28 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 13 A CYS 30 1_555 ? ? ? ? ? ? ? 2.033 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 23 ? CYS A 4 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 28 ? CYS A 9 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 30 ? CYS A 13 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 20 ? LYS A 22 ? GLN A 20 LYS A 22 AA1 2 GLN A 29 ? TYR A 31 ? GLN A 29 TYR A 31 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # _pdbx_entry_details.entry_id 6BI5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.36 120.30 3.06 0.50 N 2 1 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.26 120.30 3.96 0.50 N 3 2 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.75 120.30 3.45 0.50 N 4 3 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 124.57 120.30 4.27 0.50 N 5 3 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.37 120.30 3.07 0.50 N 6 5 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.50 120.30 4.20 0.50 N 7 6 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.51 120.30 3.21 0.50 N 8 6 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.58 120.30 3.28 0.50 N 9 7 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 125.23 120.30 4.93 0.50 N 10 7 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.32 120.30 3.02 0.50 N 11 7 CA A CYS 30 ? ? CB A CYS 30 ? ? SG A CYS 30 ? ? 121.08 114.20 6.88 1.10 N 12 8 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.66 120.30 3.36 0.50 N 13 9 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.44 120.30 3.14 0.50 N 14 9 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.65 120.30 3.35 0.50 N 15 10 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.97 120.30 3.67 0.50 N 16 11 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 124.09 120.30 3.79 0.50 N 17 11 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.43 120.30 3.13 0.50 N 18 13 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.93 120.30 3.63 0.50 N 19 14 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.50 120.30 3.20 0.50 N 20 14 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.40 120.30 3.10 0.50 N 21 15 CA A CYS 4 ? ? CB A CYS 4 ? ? SG A CYS 4 ? ? 122.43 114.20 8.23 1.10 N 22 15 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 124.76 120.30 4.46 0.50 N 23 16 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.09 120.30 3.79 0.50 N 24 17 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.78 120.30 3.48 0.50 N 25 18 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.37 120.30 3.07 0.50 N 26 18 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.53 120.30 4.23 0.50 N 27 18 CB A TYR 31 ? ? CG A TYR 31 ? ? CD1 A TYR 31 ? ? 117.38 121.00 -3.62 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 24 ? ? -143.98 15.45 2 1 LYS A 26 ? ? -138.84 -48.92 3 1 CYS A 28 ? ? -69.19 85.49 4 2 ALA A 3 ? ? -155.43 -13.40 5 2 CYS A 30 ? ? 60.99 147.19 6 3 ALA A 3 ? ? -78.00 24.74 7 3 TRP A 7 ? ? -98.57 -62.21 8 3 TRP A 24 ? ? -86.49 39.04 9 3 GLN A 29 ? ? -64.70 98.88 10 4 TRP A 24 ? ? -142.27 36.94 11 4 LYS A 26 ? ? -149.72 -54.26 12 5 LYS A 26 ? ? -94.04 -61.51 13 5 CYS A 28 ? ? -68.35 73.34 14 6 CYS A 4 ? ? -112.99 65.29 15 6 LYS A 26 ? ? -152.71 -45.20 16 7 CYS A 4 ? ? -149.27 32.59 17 7 TRP A 7 ? ? -106.07 -60.96 18 8 ALA A 3 ? ? -152.77 -13.95 19 8 CYS A 28 ? ? -65.48 78.82 20 9 GLN A 5 ? ? -59.40 103.05 21 9 TRP A 24 ? ? -144.80 23.25 22 9 LYS A 26 ? ? -158.21 -50.04 23 10 TRP A 24 ? ? -73.01 28.16 24 10 LYS A 26 ? ? -130.93 -43.39 25 11 CYS A 4 ? ? -79.62 26.72 26 11 GLN A 5 ? ? -62.39 99.24 27 11 LYS A 22 ? ? -65.94 86.43 28 11 LYS A 26 ? ? -141.47 -36.64 29 12 ALA A 3 ? ? 57.60 -2.43 30 13 ALA A 3 ? ? 59.12 7.42 31 13 TRP A 24 ? ? -143.53 28.18 32 14 ARG A 19 ? ? -81.47 47.23 33 14 TRP A 24 ? ? -144.40 26.99 34 14 LYS A 26 ? ? -149.47 -41.56 35 15 CYS A 4 ? ? -172.31 130.77 36 16 ALA A 3 ? ? -151.17 62.25 37 16 ARG A 16 ? ? -99.77 -60.15 38 16 LYS A 26 ? ? -144.42 -47.32 39 17 GLN A 20 ? ? -147.27 -81.63 40 17 TRP A 24 ? ? -74.05 25.30 41 17 LYS A 26 ? ? -143.50 -52.19 42 18 LYS A 26 ? ? -130.69 -54.92 43 19 CYS A 4 ? ? -70.12 31.63 44 19 TRP A 24 ? ? -143.90 10.77 45 19 LYS A 26 ? ? -133.97 -56.37 46 19 CYS A 28 ? ? -69.25 90.26 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 TYR A 31 ? ? 0.075 'SIDE CHAIN' 2 8 TYR A 18 ? ? 0.078 'SIDE CHAIN' 3 12 TYR A 18 ? ? 0.070 'SIDE CHAIN' 4 16 TYR A 18 ? ? 0.072 'SIDE CHAIN' 5 19 TYR A 18 ? ? 0.071 'SIDE CHAIN' 6 19 ARG A 19 ? ? 0.081 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6BI5 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6BI5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3 mM M3D1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 'Natural Abundance' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component M3D1 _pdbx_nmr_exptl_sample.concentration 1.3 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength .1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D DQF-COSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 6BI5 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'data analysis' CARA ? 'Keller and Wuthrich' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'chemical shift assignment' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLY N N N N 92 GLY CA C N N 93 GLY C C N N 94 GLY O O N N 95 GLY OXT O N N 96 GLY H H N N 97 GLY H2 H N N 98 GLY HA2 H N N 99 GLY HA3 H N N 100 GLY HXT H N N 101 ILE N N N N 102 ILE CA C N S 103 ILE C C N N 104 ILE O O N N 105 ILE CB C N S 106 ILE CG1 C N N 107 ILE CG2 C N N 108 ILE CD1 C N N 109 ILE OXT O N N 110 ILE H H N N 111 ILE H2 H N N 112 ILE HA H N N 113 ILE HB H N N 114 ILE HG12 H N N 115 ILE HG13 H N N 116 ILE HG21 H N N 117 ILE HG22 H N N 118 ILE HG23 H N N 119 ILE HD11 H N N 120 ILE HD12 H N N 121 ILE HD13 H N N 122 ILE HXT H N N 123 LYS N N N N 124 LYS CA C N S 125 LYS C C N N 126 LYS O O N N 127 LYS CB C N N 128 LYS CG C N N 129 LYS CD C N N 130 LYS CE C N N 131 LYS NZ N N N 132 LYS OXT O N N 133 LYS H H N N 134 LYS H2 H N N 135 LYS HA H N N 136 LYS HB2 H N N 137 LYS HB3 H N N 138 LYS HG2 H N N 139 LYS HG3 H N N 140 LYS HD2 H N N 141 LYS HD3 H N N 142 LYS HE2 H N N 143 LYS HE3 H N N 144 LYS HZ1 H N N 145 LYS HZ2 H N N 146 LYS HZ3 H N N 147 LYS HXT H N N 148 MET N N N N 149 MET CA C N S 150 MET C C N N 151 MET O O N N 152 MET CB C N N 153 MET CG C N N 154 MET SD S N N 155 MET CE C N N 156 MET OXT O N N 157 MET H H N N 158 MET H2 H N N 159 MET HA H N N 160 MET HB2 H N N 161 MET HB3 H N N 162 MET HG2 H N N 163 MET HG3 H N N 164 MET HE1 H N N 165 MET HE2 H N N 166 MET HE3 H N N 167 MET HXT H N N 168 PHE N N N N 169 PHE CA C N S 170 PHE C C N N 171 PHE O O N N 172 PHE CB C N N 173 PHE CG C Y N 174 PHE CD1 C Y N 175 PHE CD2 C Y N 176 PHE CE1 C Y N 177 PHE CE2 C Y N 178 PHE CZ C Y N 179 PHE OXT O N N 180 PHE H H N N 181 PHE H2 H N N 182 PHE HA H N N 183 PHE HB2 H N N 184 PHE HB3 H N N 185 PHE HD1 H N N 186 PHE HD2 H N N 187 PHE HE1 H N N 188 PHE HE2 H N N 189 PHE HZ H N N 190 PHE HXT H N N 191 SER N N N N 192 SER CA C N S 193 SER C C N N 194 SER O O N N 195 SER CB C N N 196 SER OG O N N 197 SER OXT O N N 198 SER H H N N 199 SER H2 H N N 200 SER HA H N N 201 SER HB2 H N N 202 SER HB3 H N N 203 SER HG H N N 204 SER HXT H N N 205 TRP N N N N 206 TRP CA C N S 207 TRP C C N N 208 TRP O O N N 209 TRP CB C N N 210 TRP CG C Y N 211 TRP CD1 C Y N 212 TRP CD2 C Y N 213 TRP NE1 N Y N 214 TRP CE2 C Y N 215 TRP CE3 C Y N 216 TRP CZ2 C Y N 217 TRP CZ3 C Y N 218 TRP CH2 C Y N 219 TRP OXT O N N 220 TRP H H N N 221 TRP H2 H N N 222 TRP HA H N N 223 TRP HB2 H N N 224 TRP HB3 H N N 225 TRP HD1 H N N 226 TRP HE1 H N N 227 TRP HE3 H N N 228 TRP HZ2 H N N 229 TRP HZ3 H N N 230 TRP HH2 H N N 231 TRP HXT H N N 232 TYR N N N N 233 TYR CA C N S 234 TYR C C N N 235 TYR O O N N 236 TYR CB C N N 237 TYR CG C Y N 238 TYR CD1 C Y N 239 TYR CD2 C Y N 240 TYR CE1 C Y N 241 TYR CE2 C Y N 242 TYR CZ C Y N 243 TYR OH O N N 244 TYR OXT O N N 245 TYR H H N N 246 TYR H2 H N N 247 TYR HA H N N 248 TYR HB2 H N N 249 TYR HB3 H N N 250 TYR HD1 H N N 251 TYR HD2 H N N 252 TYR HE1 H N N 253 TYR HE2 H N N 254 TYR HH H N N 255 TYR HXT H N N 256 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLY N CA sing N N 87 GLY N H sing N N 88 GLY N H2 sing N N 89 GLY CA C sing N N 90 GLY CA HA2 sing N N 91 GLY CA HA3 sing N N 92 GLY C O doub N N 93 GLY C OXT sing N N 94 GLY OXT HXT sing N N 95 ILE N CA sing N N 96 ILE N H sing N N 97 ILE N H2 sing N N 98 ILE CA C sing N N 99 ILE CA CB sing N N 100 ILE CA HA sing N N 101 ILE C O doub N N 102 ILE C OXT sing N N 103 ILE CB CG1 sing N N 104 ILE CB CG2 sing N N 105 ILE CB HB sing N N 106 ILE CG1 CD1 sing N N 107 ILE CG1 HG12 sing N N 108 ILE CG1 HG13 sing N N 109 ILE CG2 HG21 sing N N 110 ILE CG2 HG22 sing N N 111 ILE CG2 HG23 sing N N 112 ILE CD1 HD11 sing N N 113 ILE CD1 HD12 sing N N 114 ILE CD1 HD13 sing N N 115 ILE OXT HXT sing N N 116 LYS N CA sing N N 117 LYS N H sing N N 118 LYS N H2 sing N N 119 LYS CA C sing N N 120 LYS CA CB sing N N 121 LYS CA HA sing N N 122 LYS C O doub N N 123 LYS C OXT sing N N 124 LYS CB CG sing N N 125 LYS CB HB2 sing N N 126 LYS CB HB3 sing N N 127 LYS CG CD sing N N 128 LYS CG HG2 sing N N 129 LYS CG HG3 sing N N 130 LYS CD CE sing N N 131 LYS CD HD2 sing N N 132 LYS CD HD3 sing N N 133 LYS CE NZ sing N N 134 LYS CE HE2 sing N N 135 LYS CE HE3 sing N N 136 LYS NZ HZ1 sing N N 137 LYS NZ HZ2 sing N N 138 LYS NZ HZ3 sing N N 139 LYS OXT HXT sing N N 140 MET N CA sing N N 141 MET N H sing N N 142 MET N H2 sing N N 143 MET CA C sing N N 144 MET CA CB sing N N 145 MET CA HA sing N N 146 MET C O doub N N 147 MET C OXT sing N N 148 MET CB CG sing N N 149 MET CB HB2 sing N N 150 MET CB HB3 sing N N 151 MET CG SD sing N N 152 MET CG HG2 sing N N 153 MET CG HG3 sing N N 154 MET SD CE sing N N 155 MET CE HE1 sing N N 156 MET CE HE2 sing N N 157 MET CE HE3 sing N N 158 MET OXT HXT sing N N 159 PHE N CA sing N N 160 PHE N H sing N N 161 PHE N H2 sing N N 162 PHE CA C sing N N 163 PHE CA CB sing N N 164 PHE CA HA sing N N 165 PHE C O doub N N 166 PHE C OXT sing N N 167 PHE CB CG sing N N 168 PHE CB HB2 sing N N 169 PHE CB HB3 sing N N 170 PHE CG CD1 doub Y N 171 PHE CG CD2 sing Y N 172 PHE CD1 CE1 sing Y N 173 PHE CD1 HD1 sing N N 174 PHE CD2 CE2 doub Y N 175 PHE CD2 HD2 sing N N 176 PHE CE1 CZ doub Y N 177 PHE CE1 HE1 sing N N 178 PHE CE2 CZ sing Y N 179 PHE CE2 HE2 sing N N 180 PHE CZ HZ sing N N 181 PHE OXT HXT sing N N 182 SER N CA sing N N 183 SER N H sing N N 184 SER N H2 sing N N 185 SER CA C sing N N 186 SER CA CB sing N N 187 SER CA HA sing N N 188 SER C O doub N N 189 SER C OXT sing N N 190 SER CB OG sing N N 191 SER CB HB2 sing N N 192 SER CB HB3 sing N N 193 SER OG HG sing N N 194 SER OXT HXT sing N N 195 TRP N CA sing N N 196 TRP N H sing N N 197 TRP N H2 sing N N 198 TRP CA C sing N N 199 TRP CA CB sing N N 200 TRP CA HA sing N N 201 TRP C O doub N N 202 TRP C OXT sing N N 203 TRP CB CG sing N N 204 TRP CB HB2 sing N N 205 TRP CB HB3 sing N N 206 TRP CG CD1 doub Y N 207 TRP CG CD2 sing Y N 208 TRP CD1 NE1 sing Y N 209 TRP CD1 HD1 sing N N 210 TRP CD2 CE2 doub Y N 211 TRP CD2 CE3 sing Y N 212 TRP NE1 CE2 sing Y N 213 TRP NE1 HE1 sing N N 214 TRP CE2 CZ2 sing Y N 215 TRP CE3 CZ3 doub Y N 216 TRP CE3 HE3 sing N N 217 TRP CZ2 CH2 doub Y N 218 TRP CZ2 HZ2 sing N N 219 TRP CZ3 CH2 sing Y N 220 TRP CZ3 HZ3 sing N N 221 TRP CH2 HH2 sing N N 222 TRP OXT HXT sing N N 223 TYR N CA sing N N 224 TYR N H sing N N 225 TYR N H2 sing N N 226 TYR CA C sing N N 227 TYR CA CB sing N N 228 TYR CA HA sing N N 229 TYR C O doub N N 230 TYR C OXT sing N N 231 TYR CB CG sing N N 232 TYR CB HB2 sing N N 233 TYR CB HB3 sing N N 234 TYR CG CD1 doub Y N 235 TYR CG CD2 sing Y N 236 TYR CD1 CE1 sing Y N 237 TYR CD1 HD1 sing N N 238 TYR CD2 CE2 doub Y N 239 TYR CD2 HD2 sing N N 240 TYR CE1 CZ doub Y N 241 TYR CE1 HE1 sing N N 242 TYR CE2 CZ sing Y N 243 TYR CE2 HE2 sing N N 244 TYR CZ OH sing N N 245 TYR OH HH sing N N 246 TYR OXT HXT sing N N 247 # _pdbx_audit_support.funding_organization 'Direccion General de Asuntos del Personal Academico, UNAM' _pdbx_audit_support.country Mexico _pdbx_audit_support.grant_number IN207516 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.details '3 mm' # _atom_sites.entry_id 6BI5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_