data_6BP6 # _entry.id 6BP6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6BP6 WWPDB D_1000231225 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BP6 _pdbx_database_status.recvd_initial_deposition_date 2017-11-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Healy, M.D.' 1 ? 'Chandra, M.' 2 ? 'Collins, B.M.' 3 ? 'Ghai, R.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural insights into the architecture and membrane interactions of the conserved COMMD proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.35898 _citation.pdbx_database_id_PubMed 30067224 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Healy, M.D.' 1 0000-0003-2924-9179 primary 'Hospenthal, M.K.' 2 ? primary 'Hall, R.J.' 3 0000-0002-8543-0370 primary 'Chandra, M.' 4 ? primary 'Chilton, M.' 5 0000-0003-2238-9822 primary 'Tillu, V.' 6 0000-0002-1034-9543 primary 'Chen, K.E.' 7 ? primary 'Celligoi, D.J.' 8 ? primary 'McDonald, F.J.' 9 ? primary 'Cullen, P.J.' 10 ? primary 'Lott, J.S.' 11 ? primary 'Collins, B.M.' 12 0000-0002-6070-3774 primary 'Ghai, R.' 13 0000-0002-0919-0934 # _cell.entry_id 6BP6 _cell.length_a 79.404 _cell.length_b 79.404 _cell.length_c 58.572 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BP6 _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'COMM domain-containing protein 9' 10572.486 2 ? ? ? ? 2 water nat water 18.015 9 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ANQISLPRLVDLDWRVDIKTSSDSISR(MSE)AVPTCLLQ(MSE)KIQEDPSLCGDKPSISAVTVELSKETLDT (MSE)LDGLGRIRDQLSAVASKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLS AVASKLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 ASN n 1 4 GLN n 1 5 ILE n 1 6 SER n 1 7 LEU n 1 8 PRO n 1 9 ARG n 1 10 LEU n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 ASP n 1 15 TRP n 1 16 ARG n 1 17 VAL n 1 18 ASP n 1 19 ILE n 1 20 LYS n 1 21 THR n 1 22 SER n 1 23 SER n 1 24 ASP n 1 25 SER n 1 26 ILE n 1 27 SER n 1 28 ARG n 1 29 MSE n 1 30 ALA n 1 31 VAL n 1 32 PRO n 1 33 THR n 1 34 CYS n 1 35 LEU n 1 36 LEU n 1 37 GLN n 1 38 MSE n 1 39 LYS n 1 40 ILE n 1 41 GLN n 1 42 GLU n 1 43 ASP n 1 44 PRO n 1 45 SER n 1 46 LEU n 1 47 CYS n 1 48 GLY n 1 49 ASP n 1 50 LYS n 1 51 PRO n 1 52 SER n 1 53 ILE n 1 54 SER n 1 55 ALA n 1 56 VAL n 1 57 THR n 1 58 VAL n 1 59 GLU n 1 60 LEU n 1 61 SER n 1 62 LYS n 1 63 GLU n 1 64 THR n 1 65 LEU n 1 66 ASP n 1 67 THR n 1 68 MSE n 1 69 LEU n 1 70 ASP n 1 71 GLY n 1 72 LEU n 1 73 GLY n 1 74 ARG n 1 75 ILE n 1 76 ARG n 1 77 ASP n 1 78 GLN n 1 79 LEU n 1 80 SER n 1 81 ALA n 1 82 VAL n 1 83 ALA n 1 84 SER n 1 85 LYS n 1 86 LEU n 1 87 GLU n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 93 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'COMMD9, HSPC166' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COMD9_HUMAN _struct_ref.pdbx_db_accession Q9P000 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSA VASK ; _struct_ref.pdbx_align_begin 115 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6BP6 A 2 ? 85 ? Q9P000 115 ? 198 ? 2 85 2 1 6BP6 B 2 ? 85 ? Q9P000 115 ? 198 ? 2 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BP6 MSE A 1 ? UNP Q9P000 ? ? 'expression tag' 1 1 1 6BP6 LEU A 86 ? UNP Q9P000 ? ? 'expression tag' 86 2 1 6BP6 GLU A 87 ? UNP Q9P000 ? ? 'expression tag' 87 3 1 6BP6 HIS A 88 ? UNP Q9P000 ? ? 'expression tag' 88 4 1 6BP6 HIS A 89 ? UNP Q9P000 ? ? 'expression tag' 89 5 1 6BP6 HIS A 90 ? UNP Q9P000 ? ? 'expression tag' 90 6 1 6BP6 HIS A 91 ? UNP Q9P000 ? ? 'expression tag' 91 7 1 6BP6 HIS A 92 ? UNP Q9P000 ? ? 'expression tag' 92 8 1 6BP6 HIS A 93 ? UNP Q9P000 ? ? 'expression tag' 93 9 2 6BP6 MSE B 1 ? UNP Q9P000 ? ? 'expression tag' 1 10 2 6BP6 LEU B 86 ? UNP Q9P000 ? ? 'expression tag' 86 11 2 6BP6 GLU B 87 ? UNP Q9P000 ? ? 'expression tag' 87 12 2 6BP6 HIS B 88 ? UNP Q9P000 ? ? 'expression tag' 88 13 2 6BP6 HIS B 89 ? UNP Q9P000 ? ? 'expression tag' 89 14 2 6BP6 HIS B 90 ? UNP Q9P000 ? ? 'expression tag' 90 15 2 6BP6 HIS B 91 ? UNP Q9P000 ? ? 'expression tag' 91 16 2 6BP6 HIS B 92 ? UNP Q9P000 ? ? 'expression tag' 92 17 2 6BP6 HIS B 93 ? UNP Q9P000 ? ? 'expression tag' 93 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BP6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES (pH 7.0), 6% Jeffamine M-600' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9787 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9787 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6BP6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.17 _reflns.d_resolution_low 47.13 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9689 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.6 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.17 _reflns_shell.d_res_low 2.24 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 6BP6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9527 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.366 _refine.ls_d_res_high 2.170 _refine.ls_percent_reflns_obs 97.99 _refine.ls_R_factor_obs 0.2514 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2477 _refine.ls_R_factor_R_free 0.2855 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.97 _refine.ls_number_reflns_R_free 950 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.28 _refine.pdbx_overall_phase_error 34.54 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1238 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1247 _refine_hist.d_res_high 2.170 _refine_hist.d_res_low 30.366 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 1248 'X-RAY DIFFRACTION' ? f_angle_d 0.637 ? ? 1682 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.906 ? ? 792 'X-RAY DIFFRACTION' ? f_chiral_restr 0.043 ? ? 212 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 208 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.1699 2.2843 1135 0.3089 93.00 0.3906 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.2843 2.4273 1211 0.3132 96.00 0.3926 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.4273 2.6147 1207 0.3087 98.00 0.3621 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.6147 2.8776 1250 0.2985 99.00 0.3575 . . 137 . . . . 'X-RAY DIFFRACTION' . 2.8776 3.2936 1239 0.2825 100.00 0.3217 . . 145 . . . . 'X-RAY DIFFRACTION' . 3.2936 4.1479 1264 0.2537 100.00 0.2795 . . 135 . . . . 'X-RAY DIFFRACTION' . 4.1479 30.3687 1271 0.2069 100.00 0.2383 . . 140 . . . . # _struct.entry_id 6BP6 _struct.title 'Crystal structure of Commd9 COMM domain' _struct.pdbx_descriptor 'COMM domain-containing protein 9' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BP6 _struct_keywords.text 'Copper metabolism, COMM domain, CCC complex, Commander complex, membrane trafficking, recycling, Retriever, endosome, ENDOCYTOSIS' _struct_keywords.pdbx_keywords ENDOCYTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 61 ? HIS A 88 ? SER A 61 HIS A 88 1 ? 28 HELX_P HELX_P2 AA2 SER B 61 ? HIS B 88 ? SER B 61 HIS B 88 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ARG 28 C ? ? ? 1_555 A MSE 29 N ? ? A ARG 28 A MSE 29 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale both ? A MSE 29 C ? ? ? 1_555 A ALA 30 N ? ? A MSE 29 A ALA 30 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale both ? A GLN 37 C ? ? ? 1_555 A MSE 38 N ? ? A GLN 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.325 ? covale4 covale both ? A MSE 38 C ? ? ? 1_555 A LYS 39 N ? ? A MSE 38 A LYS 39 1_555 ? ? ? ? ? ? ? 1.325 ? covale5 covale both ? A THR 67 C ? ? ? 1_555 A MSE 68 N ? ? A THR 67 A MSE 68 1_555 ? ? ? ? ? ? ? 1.334 ? covale6 covale both ? A MSE 68 C ? ? ? 1_555 A LEU 69 N ? ? A MSE 68 A LEU 69 1_555 ? ? ? ? ? ? ? 1.335 ? covale7 covale both ? B MSE 1 C ? ? ? 1_555 B ALA 2 N ? ? B MSE 1 B ALA 2 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale both ? B ARG 28 C ? ? ? 1_555 B MSE 29 N ? ? B ARG 28 B MSE 29 1_555 ? ? ? ? ? ? ? 1.330 ? covale9 covale both ? B MSE 29 C ? ? ? 1_555 B ALA 30 N ? ? B MSE 29 B ALA 30 1_555 ? ? ? ? ? ? ? 1.329 ? covale10 covale both ? B GLN 37 C ? ? ? 1_555 B MSE 38 N ? ? B GLN 37 B MSE 38 1_555 ? ? ? ? ? ? ? 1.323 ? covale11 covale both ? B MSE 38 C ? ? ? 1_555 B LYS 39 N ? ? B MSE 38 B LYS 39 1_555 ? ? ? ? ? ? ? 1.325 ? covale12 covale both ? B THR 67 C ? ? ? 1_555 B MSE 68 N ? ? B THR 67 B MSE 68 1_555 ? ? ? ? ? ? ? 1.335 ? covale13 covale both ? B MSE 68 C ? ? ? 1_555 B LEU 69 N ? ? B MSE 68 B LEU 69 1_555 ? ? ? ? ? ? ? 1.333 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 9 ? LYS A 20 ? ARG A 9 LYS A 20 AA1 2 VAL A 31 ? GLN A 41 ? VAL A 31 GLN A 41 AA1 3 SER A 54 ? LEU A 60 ? SER A 54 LEU A 60 AA2 1 ARG B 9 ? THR B 21 ? ARG B 9 THR B 21 AA2 2 ALA B 30 ? GLN B 41 ? ALA B 30 GLN B 41 AA2 3 SER B 54 ? LEU B 60 ? SER B 54 LEU B 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 9 ? N ARG A 9 O GLN A 41 ? O GLN A 41 AA1 2 3 N MSE A 38 ? N MSE A 38 O VAL A 56 ? O VAL A 56 AA2 1 2 N ARG B 9 ? N ARG B 9 O GLN B 41 ? O GLN B 41 AA2 2 3 N LEU B 36 ? N LEU B 36 O VAL B 58 ? O VAL B 58 # _atom_sites.entry_id 6BP6 _atom_sites.fract_transf_matrix[1][1] 0.012594 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012594 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017073 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 MSE 29 29 29 MSE MSE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 MSE 38 38 38 MSE MSE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 ? ? ? A . n A 1 45 SER 45 45 ? ? ? A . n A 1 46 LEU 46 46 ? ? ? A . n A 1 47 CYS 47 47 ? ? ? A . n A 1 48 GLY 48 48 ? ? ? A . n A 1 49 ASP 49 49 ? ? ? A . n A 1 50 LYS 50 50 ? ? ? A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 MSE 68 68 68 MSE MSE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n B 1 1 MSE 1 1 1 MSE MSE B . n B 1 2 ALA 2 2 2 ALA ALA B . n B 1 3 ASN 3 3 3 ASN ASN B . n B 1 4 GLN 4 4 4 GLN GLN B . n B 1 5 ILE 5 5 5 ILE ILE B . n B 1 6 SER 6 6 6 SER SER B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 TRP 15 15 15 TRP TRP B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 THR 21 21 21 THR THR B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 SER 23 23 23 SER SER B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 SER 25 25 25 SER SER B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 SER 27 27 27 SER SER B . n B 1 28 ARG 28 28 28 ARG ARG B . n B 1 29 MSE 29 29 29 MSE MSE B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 PRO 32 32 32 PRO PRO B . n B 1 33 THR 33 33 33 THR THR B . n B 1 34 CYS 34 34 34 CYS CYS B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 GLN 37 37 37 GLN GLN B . n B 1 38 MSE 38 38 38 MSE MSE B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 GLN 41 41 41 GLN GLN B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 PRO 44 44 ? ? ? B . n B 1 45 SER 45 45 ? ? ? B . n B 1 46 LEU 46 46 ? ? ? B . n B 1 47 CYS 47 47 ? ? ? B . n B 1 48 GLY 48 48 ? ? ? B . n B 1 49 ASP 49 49 ? ? ? B . n B 1 50 LYS 50 50 ? ? ? B . n B 1 51 PRO 51 51 51 PRO PRO B . n B 1 52 SER 52 52 52 SER SER B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 THR 57 57 57 THR THR B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 SER 61 61 61 SER SER B . n B 1 62 LYS 62 62 62 LYS LYS B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 THR 64 64 64 THR THR B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 THR 67 67 67 THR THR B . n B 1 68 MSE 68 68 68 MSE MSE B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 ASP 70 70 70 ASP ASP B . n B 1 71 GLY 71 71 71 GLY GLY B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 ARG 74 74 74 ARG ARG B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 GLN 78 78 78 GLN GLN B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 ALA 81 81 81 ALA ALA B . n B 1 82 VAL 82 82 82 VAL VAL B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 SER 84 84 84 SER SER B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 GLU 87 87 87 GLU GLU B . n B 1 88 HIS 88 88 88 HIS HIS B . n B 1 89 HIS 89 89 89 HIS HIS B . n B 1 90 HIS 90 90 ? ? ? B . n B 1 91 HIS 91 91 ? ? ? B . n B 1 92 HIS 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 6 HOH HOH A . C 2 HOH 2 102 9 HOH HOH A . C 2 HOH 3 103 5 HOH HOH A . C 2 HOH 4 104 7 HOH HOH A . C 2 HOH 5 105 8 HOH HOH A . C 2 HOH 6 106 4 HOH HOH A . C 2 HOH 7 107 3 HOH HOH A . C 2 HOH 8 108 1 HOH HOH A . D 2 HOH 1 101 2 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 29 A MSE 29 ? MET 'modified residue' 2 A MSE 38 A MSE 38 ? MET 'modified residue' 3 A MSE 68 A MSE 68 ? MET 'modified residue' 4 B MSE 29 B MSE 29 ? MET 'modified residue' 5 B MSE 38 B MSE 38 ? MET 'modified residue' 6 B MSE 68 B MSE 68 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 24190 ? 1 MORE -187 ? 1 'SSA (A^2)' 34290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 79.4040000000 0.0000000000 -1.0000000000 0.0000000000 79.4040000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 79.4040000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 79.4040000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 107 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-15 2 'Structure model' 1 1 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 22.6824 28.7608 9.8432 0.4070 0.4874 0.4078 -0.0969 0.0593 -0.0257 4.2567 4.0455 1.2953 -1.3811 1.9596 2.4958 0.3683 0.2517 -0.1320 -0.9062 0.0382 0.6938 -0.0517 0.1851 -0.4560 'X-RAY DIFFRACTION' 2 ? refined 23.5831 7.9043 28.1843 1.5572 2.1637 1.1117 0.6244 0.7237 0.0385 3.1914 2.3193 0.5291 -2.6976 1.0912 -1.0131 -2.9486 -0.8927 0.1468 2.6186 0.9070 0.1588 -0.1582 0.7252 0.5148 'X-RAY DIFFRACTION' 3 ? refined 25.3560 29.4119 11.3658 0.6217 0.6662 0.6088 0.0158 -0.0260 -0.0709 6.2091 8.9196 6.1881 2.2614 -2.2800 -1.3139 0.0678 0.2561 0.6705 0.0628 0.2525 0.6519 -1.2109 0.1677 -0.0566 'X-RAY DIFFRACTION' 4 ? refined 7.0035 37.6565 16.2017 0.5117 0.7251 1.0008 -0.0732 0.0044 -0.1426 6.4471 5.7250 4.8896 -2.7439 1.1267 -6.0799 -0.0631 -1.0009 -0.4701 -0.2020 0.6846 1.4328 0.2012 -0.6128 -0.7612 'X-RAY DIFFRACTION' 5 ? refined 32.0940 18.0155 22.8436 1.9013 0.0913 1.3254 0.3405 0.9256 0.5597 3.6776 0.2155 0.1396 -1.0828 0.1085 0.0225 -3.9370 -1.4297 -2.8243 2.7163 1.5136 1.2794 4.1567 -0.4744 0.5093 'X-RAY DIFFRACTION' 6 ? refined 16.4365 41.5337 18.5567 0.4591 0.5381 0.7037 -0.0066 0.1466 -0.0182 5.1030 5.2091 6.4339 -5.2759 2.8509 -2.3308 -0.2734 -0.0969 -0.1474 0.8510 0.1400 0.9396 0.0292 0.0815 -0.0608 'X-RAY DIFFRACTION' 7 ? refined 8.7025 55.1251 0.6600 1.1836 2.1504 1.4060 -0.2397 -0.0427 0.4813 0.2712 1.9925 2.0513 -1.7338 -0.6625 0.8820 -0.1149 3.8047 1.1938 1.6541 -1.7195 1.9789 0.0245 -6.0257 0.2730 'X-RAY DIFFRACTION' 8 ? refined 18.4492 40.8443 16.6661 0.5588 0.5197 0.6800 -0.0325 0.0664 0.0118 8.7914 7.3860 2.8427 -2.1936 4.1779 0.2556 0.3126 0.8241 -0.6959 0.2119 -0.3748 0.4153 0.6369 0.7993 0.2142 'X-RAY DIFFRACTION' 9 ? refined 25.6484 36.8212 18.6985 0.5194 0.6250 0.5710 -0.0345 -0.0526 -0.1064 9.1485 6.9714 7.8297 -2.1255 0.6173 -0.3662 -0.6119 0.6011 0.9298 0.5141 -0.2870 -1.2042 0.0335 2.4298 0.0512 'X-RAY DIFFRACTION' 10 ? refined 12.9535 20.7924 12.0130 0.5334 0.6274 1.3161 -0.0251 -0.0384 -0.0793 3.4117 4.0891 4.9655 -2.9155 3.5313 -0.1448 0.6109 1.3475 -1.3391 -1.6436 -0.3180 2.3219 0.7674 0.0111 -0.3173 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 5 through 21 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 22 through 29 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 30 through 61 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 62 through 89 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 1 through 8 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 9 through 21 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 22 through 29 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 30 through 41 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 42 through 61 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 62 through 89 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13rc1_2954: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 106 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 106 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A PRO 44 ? A PRO 44 6 1 Y 1 A SER 45 ? A SER 45 7 1 Y 1 A LEU 46 ? A LEU 46 8 1 Y 1 A CYS 47 ? A CYS 47 9 1 Y 1 A GLY 48 ? A GLY 48 10 1 Y 1 A ASP 49 ? A ASP 49 11 1 Y 1 A LYS 50 ? A LYS 50 12 1 Y 1 A HIS 90 ? A HIS 90 13 1 Y 1 A HIS 91 ? A HIS 91 14 1 Y 1 A HIS 92 ? A HIS 92 15 1 Y 1 A HIS 93 ? A HIS 93 16 1 Y 1 B PRO 44 ? B PRO 44 17 1 Y 1 B SER 45 ? B SER 45 18 1 Y 1 B LEU 46 ? B LEU 46 19 1 Y 1 B CYS 47 ? B CYS 47 20 1 Y 1 B GLY 48 ? B GLY 48 21 1 Y 1 B ASP 49 ? B ASP 49 22 1 Y 1 B LYS 50 ? B LYS 50 23 1 Y 1 B HIS 90 ? B HIS 90 24 1 Y 1 B HIS 91 ? B HIS 91 25 1 Y 1 B HIS 92 ? B HIS 92 26 1 Y 1 B HIS 93 ? B HIS 93 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Health and Medical Research Council (NHMRC, Australia)' Australia 1097185 1 'University of Queensland' Australia 2016003796 2 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1058734 3 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1061574 4 'Australian Research Council (ARC)' Australia DP160101743 5 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #