data_6BPW # _entry.id 6BPW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BPW pdb_00006bpw 10.2210/pdb6bpw/pdb WWPDB D_1000231236 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BPW _pdbx_database_status.recvd_initial_deposition_date 2017-11-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, A.' 1 0000-0002-4182-8176 'Li, J.' 2 ? 'Shin, I.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 853 _citation.page_last 860 _citation.title 'Cleavage of a carbon-fluorine bond by an engineered cysteine dioxygenase.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0085-5 _citation.pdbx_database_id_PubMed 29942080 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 ? primary 'Griffith, W.P.' 2 ? primary 'Davis, I.' 3 ? primary 'Shin, I.' 4 ? primary 'Wang, J.' 5 ? primary 'Li, F.' 6 ? primary 'Wang, Y.' 7 ? primary 'Wherritt, D.J.' 8 0000-0002-8616-9864 primary 'Liu, A.' 9 0000-0002-4182-8176 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6BPW _cell.details ? _cell.formula_units_Z ? _cell.length_a 131.098 _cell.length_a_esd ? _cell.length_b 131.098 _cell.length_b_esd ? _cell.length_c 34.292 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BPW _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 23014.645 1 1.13.11.20 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 6 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 5 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I, CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHL (2LT)SPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;SEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLXSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLN n 1 4 THR n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLN n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 ILE n 1 37 MET n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASP n 1 44 PRO n 1 45 THR n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 MET n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASN n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 MET n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ALA n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 VAL n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 VAL n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 VAL n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 ILE n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 2LT n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 ASN n 1 192 ALA n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CDO1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDO1_HUMAN _struct_ref.pdbx_db_accession Q16878 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGH GSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPF DTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BPW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16878 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BPW SER A 1 ? UNP Q16878 ? ? 'expression tag' 1 1 1 6BPW VAL A 137 ? UNP Q16878 ILE 137 conflict 137 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2LT 'L-peptide linking' n 3,5-dichloro-L-tyrosine ? 'C9 H9 Cl2 N O3' 250.079 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BPW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES, 2 M ammonium sulfate, 2% PEG400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 37.090 _reflns.entry_id 6BPW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.430 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12775 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.700 _reflns.pdbx_Rmerge_I_obs 0.213 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.024 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.225 _reflns.pdbx_Rpim_I_all 0.071 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.430 2.490 ? ? ? ? ? ? 797 94.300 ? ? ? ? 0.675 ? ? ? ? ? ? ? ? 6.400 ? 0.641 ? ? 0.733 0.272 ? 1 1 0.694 ? 2.490 2.550 ? ? ? ? ? ? 838 99.500 ? ? ? ? 0.689 ? ? ? ? ? ? ? ? 7.300 ? 0.649 ? ? 0.741 0.267 ? 2 1 0.851 ? 2.550 2.620 ? ? ? ? ? ? 867 98.500 ? ? ? ? 0.623 ? ? ? ? ? ? ? ? 9.000 ? 0.679 ? ? 0.661 0.216 ? 3 1 0.890 ? 2.620 2.690 ? ? ? ? ? ? 826 97.800 ? ? ? ? 0.539 ? ? ? ? ? ? ? ? 9.500 ? 0.682 ? ? 0.571 0.183 ? 4 1 0.901 ? 2.690 2.780 ? ? ? ? ? ? 860 99.100 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 9.400 ? 0.703 ? ? 0.518 0.166 ? 5 1 0.919 ? 2.780 2.880 ? ? ? ? ? ? 806 92.200 ? ? ? ? 0.456 ? ? ? ? ? ? ? ? 10.500 ? 0.734 ? ? 0.480 0.146 ? 6 1 0.957 ? 2.880 3.000 ? ? ? ? ? ? 848 100.000 ? ? ? ? 0.381 ? ? ? ? ? ? ? ? 10.600 ? 0.751 ? ? 0.401 0.123 ? 7 1 0.964 ? 3.000 3.130 ? ? ? ? ? ? 869 98.300 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 10.600 ? 0.864 ? ? 0.318 0.097 ? 8 1 0.975 ? 3.130 3.300 ? ? ? ? ? ? 853 100.000 ? ? ? ? 0.246 ? ? ? ? ? ? ? ? 10.600 ? 1.019 ? ? 0.259 0.080 ? 9 1 0.978 ? 3.300 3.500 ? ? ? ? ? ? 853 98.700 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 10.200 ? 1.119 ? ? 0.228 0.071 ? 10 1 0.980 ? 3.500 3.770 ? ? ? ? ? ? 848 96.100 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 9.900 ? 1.327 ? ? 0.207 0.065 ? 11 1 0.982 ? 3.770 4.150 ? ? ? ? ? ? 858 99.200 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 10.700 ? 1.472 ? ? 0.193 0.059 ? 12 1 0.982 ? 4.150 4.760 ? ? ? ? ? ? 879 99.500 ? ? ? ? 0.172 ? ? ? ? ? ? ? ? 10.300 ? 1.612 ? ? 0.181 0.056 ? 13 1 0.984 ? 4.760 5.990 ? ? ? ? ? ? 861 95.900 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 10.000 ? 1.416 ? ? 0.169 0.053 ? 14 1 0.984 ? 5.990 50.000 ? ? ? ? ? ? 912 97.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 10.100 ? 1.267 ? ? 0.144 0.046 ? 15 1 0.988 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 94.550 _refine.B_iso_mean 41.1118 _refine.B_iso_min 18.450 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BPW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4300 _refine.ls_d_res_low 32.8270 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12767 _refine.ls_number_reflns_R_free 1265 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.7900 _refine.ls_percent_reflns_R_free 9.9100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1646 _refine.ls_R_factor_R_free 0.2056 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1601 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 2IC1' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.5700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4300 _refine_hist.d_res_low 32.8270 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 1643 _refine_hist.pdbx_number_residues_total 186 _refine_hist.pdbx_B_iso_mean_ligand 63.42 _refine_hist.pdbx_B_iso_mean_solvent 44.64 _refine_hist.pdbx_number_atoms_protein 1512 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4300 2.5272 1360 . 133 1227 96.0000 . . . 0.3012 0.0000 0.2295 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.5272 2.6422 1423 . 143 1280 98.0000 . . . 0.2477 0.0000 0.2083 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.6422 2.7814 1401 . 141 1260 99.0000 . . . 0.2643 0.0000 0.1897 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.7814 2.9556 1366 . 136 1230 95.0000 . . . 0.2514 0.0000 0.1919 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.9556 3.1836 1419 . 138 1281 99.0000 . . . 0.2339 0.0000 0.1823 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.1836 3.5037 1439 . 144 1295 99.0000 . . . 0.1998 0.0000 0.1574 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.5037 4.0099 1418 . 141 1277 97.0000 . . . 0.2165 0.0000 0.1385 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.0099 5.0491 1470 . 144 1326 100.0000 . . . 0.1485 0.0000 0.1182 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 5.0491 32.8303 1471 . 145 1326 96.0000 . . . 0.1858 0.0000 0.1643 . . . . . . 9 . . . # _struct.entry_id 6BPW _struct.title 'Crystal structure of ferrous form of the Cl2-Tyr157 human cysteine dioxygenase with both uncrosslinked and crosslinked cofactor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BPW _struct_keywords.text 'Cysteine, Cys-Tyr cofactor, iron, unnatural amino acid, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 AA2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 AA3 ASP A 43 ? ALA A 48 ? ASP A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 AA4 MET A 49 ? ALA A 51 ? MET A 49 ALA A 51 5 ? 3 HELX_P HELX_P5 AA5 GLN A 65 ? LYS A 69 ? GLN A 65 LYS A 69 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 93 SG B ? ? 1_555 A 2LT 157 CE1 B ? A CYS 93 A 2LT 157 1_555 ? ? ? ? ? ? ? 1.760 ? ? covale2 covale both ? A LEU 156 C ? ? ? 1_555 A 2LT 157 N ? ? A LEU 156 A 2LT 157 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A 2LT 157 C ? ? ? 1_555 A SER 158 N ? ? A 2LT 157 A SER 158 1_555 ? ? ? ? ? ? ? 1.332 ? ? metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 86 A FE2 301 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc2 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 88 A FE2 301 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc3 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 140 A FE2 301 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 L HOH . O ? ? A FE2 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.565 ? ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 L HOH . O ? ? A FE2 301 A HOH 405 1_555 ? ? ? ? ? ? ? 2.563 ? ? metalc6 metalc ? ? B FE2 . FE ? ? ? 1_555 L HOH . O ? ? A FE2 301 A HOH 475 1_555 ? ? ? ? ? ? ? 2.651 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 AA1 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 AA1 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 AA1 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 AA1 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 AA1 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 AA1 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 AA2 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 AA2 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 AA2 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 AA3 1 LYS A 119 ? VAL A 124 ? LYS A 119 VAL A 124 AA3 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 AA3 3 LEU A 139 ? ASN A 144 ? LEU A 139 ASN A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 AA1 2 3 N HIS A 92 ? N HIS A 92 O SER A 158 ? O SER A 158 AA1 3 4 O ALA A 151 ? O ALA A 151 N TRP A 77 ? N TRP A 77 AA1 4 5 O LEU A 72 ? O LEU A 72 N VAL A 63 ? N VAL A 63 AA1 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 AA1 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 AA2 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 AA2 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 AA3 1 2 O ARG A 123 ? O ARG A 123 N GLU A 104 ? N GLU A 104 AA3 2 3 N PHE A 107 ? N PHE A 107 O LEU A 139 ? O LEU A 139 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE2 301 ? 7 'binding site for residue FE2 A 301' AC2 Software A GOL 302 ? 3 'binding site for residue GOL A 302' AC3 Software A GOL 303 ? 5 'binding site for residue GOL A 303' AC4 Software A GOL 304 ? 4 'binding site for residue GOL A 304' AC5 Software A GOL 305 ? 4 'binding site for residue GOL A 305' AC6 Software A GOL 306 ? 6 'binding site for residue GOL A 306' AC7 Software A GOL 307 ? 4 'binding site for residue GOL A 307' AC8 Software A SO4 308 ? 6 'binding site for residue SO4 A 308' AC9 Software A SO4 309 ? 3 'binding site for residue SO4 A 309' AD1 Software A SO4 310 ? 5 'binding site for residue SO4 A 310' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 7 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 7 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 7 2LT A 157 ? 2LT A 157 . ? 1_555 ? 5 AC1 7 HOH L . ? HOH A 402 . ? 1_555 ? 6 AC1 7 HOH L . ? HOH A 405 . ? 1_555 ? 7 AC1 7 HOH L . ? HOH A 475 . ? 1_555 ? 8 AC2 3 PHE A 181 ? PHE A 181 . ? 1_555 ? 9 AC2 3 LYS A 184 ? LYS A 184 . ? 1_555 ? 10 AC2 3 HOH L . ? HOH A 449 . ? 1_555 ? 11 AC3 5 PRO A 44 ? PRO A 44 . ? 1_555 ? 12 AC3 5 LEU A 98 ? LEU A 98 . ? 1_555 ? 13 AC3 5 GLN A 99 ? GLN A 99 . ? 1_555 ? 14 AC3 5 GLU A 127 ? GLU A 127 . ? 1_555 ? 15 AC3 5 HOH L . ? HOH A 442 . ? 1_555 ? 16 AC4 4 GLU A 32 ? GLU A 32 . ? 1_555 ? 17 AC4 4 LEU A 62 ? LEU A 62 . ? 3_455 ? 18 AC4 4 GLN A 65 ? GLN A 65 . ? 3_455 ? 19 AC4 4 LYS A 184 ? LYS A 184 . ? 3_455 ? 20 AC5 4 ARG A 57 ? ARG A 57 . ? 1_555 ? 21 AC5 4 TYR A 58 ? TYR A 58 . ? 1_555 ? 22 AC5 4 SER A 84 ? SER A 84 . ? 1_555 ? 23 AC5 4 HOH L . ? HOH A 408 . ? 1_555 ? 24 AC6 6 ALA A 48 ? ALA A 48 . ? 1_556 ? 25 AC6 6 ALA A 51 ? ALA A 51 . ? 1_556 ? 26 AC6 6 ASN A 90 ? ASN A 90 . ? 1_555 ? 27 AC6 6 HIS A 92 ? HIS A 92 . ? 1_555 ? 28 AC6 6 HOH L . ? HOH A 428 . ? 1_555 ? 29 AC6 6 HOH L . ? HOH A 429 . ? 1_555 ? 30 AC7 4 ARG A 10 ? ARG A 10 . ? 1_555 ? 31 AC7 4 ASP A 14 ? ASP A 14 . ? 1_555 ? 32 AC7 4 LYS A 52 ? LYS A 52 . ? 3_455 ? 33 AC7 4 ARG A 188 ? ARG A 188 . ? 3_455 ? 34 AC8 6 GLN A 34 ? GLN A 34 . ? 1_555 ? 35 AC8 6 ARG A 123 ? ARG A 123 . ? 1_555 ? 36 AC8 6 ALA A 131 ? ALA A 131 . ? 1_555 ? 37 AC8 6 TYR A 132 ? TYR A 132 . ? 1_555 ? 38 AC8 6 HOH L . ? HOH A 403 . ? 1_555 ? 39 AC8 6 HOH L . ? HOH A 415 . ? 1_555 ? 40 AC9 3 LYS A 119 ? LYS A 119 . ? 1_555 ? 41 AC9 3 ARG A 141 ? ARG A 141 . ? 1_555 ? 42 AC9 3 GLN A 169 ? GLN A 169 . ? 1_555 ? 43 AD1 5 TYR A 56 ? TYR A 56 . ? 1_556 ? 44 AD1 5 HIS A 173 ? HIS A 173 . ? 1_555 ? 45 AD1 5 LYS A 174 ? LYS A 174 . ? 1_555 ? 46 AD1 5 HOH L . ? HOH A 411 . ? 1_555 ? 47 AD1 5 HOH L . ? HOH A 414 . ? 1_555 ? # _atom_sites.entry_id 6BPW _atom_sites.fract_transf_matrix[1][1] 0.007628 _atom_sites.fract_transf_matrix[1][2] 0.004404 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008808 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029161 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 2LT 157 157 157 2LT 2LT A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 ASN 191 191 ? ? ? A . n A 1 192 ALA 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 301 201 FE2 FE2 A . C 3 GOL 1 302 201 GOL GOL A . D 3 GOL 1 303 202 GOL GOL A . E 3 GOL 1 304 203 GOL GOL A . F 3 GOL 1 305 204 GOL GOL A . G 3 GOL 1 306 205 GOL GOL A . H 3 GOL 1 307 206 GOL GOL A . I 4 SO4 1 308 301 SO4 SO4 A . J 4 SO4 1 309 302 SO4 SO4 A . K 4 SO4 1 310 303 SO4 SO4 A . L 5 HOH 1 401 68 HOH HOH A . L 5 HOH 2 402 4 HOH HOH A . L 5 HOH 3 403 48 HOH HOH A . L 5 HOH 4 404 49 HOH HOH A . L 5 HOH 5 405 65 HOH HOH A . L 5 HOH 6 406 19 HOH HOH A . L 5 HOH 7 407 12 HOH HOH A . L 5 HOH 8 408 2 HOH HOH A . L 5 HOH 9 409 14 HOH HOH A . L 5 HOH 10 410 53 HOH HOH A . L 5 HOH 11 411 15 HOH HOH A . L 5 HOH 12 412 45 HOH HOH A . L 5 HOH 13 413 56 HOH HOH A . L 5 HOH 14 414 50 HOH HOH A . L 5 HOH 15 415 27 HOH HOH A . L 5 HOH 16 416 82 HOH HOH A . L 5 HOH 17 417 13 HOH HOH A . L 5 HOH 18 418 9 HOH HOH A . L 5 HOH 19 419 33 HOH HOH A . L 5 HOH 20 420 44 HOH HOH A . L 5 HOH 21 421 66 HOH HOH A . L 5 HOH 22 422 70 HOH HOH A . L 5 HOH 23 423 20 HOH HOH A . L 5 HOH 24 424 51 HOH HOH A . L 5 HOH 25 425 21 HOH HOH A . L 5 HOH 26 426 11 HOH HOH A . L 5 HOH 27 427 29 HOH HOH A . L 5 HOH 28 428 54 HOH HOH A . L 5 HOH 29 429 30 HOH HOH A . L 5 HOH 30 430 18 HOH HOH A . L 5 HOH 31 431 22 HOH HOH A . L 5 HOH 32 432 28 HOH HOH A . L 5 HOH 33 433 8 HOH HOH A . L 5 HOH 34 434 39 HOH HOH A . L 5 HOH 35 435 41 HOH HOH A . L 5 HOH 36 436 17 HOH HOH A . L 5 HOH 37 437 24 HOH HOH A . L 5 HOH 38 438 59 HOH HOH A . L 5 HOH 39 439 35 HOH HOH A . L 5 HOH 40 440 16 HOH HOH A . L 5 HOH 41 441 31 HOH HOH A . L 5 HOH 42 442 79 HOH HOH A . L 5 HOH 43 443 80 HOH HOH A . L 5 HOH 44 444 37 HOH HOH A . L 5 HOH 45 445 62 HOH HOH A . L 5 HOH 46 446 67 HOH HOH A . L 5 HOH 47 447 63 HOH HOH A . L 5 HOH 48 448 64 HOH HOH A . L 5 HOH 49 449 61 HOH HOH A . L 5 HOH 50 450 84 HOH HOH A . L 5 HOH 51 451 78 HOH HOH A . L 5 HOH 52 452 25 HOH HOH A . L 5 HOH 53 453 77 HOH HOH A . L 5 HOH 54 454 42 HOH HOH A . L 5 HOH 55 455 74 HOH HOH A . L 5 HOH 56 456 47 HOH HOH A . L 5 HOH 57 457 38 HOH HOH A . L 5 HOH 58 458 90 HOH HOH A . L 5 HOH 59 459 23 HOH HOH A . L 5 HOH 60 460 40 HOH HOH A . L 5 HOH 61 461 26 HOH HOH A . L 5 HOH 62 462 43 HOH HOH A . L 5 HOH 63 463 46 HOH HOH A . L 5 HOH 64 464 55 HOH HOH A . L 5 HOH 65 465 3 HOH HOH A . L 5 HOH 66 466 69 HOH HOH A . L 5 HOH 67 467 87 HOH HOH A . L 5 HOH 68 468 72 HOH HOH A . L 5 HOH 69 469 52 HOH HOH A . L 5 HOH 70 470 32 HOH HOH A . L 5 HOH 71 471 83 HOH HOH A . L 5 HOH 72 472 91 HOH HOH A . L 5 HOH 73 473 85 HOH HOH A . L 5 HOH 74 474 88 HOH HOH A . L 5 HOH 75 475 1 HOH HOH A . L 5 HOH 76 476 76 HOH HOH A . L 5 HOH 77 477 89 HOH HOH A . L 5 HOH 78 478 5 HOH HOH A . L 5 HOH 79 479 86 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id 2LT _pdbx_struct_mod_residue.label_seq_id 157 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id 2LT _pdbx_struct_mod_residue.auth_seq_id 157 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1870 ? 1 MORE -48 ? 1 'SSA (A^2)' 10080 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 97.5 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 93.7 ? 3 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 86.7 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 402 ? 1_555 87.8 ? 5 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 402 ? 1_555 93.3 ? 6 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 402 ? 1_555 178.6 ? 7 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 405 ? 1_555 167.0 ? 8 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 405 ? 1_555 95.5 ? 9 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 405 ? 1_555 85.9 ? 10 O ? L HOH . ? A HOH 402 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 405 ? 1_555 92.6 ? 11 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 475 ? 1_555 88.3 ? 12 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 475 ? 1_555 174.2 ? 13 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 475 ? 1_555 93.8 ? 14 O ? L HOH . ? A HOH 402 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 475 ? 1_555 86.1 ? 15 O ? L HOH . ? A HOH 405 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? L HOH . ? A HOH 475 ? 1_555 78.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-04 2 'Structure model' 1 1 2018-07-11 3 'Structure model' 1 2 2018-08-29 4 'Structure model' 1 3 2019-02-20 5 'Structure model' 1 4 2019-11-27 6 'Structure model' 1 5 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' 11 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' pdbx_audit_support 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 9 6 'Structure model' pdbx_initial_refinement_model 10 6 'Structure model' struct_conn 11 6 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation_author.identifier_ORCID' 8 4 'Structure model' '_pdbx_audit_support.funding_organization' 9 5 'Structure model' '_pdbx_audit_support.funding_organization' 10 6 'Structure model' '_database_2.pdbx_DOI' 11 6 'Structure model' '_database_2.pdbx_database_accession' 12 6 'Structure model' '_struct_conn.conn_type_id' 13 6 'Structure model' '_struct_conn.id' 14 6 'Structure model' '_struct_conn.pdbx_dist_value' 15 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 16 6 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 17 6 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 18 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 6 'Structure model' '_struct_conn_type.id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH2 A ARG 60 ? B O A HOH 401 ? ? 2.08 2 1 O A HOH 408 ? ? O A HOH 446 ? ? 2.18 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 88 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -140.24 _pdbx_validate_torsion.psi 27.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASN 191 ? A ASN 191 6 1 Y 1 A ALA 192 ? A ALA 192 7 1 Y 1 A THR 193 ? A THR 193 8 1 Y 1 A SER 194 ? A SER 194 9 1 Y 1 A GLY 195 ? A GLY 195 10 1 Y 1 A SER 196 ? A SER 196 11 1 Y 1 A LEU 197 ? A LEU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2LT N N N N 1 2LT CA C N S 2 2LT C C N N 3 2LT O O N N 4 2LT CB C N N 5 2LT CG C Y N 6 2LT CD1 C Y N 7 2LT CD2 C Y N 8 2LT CE1 C Y N 9 2LT CE2 C Y N 10 2LT CZ C Y N 11 2LT OH O N N 12 2LT OXT O N N 13 2LT CL1 CL N N 14 2LT CL2 CL N N 15 2LT H H N N 16 2LT H2 H N N 17 2LT HA H N N 18 2LT HB2 H N N 19 2LT HB3 H N N 20 2LT HD1 H N N 21 2LT HD2 H N N 22 2LT HH H N N 23 2LT HXT H N N 24 ALA N N N N 25 ALA CA C N S 26 ALA C C N N 27 ALA O O N N 28 ALA CB C N N 29 ALA OXT O N N 30 ALA H H N N 31 ALA H2 H N N 32 ALA HA H N N 33 ALA HB1 H N N 34 ALA HB2 H N N 35 ALA HB3 H N N 36 ALA HXT H N N 37 ARG N N N N 38 ARG CA C N S 39 ARG C C N N 40 ARG O O N N 41 ARG CB C N N 42 ARG CG C N N 43 ARG CD C N N 44 ARG NE N N N 45 ARG CZ C N N 46 ARG NH1 N N N 47 ARG NH2 N N N 48 ARG OXT O N N 49 ARG H H N N 50 ARG H2 H N N 51 ARG HA H N N 52 ARG HB2 H N N 53 ARG HB3 H N N 54 ARG HG2 H N N 55 ARG HG3 H N N 56 ARG HD2 H N N 57 ARG HD3 H N N 58 ARG HE H N N 59 ARG HH11 H N N 60 ARG HH12 H N N 61 ARG HH21 H N N 62 ARG HH22 H N N 63 ARG HXT H N N 64 ASN N N N N 65 ASN CA C N S 66 ASN C C N N 67 ASN O O N N 68 ASN CB C N N 69 ASN CG C N N 70 ASN OD1 O N N 71 ASN ND2 N N N 72 ASN OXT O N N 73 ASN H H N N 74 ASN H2 H N N 75 ASN HA H N N 76 ASN HB2 H N N 77 ASN HB3 H N N 78 ASN HD21 H N N 79 ASN HD22 H N N 80 ASN HXT H N N 81 ASP N N N N 82 ASP CA C N S 83 ASP C C N N 84 ASP O O N N 85 ASP CB C N N 86 ASP CG C N N 87 ASP OD1 O N N 88 ASP OD2 O N N 89 ASP OXT O N N 90 ASP H H N N 91 ASP H2 H N N 92 ASP HA H N N 93 ASP HB2 H N N 94 ASP HB3 H N N 95 ASP HD2 H N N 96 ASP HXT H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 FE2 FE FE N N 112 GLN N N N N 113 GLN CA C N S 114 GLN C C N N 115 GLN O O N N 116 GLN CB C N N 117 GLN CG C N N 118 GLN CD C N N 119 GLN OE1 O N N 120 GLN NE2 N N N 121 GLN OXT O N N 122 GLN H H N N 123 GLN H2 H N N 124 GLN HA H N N 125 GLN HB2 H N N 126 GLN HB3 H N N 127 GLN HG2 H N N 128 GLN HG3 H N N 129 GLN HE21 H N N 130 GLN HE22 H N N 131 GLN HXT H N N 132 GLU N N N N 133 GLU CA C N S 134 GLU C C N N 135 GLU O O N N 136 GLU CB C N N 137 GLU CG C N N 138 GLU CD C N N 139 GLU OE1 O N N 140 GLU OE2 O N N 141 GLU OXT O N N 142 GLU H H N N 143 GLU H2 H N N 144 GLU HA H N N 145 GLU HB2 H N N 146 GLU HB3 H N N 147 GLU HG2 H N N 148 GLU HG3 H N N 149 GLU HE2 H N N 150 GLU HXT H N N 151 GLY N N N N 152 GLY CA C N N 153 GLY C C N N 154 GLY O O N N 155 GLY OXT O N N 156 GLY H H N N 157 GLY H2 H N N 158 GLY HA2 H N N 159 GLY HA3 H N N 160 GLY HXT H N N 161 GOL C1 C N N 162 GOL O1 O N N 163 GOL C2 C N N 164 GOL O2 O N N 165 GOL C3 C N N 166 GOL O3 O N N 167 GOL H11 H N N 168 GOL H12 H N N 169 GOL HO1 H N N 170 GOL H2 H N N 171 GOL HO2 H N N 172 GOL H31 H N N 173 GOL H32 H N N 174 GOL HO3 H N N 175 HIS N N N N 176 HIS CA C N S 177 HIS C C N N 178 HIS O O N N 179 HIS CB C N N 180 HIS CG C Y N 181 HIS ND1 N Y N 182 HIS CD2 C Y N 183 HIS CE1 C Y N 184 HIS NE2 N Y N 185 HIS OXT O N N 186 HIS H H N N 187 HIS H2 H N N 188 HIS HA H N N 189 HIS HB2 H N N 190 HIS HB3 H N N 191 HIS HD1 H N N 192 HIS HD2 H N N 193 HIS HE1 H N N 194 HIS HE2 H N N 195 HIS HXT H N N 196 HOH O O N N 197 HOH H1 H N N 198 HOH H2 H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 SO4 S S N N 343 SO4 O1 O N N 344 SO4 O2 O N N 345 SO4 O3 O N N 346 SO4 O4 O N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2LT O C doub N N 1 2LT N CA sing N N 2 2LT C CA sing N N 3 2LT C OXT sing N N 4 2LT CA CB sing N N 5 2LT CB CG sing N N 6 2LT CD1 CG doub Y N 7 2LT CD1 CE1 sing Y N 8 2LT CG CD2 sing Y N 9 2LT CL1 CE1 sing N N 10 2LT CE1 CZ doub Y N 11 2LT CD2 CE2 doub Y N 12 2LT CZ CE2 sing Y N 13 2LT CZ OH sing N N 14 2LT CE2 CL2 sing N N 15 2LT N H sing N N 16 2LT N H2 sing N N 17 2LT CA HA sing N N 18 2LT CB HB2 sing N N 19 2LT CB HB3 sing N N 20 2LT CD1 HD1 sing N N 21 2LT CD2 HD2 sing N N 22 2LT OH HH sing N N 23 2LT OXT HXT sing N N 24 ALA N CA sing N N 25 ALA N H sing N N 26 ALA N H2 sing N N 27 ALA CA C sing N N 28 ALA CA CB sing N N 29 ALA CA HA sing N N 30 ALA C O doub N N 31 ALA C OXT sing N N 32 ALA CB HB1 sing N N 33 ALA CB HB2 sing N N 34 ALA CB HB3 sing N N 35 ALA OXT HXT sing N N 36 ARG N CA sing N N 37 ARG N H sing N N 38 ARG N H2 sing N N 39 ARG CA C sing N N 40 ARG CA CB sing N N 41 ARG CA HA sing N N 42 ARG C O doub N N 43 ARG C OXT sing N N 44 ARG CB CG sing N N 45 ARG CB HB2 sing N N 46 ARG CB HB3 sing N N 47 ARG CG CD sing N N 48 ARG CG HG2 sing N N 49 ARG CG HG3 sing N N 50 ARG CD NE sing N N 51 ARG CD HD2 sing N N 52 ARG CD HD3 sing N N 53 ARG NE CZ sing N N 54 ARG NE HE sing N N 55 ARG CZ NH1 sing N N 56 ARG CZ NH2 doub N N 57 ARG NH1 HH11 sing N N 58 ARG NH1 HH12 sing N N 59 ARG NH2 HH21 sing N N 60 ARG NH2 HH22 sing N N 61 ARG OXT HXT sing N N 62 ASN N CA sing N N 63 ASN N H sing N N 64 ASN N H2 sing N N 65 ASN CA C sing N N 66 ASN CA CB sing N N 67 ASN CA HA sing N N 68 ASN C O doub N N 69 ASN C OXT sing N N 70 ASN CB CG sing N N 71 ASN CB HB2 sing N N 72 ASN CB HB3 sing N N 73 ASN CG OD1 doub N N 74 ASN CG ND2 sing N N 75 ASN ND2 HD21 sing N N 76 ASN ND2 HD22 sing N N 77 ASN OXT HXT sing N N 78 ASP N CA sing N N 79 ASP N H sing N N 80 ASP N H2 sing N N 81 ASP CA C sing N N 82 ASP CA CB sing N N 83 ASP CA HA sing N N 84 ASP C O doub N N 85 ASP C OXT sing N N 86 ASP CB CG sing N N 87 ASP CB HB2 sing N N 88 ASP CB HB3 sing N N 89 ASP CG OD1 doub N N 90 ASP CG OD2 sing N N 91 ASP OD2 HD2 sing N N 92 ASP OXT HXT sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 GOL C1 O1 sing N N 153 GOL C1 C2 sing N N 154 GOL C1 H11 sing N N 155 GOL C1 H12 sing N N 156 GOL O1 HO1 sing N N 157 GOL C2 O2 sing N N 158 GOL C2 C3 sing N N 159 GOL C2 H2 sing N N 160 GOL O2 HO2 sing N N 161 GOL C3 O3 sing N N 162 GOL C3 H31 sing N N 163 GOL C3 H32 sing N N 164 GOL O3 HO3 sing N N 165 HIS N CA sing N N 166 HIS N H sing N N 167 HIS N H2 sing N N 168 HIS CA C sing N N 169 HIS CA CB sing N N 170 HIS CA HA sing N N 171 HIS C O doub N N 172 HIS C OXT sing N N 173 HIS CB CG sing N N 174 HIS CB HB2 sing N N 175 HIS CB HB3 sing N N 176 HIS CG ND1 sing Y N 177 HIS CG CD2 doub Y N 178 HIS ND1 CE1 doub Y N 179 HIS ND1 HD1 sing N N 180 HIS CD2 NE2 sing Y N 181 HIS CD2 HD2 sing N N 182 HIS CE1 NE2 sing Y N 183 HIS CE1 HE1 sing N N 184 HIS NE2 HE2 sing N N 185 HIS OXT HXT sing N N 186 HOH O H1 sing N N 187 HOH O H2 sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 SO4 S O1 doub N N 327 SO4 S O2 doub N N 328 SO4 S O3 sing N N 329 SO4 S O4 sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' CHE-1623856 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM107529 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM108988 3 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 2LT ? ? 2LT ? ? 'SUBJECT OF INVESTIGATION' ? 2 FE2 ? ? FE2 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2IC1 _pdbx_initial_refinement_model.details 'PDB entry 2IC1' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details MONOMER #