data_6BYD # _entry.id 6BYD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6BYD WWPDB D_1000231753 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BYD _pdbx_database_status.recvd_initial_deposition_date 2017-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jentsch, J.A.' 1 ? 'Kiburu, I.N.' 2 ? 'Wu, J.' 3 ? 'Pandey, K.' 4 ? 'Boudker, O.' 5 ? 'Menon, A.K.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 5522 _citation.page_last 5531 _citation.title 'Structural basis of sterol binding and transport by a yeast StARkin domain.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.001881 _citation.pdbx_database_id_PubMed 29463678 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jentsch, J.A.' 1 ? primary 'Kiburu, I.' 2 ? primary 'Pandey, K.' 3 ? primary 'Timme, M.' 4 ? primary 'Ramlall, T.' 5 ? primary 'Levkau, B.' 6 ? primary 'Wu, J.' 7 ? primary 'Eliezer, D.' 8 ? primary 'Boudker, O.' 9 ? primary 'Menon, A.K.' 10 ? # _cell.length_a 45.601 _cell.length_b 67.923 _cell.length_c 132.042 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 6BYD _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'I 21 21 21' _symmetry.entry_id 6BYD _symmetry.Int_Tables_number 24 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane-anchored lipid-binding protein LAM4' 23040.311 1 ? ? 'LAM4 (YHR080C)-StARkin domain' ? 2 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lipid transfer at contact site protein 3,Lipid transfer protein anchored at membrane contact sites 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GP(MSE)TLPK(MSE)EPSSHAPTEPDIQKDKDDSIIRENENIPAPLGTVVQLLFGSNTEY(MSE)QKVITRDKNNVNVE TIPKFTPSLVEGGSRHYEYTKKLNNSIGPKQTKCLLTESIEH(MSE)DINNYVLVTQTTKTPDVPSGSNFAVESKIFLFW GQHDTTN(MSE)TVITKINWTSKSFLKGAIEKGSVEGQKVSVDY(MSE)LSELRDIISRAKSKKPVK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMTLPKMEPSSHAPTEPDIQKDKDDSIIRENENIPAPLGTVVQLLFGSNTEYMQKVITRDKNNVNVETIPKFTPSLVEG GSRHYEYTKKLNNSIGPKQTKCLLTESIEHMDINNYVLVTQTTKTPDVPSGSNFAVESKIFLFWGQHDTTNMTVITKINW TSKSFLKGAIEKGSVEGQKVSVDYMLSELRDIISRAKSKKPVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MSE n 1 4 THR n 1 5 LEU n 1 6 PRO n 1 7 LYS n 1 8 MSE n 1 9 GLU n 1 10 PRO n 1 11 SER n 1 12 SER n 1 13 HIS n 1 14 ALA n 1 15 PRO n 1 16 THR n 1 17 GLU n 1 18 PRO n 1 19 ASP n 1 20 ILE n 1 21 GLN n 1 22 LYS n 1 23 ASP n 1 24 LYS n 1 25 ASP n 1 26 ASP n 1 27 SER n 1 28 ILE n 1 29 ILE n 1 30 ARG n 1 31 GLU n 1 32 ASN n 1 33 GLU n 1 34 ASN n 1 35 ILE n 1 36 PRO n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 GLY n 1 41 THR n 1 42 VAL n 1 43 VAL n 1 44 GLN n 1 45 LEU n 1 46 LEU n 1 47 PHE n 1 48 GLY n 1 49 SER n 1 50 ASN n 1 51 THR n 1 52 GLU n 1 53 TYR n 1 54 MSE n 1 55 GLN n 1 56 LYS n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 ARG n 1 61 ASP n 1 62 LYS n 1 63 ASN n 1 64 ASN n 1 65 VAL n 1 66 ASN n 1 67 VAL n 1 68 GLU n 1 69 THR n 1 70 ILE n 1 71 PRO n 1 72 LYS n 1 73 PHE n 1 74 THR n 1 75 PRO n 1 76 SER n 1 77 LEU n 1 78 VAL n 1 79 GLU n 1 80 GLY n 1 81 GLY n 1 82 SER n 1 83 ARG n 1 84 HIS n 1 85 TYR n 1 86 GLU n 1 87 TYR n 1 88 THR n 1 89 LYS n 1 90 LYS n 1 91 LEU n 1 92 ASN n 1 93 ASN n 1 94 SER n 1 95 ILE n 1 96 GLY n 1 97 PRO n 1 98 LYS n 1 99 GLN n 1 100 THR n 1 101 LYS n 1 102 CYS n 1 103 LEU n 1 104 LEU n 1 105 THR n 1 106 GLU n 1 107 SER n 1 108 ILE n 1 109 GLU n 1 110 HIS n 1 111 MSE n 1 112 ASP n 1 113 ILE n 1 114 ASN n 1 115 ASN n 1 116 TYR n 1 117 VAL n 1 118 LEU n 1 119 VAL n 1 120 THR n 1 121 GLN n 1 122 THR n 1 123 THR n 1 124 LYS n 1 125 THR n 1 126 PRO n 1 127 ASP n 1 128 VAL n 1 129 PRO n 1 130 SER n 1 131 GLY n 1 132 SER n 1 133 ASN n 1 134 PHE n 1 135 ALA n 1 136 VAL n 1 137 GLU n 1 138 SER n 1 139 LYS n 1 140 ILE n 1 141 PHE n 1 142 LEU n 1 143 PHE n 1 144 TRP n 1 145 GLY n 1 146 GLN n 1 147 HIS n 1 148 ASP n 1 149 THR n 1 150 THR n 1 151 ASN n 1 152 MSE n 1 153 THR n 1 154 VAL n 1 155 ILE n 1 156 THR n 1 157 LYS n 1 158 ILE n 1 159 ASN n 1 160 TRP n 1 161 THR n 1 162 SER n 1 163 LYS n 1 164 SER n 1 165 PHE n 1 166 LEU n 1 167 LYS n 1 168 GLY n 1 169 ALA n 1 170 ILE n 1 171 GLU n 1 172 LYS n 1 173 GLY n 1 174 SER n 1 175 VAL n 1 176 GLU n 1 177 GLY n 1 178 GLN n 1 179 LYS n 1 180 VAL n 1 181 SER n 1 182 VAL n 1 183 ASP n 1 184 TYR n 1 185 MSE n 1 186 LEU n 1 187 SER n 1 188 GLU n 1 189 LEU n 1 190 ARG n 1 191 ASP n 1 192 ILE n 1 193 ILE n 1 194 SER n 1 195 ARG n 1 196 ALA n 1 197 LYS n 1 198 SER n 1 199 LYS n 1 200 LYS n 1 201 PRO n 1 202 VAL n 1 203 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LAM4, LTC3, YHR080C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LAM4_YEAST _struct_ref.pdbx_db_accession P38800 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TLPKMEPSSHAPTEPDIQKDKDDSIIRENENIPAPLGTVVQLLFGSNTEYMQKVITRDKNNVNVETIPKFTPSLVEGGSR HYEYTKKLNNSIGPKQTKCLLTESIEHMDINNYVLVTQTTKTPDVPSGSNFAVESKIFLFWGQHDTTNMTVITKINWTSK SFLKGAIEKGSVEGQKVSVDYMLSELRDIISRAKSKKPVK ; _struct_ref.pdbx_align_begin 946 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BYD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38800 _struct_ref_seq.db_align_beg 946 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 203 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BYD GLY A 1 ? UNP P38800 ? ? 'cloning artifact' 1 1 1 6BYD PRO A 2 ? UNP P38800 ? ? 'cloning artifact' 2 2 1 6BYD MSE A 3 ? UNP P38800 ? ? 'cloning artifact' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BYD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.5M Lithium Chloride 30% PEG 6000 0.1M HEPES, pH 7.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97494 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97494 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.entry_id 6BYD _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.190 _reflns.number_obs 11009 _reflns.number_all ? _reflns.percent_possible_obs 100.000 _reflns.pdbx_Rmerge_I_obs 0.132 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.300 _reflns.B_iso_Wilson_estimate 30.880 _reflns.pdbx_redundancy 14.000 _reflns.pdbx_Rrim_I_all 0.137 _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 153681 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared 0.981 _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.190 2.270 ? ? 1083 ? 0.664 ? ? 0.614 12.800 ? ? ? ? ? ? ? ? 100.000 0.691 0.189 0.968 1 2 2.270 2.360 ? ? 1086 ? 0.511 ? ? 0.492 14.000 ? ? ? ? ? ? ? ? 100.000 0.531 0.141 0.986 1 3 2.360 2.470 ? ? 1059 ? 0.417 ? ? 0.556 14.400 ? ? ? ? ? ? ? ? 100.000 0.432 0.114 0.979 1 4 2.470 2.600 ? ? 1103 ? 0.306 ? ? 0.639 14.500 ? ? ? ? ? ? ? ? 100.000 0.318 0.084 0.991 1 5 2.600 2.760 ? ? 1073 ? 0.244 ? ? 0.855 14.400 ? ? ? ? ? ? ? ? 100.000 0.254 0.067 0.991 1 6 2.760 2.970 ? ? 1090 ? 0.183 ? ? 1.092 14.400 ? ? ? ? ? ? ? ? 100.000 0.189 0.050 0.992 1 7 2.970 3.270 ? ? 1110 ? 0.134 ? ? 1.338 14.200 ? ? ? ? ? ? ? ? 100.000 0.139 0.037 0.996 1 8 3.270 3.740 ? ? 1098 ? 0.120 ? ? 1.381 14.100 ? ? ? ? ? ? ? ? 100.000 0.125 0.033 0.996 1 9 3.740 4.720 ? ? 1111 ? 0.090 ? ? 1.423 13.600 ? ? ? ? ? ? ? ? 100.000 0.094 0.025 0.995 1 10 4.720 50.000 ? ? 1196 ? 0.078 ? ? 1.376 13.300 ? ? ? ? ? ? ? ? 100.000 0.081 0.022 0.997 # _refine.entry_id 6BYD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.1950 _refine.ls_d_res_low 43.1030 _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.6100 _refine.ls_number_reflns_obs 10837 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1890 _refine.ls_R_factor_R_work 0.1857 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2480 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_number_reflns_R_free 544 _refine.ls_number_reflns_R_work 10293 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 45.1961 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 131.230 _refine.B_iso_min 18.410 _refine.pdbx_overall_phase_error 29.6200 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1950 _refine_hist.d_res_low 43.1030 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 1601 _refine_hist.pdbx_number_residues_total 197 _refine_hist.pdbx_B_iso_mean_solvent 42.04 _refine_hist.pdbx_number_atoms_protein 1553 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1582 0.008 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2141 0.901 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 248 0.056 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 273 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 979 3.585 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 2.1946 2.4155 4 99.0000 2506 . 0.2155 0.2802 . 126 0.0000 2632 . 'X-RAY DIFFRACTION' 2.4155 2.7649 4 100.0000 2530 . 0.2090 0.2891 . 136 0.0000 2666 . 'X-RAY DIFFRACTION' 2.7649 3.4833 4 100.0000 2574 . 0.2005 0.2746 . 134 0.0000 2708 . 'X-RAY DIFFRACTION' 3.4833 43.1113 4 100.0000 2683 . 0.1650 0.2176 . 148 0.0000 2831 . 'X-RAY DIFFRACTION' # _struct.entry_id 6BYD _struct.title 'Crystal structure of the second StART domain of yeast Lam4' _struct.pdbx_descriptor 'Sterol-binding protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BYD _struct_keywords.text 'Sterol Transport, LIPID TRANSPORT' _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 38 ? GLY A 48 ? PRO A 38 GLY A 48 1 ? 11 HELX_P HELX_P2 AA2 THR A 51 ? ASP A 61 ? THR A 51 ASP A 61 1 ? 11 HELX_P HELX_P3 AA3 SER A 130 ? SER A 132 ? SER A 130 SER A 132 5 ? 3 HELX_P HELX_P4 AA4 GLN A 146 ? ASP A 148 ? GLN A 146 ASP A 148 5 ? 3 HELX_P HELX_P5 AA5 LEU A 166 ? SER A 198 ? LEU A 166 SER A 198 1 ? 33 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LYS 7 C ? ? ? 1_555 A MSE 8 N ? ? A LYS 7 A MSE 8 1_555 ? ? ? ? ? ? ? 1.340 ? covale2 covale both ? A MSE 8 C ? ? ? 1_555 A GLU 9 N ? ? A MSE 8 A GLU 9 1_555 ? ? ? ? ? ? ? 1.383 ? covale3 covale both ? A TYR 53 C ? ? ? 1_555 A MSE 54 N ? ? A TYR 53 A MSE 54 1_555 ? ? ? ? ? ? ? 1.340 ? covale4 covale both ? A MSE 54 C ? ? ? 1_555 A GLN 55 N ? ? A MSE 54 A GLN 55 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale both ? A HIS 110 C ? ? ? 1_555 A MSE 111 N ? ? A HIS 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.319 ? covale6 covale both ? A MSE 111 C ? ? ? 1_555 A ASP 112 N ? ? A MSE 111 A ASP 112 1_555 ? ? ? ? ? ? ? 1.335 ? covale7 covale both ? A ASN 151 C ? ? ? 1_555 A MSE 152 N ? ? A ASN 151 A MSE 152 1_555 ? ? ? ? ? ? ? 1.334 ? covale8 covale both ? A MSE 152 C ? ? ? 1_555 A THR 153 N ? ? A MSE 152 A THR 153 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale both ? A TYR 184 C ? ? ? 1_555 A MSE 185 N ? ? A TYR 184 A MSE 185 1_555 ? ? ? ? ? ? ? 1.332 ? covale10 covale both ? A MSE 185 C ? ? ? 1_555 A LEU 186 N ? ? A MSE 185 A LEU 186 1_555 ? ? ? ? ? ? ? 1.340 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 9 A . ? GLU 9 A PRO 10 A ? PRO 10 A 1 1.58 2 THR 74 A . ? THR 74 A PRO 75 A ? PRO 75 A 1 -2.61 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 27 ? ILE A 35 ? SER A 27 ILE A 35 AA1 2 THR A 150 ? TRP A 160 ? THR A 150 TRP A 160 AA1 3 PHE A 134 ? TRP A 144 ? PHE A 134 TRP A 144 AA1 4 TYR A 116 ? LYS A 124 ? TYR A 116 LYS A 124 AA1 5 GLN A 99 ? MSE A 111 ? GLN A 99 MSE A 111 AA1 6 SER A 82 ? LYS A 90 ? SER A 82 LYS A 90 AA1 7 ASN A 64 ? VAL A 65 ? ASN A 64 VAL A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 35 ? N ILE A 35 O THR A 150 ? O THR A 150 AA1 2 3 O ILE A 155 ? O ILE A 155 N LYS A 139 ? N LYS A 139 AA1 3 4 O LEU A 142 ? O LEU A 142 N VAL A 117 ? N VAL A 117 AA1 4 5 O THR A 122 ? O THR A 122 N THR A 105 ? N THR A 105 AA1 5 6 O CYS A 102 ? O CYS A 102 N TYR A 87 ? N TYR A 87 AA1 6 7 O THR A 88 ? O THR A 88 N VAL A 65 ? N VAL A 65 # _atom_sites.entry_id 6BYD _atom_sites.fract_transf_matrix[1][1] 0.021929 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014723 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007573 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 MSE 3 3 ? ? ? A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 MSE 8 8 8 MSE MSE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 MSE 54 54 54 MSE MSE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 MSE 152 152 152 MSE MSE A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 TRP 160 160 160 TRP TRP A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 MSE 185 185 185 MSE MSE A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 PRO 201 201 ? ? ? A . n A 1 202 VAL 202 202 ? ? ? A . n A 1 203 LYS 203 203 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 41 HOH HOH A . B 2 HOH 2 302 34 HOH HOH A . B 2 HOH 3 303 23 HOH HOH A . B 2 HOH 4 304 44 HOH HOH A . B 2 HOH 5 305 18 HOH HOH A . B 2 HOH 6 306 10 HOH HOH A . B 2 HOH 7 307 15 HOH HOH A . B 2 HOH 8 308 24 HOH HOH A . B 2 HOH 9 309 12 HOH HOH A . B 2 HOH 10 310 13 HOH HOH A . B 2 HOH 11 311 6 HOH HOH A . B 2 HOH 12 312 9 HOH HOH A . B 2 HOH 13 313 22 HOH HOH A . B 2 HOH 14 314 19 HOH HOH A . B 2 HOH 15 315 14 HOH HOH A . B 2 HOH 16 316 1 HOH HOH A . B 2 HOH 17 317 3 HOH HOH A . B 2 HOH 18 318 36 HOH HOH A . B 2 HOH 19 319 25 HOH HOH A . B 2 HOH 20 320 27 HOH HOH A . B 2 HOH 21 321 37 HOH HOH A . B 2 HOH 22 322 7 HOH HOH A . B 2 HOH 23 323 43 HOH HOH A . B 2 HOH 24 324 21 HOH HOH A . B 2 HOH 25 325 17 HOH HOH A . B 2 HOH 26 326 8 HOH HOH A . B 2 HOH 27 327 2 HOH HOH A . B 2 HOH 28 328 48 HOH HOH A . B 2 HOH 29 329 20 HOH HOH A . B 2 HOH 30 330 31 HOH HOH A . B 2 HOH 31 331 46 HOH HOH A . B 2 HOH 32 332 5 HOH HOH A . B 2 HOH 33 333 38 HOH HOH A . B 2 HOH 34 334 26 HOH HOH A . B 2 HOH 35 335 47 HOH HOH A . B 2 HOH 36 336 16 HOH HOH A . B 2 HOH 37 337 4 HOH HOH A . B 2 HOH 38 338 11 HOH HOH A . B 2 HOH 39 339 39 HOH HOH A . B 2 HOH 40 340 40 HOH HOH A . B 2 HOH 41 341 29 HOH HOH A . B 2 HOH 42 342 42 HOH HOH A . B 2 HOH 43 343 45 HOH HOH A . B 2 HOH 44 344 35 HOH HOH A . B 2 HOH 45 345 28 HOH HOH A . B 2 HOH 46 346 30 HOH HOH A . B 2 HOH 47 347 32 HOH HOH A . B 2 HOH 48 348 33 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 8 A MSE 8 ? MET 'modified residue' 2 A MSE 54 A MSE 54 ? MET 'modified residue' 3 A MSE 111 A MSE 111 ? MET 'modified residue' 4 A MSE 152 A MSE 152 ? MET 'modified residue' 5 A MSE 185 A MSE 185 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9980 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-31 2 'Structure model' 1 1 2018-02-14 3 'Structure model' 1 2 2018-03-07 4 'Structure model' 1 3 2018-04-25 5 'Structure model' 1 4 2020-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 3 'Structure model' '_citation_author.name' 12 4 'Structure model' '_citation.journal_volume' 13 4 'Structure model' '_citation.page_first' 14 4 'Structure model' '_citation.page_last' 15 5 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 14.2956 35.2900 51.5139 0.3740 0.7880 0.3608 0.0587 -0.0459 -0.0198 2.2687 1.7386 1.0710 -0.2583 0.1319 -1.0853 -0.1906 0.1489 0.0684 0.1919 0.1046 0.2560 -0.2350 -0.2675 -0.8834 'X-RAY DIFFRACTION' 2 ? refined 22.1169 31.1464 51.4533 0.2111 0.2815 0.2544 -0.0015 -0.0200 0.0003 1.8194 2.2746 3.5521 -0.2522 -0.4603 0.6377 0.1275 -0.1957 0.0130 0.0120 -0.2330 0.0522 -0.2193 0.1351 -0.6086 'X-RAY DIFFRACTION' 3 ? refined 37.6696 34.9805 56.0051 0.1884 0.3650 0.1973 -0.0005 -0.0131 0.0006 4.6853 2.9526 2.3017 -1.3567 -0.7947 -0.1875 0.1011 -0.1972 0.0957 0.0503 -0.0747 0.2177 -0.1229 0.0736 0.3175 'X-RAY DIFFRACTION' 4 ? refined 37.3063 35.5204 46.3725 0.3033 0.2219 0.2012 0.0364 0.0182 -0.0049 3.9064 2.0166 3.4393 -0.4139 -0.3409 0.0701 0.1211 -0.1770 0.0167 0.1730 0.0265 0.0278 -0.2990 0.0434 0.4091 'X-RAY DIFFRACTION' 5 ? refined 32.2141 36.4500 44.1685 0.2826 0.2764 0.2002 0.0566 -0.0017 -0.0369 2.3783 3.7245 2.5551 -2.4347 1.2836 -0.2135 -0.9033 0.6908 0.0837 -1.0738 0.3488 -0.0044 0.2897 -0.3554 -0.1096 'X-RAY DIFFRACTION' 6 ? refined 21.8643 35.8925 45.0863 0.2288 0.3515 0.3059 0.1164 -0.0215 0.0269 6.6010 2.9015 3.0928 -0.5543 -0.9414 -0.2215 0.4029 -0.1449 -0.0418 0.0976 0.8459 -0.1359 -0.5569 0.0387 -0.9833 'X-RAY DIFFRACTION' 7 ? refined 26.3165 29.4205 46.2041 0.2983 0.2162 0.2622 -0.0043 -0.0352 0.0101 3.9834 1.2089 3.5895 -0.9155 -0.3926 1.0726 0.0016 -0.1226 0.0079 -0.1279 -0.0615 0.0919 -0.0715 0.4120 -0.4296 'X-RAY DIFFRACTION' 8 ? refined 34.3815 24.1754 33.4529 0.4761 0.2977 0.3479 0.1493 0.0593 -0.0367 0.8244 2.0262 5.0175 1.2734 -0.3632 -0.8609 -0.3710 -0.2152 0.1744 0.1482 -0.5395 -0.3883 -0.2620 1.0578 0.4926 'X-RAY DIFFRACTION' 9 ? refined 29.4904 26.6731 54.8422 0.3528 0.1924 0.2900 0.0591 -0.0143 0.0545 1.6457 1.8184 4.0498 -0.3963 -1.2666 0.6341 0.0796 -0.0612 0.0071 -0.3211 -0.1417 -0.0849 -0.1965 0.5625 0.0408 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 4 A 23 ;chain 'A' and (resid 4 through 23 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 24 A 50 ;chain 'A' and (resid 24 through 50 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 51 A 70 ;chain 'A' and (resid 51 through 70 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 71 A 98 ;chain 'A' and (resid 71 through 98 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 99 A 111 ;chain 'A' and (resid 99 through 111 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 112 A 124 ;chain 'A' and (resid 112 through 124 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 125 A 153 ;chain 'A' and (resid 125 through 153 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 154 A 166 ;chain 'A' and (resid 154 through 166 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 167 A 200 ;chain 'A' and (resid 167 through 200 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL2Map ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 21 ? ? -68.96 63.57 2 1 ASN A 115 ? ? -147.23 -83.87 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A MSE 3 ? A MSE 3 4 1 Y 1 A PRO 201 ? A PRO 201 5 1 Y 1 A VAL 202 ? A VAL 202 6 1 Y 1 A LYS 203 ? A LYS 203 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Research Foundation (DFG)' Germany 'Graduiertenkolleg 2098, Project 11' 1 'Qatar National Research Fund' Qatar 'NPRP 7-082-1-014' 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #