data_6BZ3 # _entry.id 6BZ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6BZ3 WWPDB D_1000231825 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BZ3 _pdbx_database_status.recvd_initial_deposition_date 2017-12-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xu, S.' 1 ? 'Wang, J.-H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Discov' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2056-5968 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 8 _citation.page_last 8 _citation.title 'The binding of DCC-P3 motif and FAK-FAT domain mediates the initial step of netrin-1/DCC signaling for axon attraction.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41421-017-0008-8 _citation.pdbx_database_id_PubMed 29479476 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, S.' 1 ? primary 'Liu, Y.' 2 ? primary 'Li, X.' 3 ? primary 'Liu, Y.' 4 ? primary 'Meijers, R.' 5 ? primary 'Zhang, Y.' 6 ? primary 'Wang, J.H.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.300 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6BZ3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 129.178 _cell.length_a_esd ? _cell.length_b 36.130 _cell.length_b_esd ? _cell.length_c 65.429 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BZ3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Focal adhesion kinase 1' 14006.386 2 2.7.10.2 ? 'FAT domain residues 959-1084' ? 2 polymer syn 'Netrin receptor DCC' 2452.735 2 ? ? 'P3 motif residues 1421-1443' ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 12 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'FADK 1,Focal adhesion kinase-related nonkinase,FRNK,Protein-tyrosine kinase 2,p125FAK,pp125FAK' 2 'Tumor suppressor protein DCC' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISK MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML ; ;NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISK MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML ; A,C ? 2 'polypeptide(L)' no no DDLSEQMASLEGLMKQLNAITGS DDLSEQMASLEGLMKQLNAITGS B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ASP n 1 3 LYS n 1 4 VAL n 1 5 TYR n 1 6 GLU n 1 7 ASN n 1 8 VAL n 1 9 THR n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 LYS n 1 14 ALA n 1 15 VAL n 1 16 ILE n 1 17 GLU n 1 18 MET n 1 19 SER n 1 20 SER n 1 21 LYS n 1 22 ILE n 1 23 GLN n 1 24 PRO n 1 25 ALA n 1 26 PRO n 1 27 PRO n 1 28 GLU n 1 29 GLU n 1 30 TYR n 1 31 VAL n 1 32 PRO n 1 33 MET n 1 34 VAL n 1 35 LYS n 1 36 GLU n 1 37 VAL n 1 38 GLY n 1 39 LEU n 1 40 ALA n 1 41 LEU n 1 42 ARG n 1 43 THR n 1 44 LEU n 1 45 LEU n 1 46 ALA n 1 47 THR n 1 48 VAL n 1 49 ASP n 1 50 GLU n 1 51 THR n 1 52 ILE n 1 53 PRO n 1 54 ALA n 1 55 LEU n 1 56 PRO n 1 57 ALA n 1 58 SER n 1 59 THR n 1 60 HIS n 1 61 ARG n 1 62 GLU n 1 63 ILE n 1 64 GLU n 1 65 MET n 1 66 ALA n 1 67 GLN n 1 68 LYS n 1 69 LEU n 1 70 LEU n 1 71 ASN n 1 72 SER n 1 73 ASP n 1 74 LEU n 1 75 GLY n 1 76 GLU n 1 77 LEU n 1 78 ILE n 1 79 SER n 1 80 LYS n 1 81 MET n 1 82 LYS n 1 83 LEU n 1 84 ALA n 1 85 GLN n 1 86 GLN n 1 87 TYR n 1 88 VAL n 1 89 MET n 1 90 THR n 1 91 SER n 1 92 LEU n 1 93 GLN n 1 94 GLN n 1 95 GLU n 1 96 TYR n 1 97 LYS n 1 98 LYS n 1 99 GLN n 1 100 MET n 1 101 LEU n 1 102 THR n 1 103 ALA n 1 104 ALA n 1 105 HIS n 1 106 ALA n 1 107 LEU n 1 108 ALA n 1 109 VAL n 1 110 ASP n 1 111 ALA n 1 112 LYS n 1 113 ASN n 1 114 LEU n 1 115 LEU n 1 116 ASP n 1 117 VAL n 1 118 ILE n 1 119 ASP n 1 120 GLN n 1 121 ALA n 1 122 ARG n 1 123 LEU n 1 124 LYS n 1 125 MET n 1 126 LEU n 2 1 ASP n 2 2 ASP n 2 3 LEU n 2 4 SER n 2 5 GLU n 2 6 GLN n 2 7 MET n 2 8 ALA n 2 9 SER n 2 10 LEU n 2 11 GLU n 2 12 GLY n 2 13 LEU n 2 14 MET n 2 15 LYS n 2 16 GLN n 2 17 LEU n 2 18 ASN n 2 19 ALA n 2 20 ILE n 2 21 THR n 2 22 GLY n 2 23 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ptk2, Fadk, Fak, Fak1, Kiaa4203' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28Sumo _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 23 _pdbx_entity_src_syn.organism_scientific 'Rattus norvegicus' _pdbx_entity_src_syn.organism_common_name Rat _pdbx_entity_src_syn.ncbi_taxonomy_id 10116 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP FAK1_MOUSE P34152 ? 1 ;NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISK MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML ; 959 2 UNP DCC_RAT Q63155 ? 2 DDLSEQMASLEGLMKQLNAITGS 1421 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6BZ3 A 1 ? 126 ? P34152 959 ? 1084 ? 921 1046 2 2 6BZ3 B 1 ? 23 ? Q63155 1421 ? 1443 ? 1421 1443 3 1 6BZ3 C 1 ? 126 ? P34152 959 ? 1084 ? 921 1046 4 2 6BZ3 D 1 ? 23 ? Q63155 1421 ? 1443 ? 1421 1443 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BZ3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 0.1 M Tris pH8.5, 20% (w/v) PEG8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6BZ3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4970 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10318 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_Rmerge_I_obs 0.092 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4970 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 978 _reflns_shell.percent_possible_all 93.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.527 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 148.840 _refine.B_iso_mean 64.3044 _refine.B_iso_min 29.890 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BZ3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4970 _refine.ls_d_res_low 39.8890 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10314 _refine.ls_number_reflns_R_free 496 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5800 _refine.ls_percent_reflns_R_free 4.8100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2278 _refine.ls_R_factor_R_free 0.2686 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2260 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1OW6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.8800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4970 _refine_hist.d_res_low 39.8890 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 2230 _refine_hist.pdbx_number_residues_total 287 _refine_hist.pdbx_B_iso_mean_ligand 81.48 _refine_hist.pdbx_B_iso_mean_solvent 53.76 _refine_hist.pdbx_number_atoms_protein 2217 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2243 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.573 ? 3017 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.030 ? 371 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 381 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.711 ? 1433 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4974 2.7487 2461 . 125 2336 95.0000 . . . 0.3205 0.0000 0.2896 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7487 3.1463 2572 . 126 2446 100.0000 . . . 0.3428 0.0000 0.2978 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.1463 3.9634 2602 . 130 2472 100.0000 . . . 0.2580 0.0000 0.2314 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.9634 39.8944 2679 . 115 2564 100.0000 . . . 0.2355 0.0000 0.1906 . . . . . . 4 . . . # _struct.entry_id 6BZ3 _struct.title 'Complex structure of FAK FAT domain and DCC P3 motif' _struct.pdbx_descriptor 'Focal adhesion kinase 1 (E.C.2.7.10.2), Netrin receptor DCC' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BZ3 _struct_keywords.text ;4-helix bundle, axon guidance, focal adhesion kinase, transferase-peptide complex, MEMBRANE PROTEIN, TRANSFERASE-MEMBRANE PROTEIN complex ; _struct_keywords.pdbx_keywords 'TRANSFERASE/MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLN A 23 ? ASP A 922 GLN A 943 1 ? 22 HELX_P HELX_P2 AA2 PRO A 26 ? GLU A 28 ? PRO A 946 GLU A 948 5 ? 3 HELX_P HELX_P3 AA3 GLU A 29 ? ILE A 52 ? GLU A 949 ILE A 972 1 ? 24 HELX_P HELX_P4 AA4 PRO A 53 ? LEU A 55 ? PRO A 973 LEU A 975 5 ? 3 HELX_P HELX_P5 AA5 PRO A 56 ? SER A 58 ? PRO A 976 SER A 978 5 ? 3 HELX_P HELX_P6 AA6 THR A 59 ? TYR A 87 ? THR A 979 TYR A 1007 1 ? 29 HELX_P HELX_P7 AA7 LEU A 92 ? LEU A 126 ? LEU A 1012 LEU A 1046 1 ? 35 HELX_P HELX_P8 AA8 ASP B 2 ? ASN B 18 ? ASP B 1422 ASN B 1438 1 ? 17 HELX_P HELX_P9 AA9 LYS C 3 ? GLN C 23 ? LYS C 923 GLN C 943 1 ? 21 HELX_P HELX_P10 AB1 PRO C 26 ? ILE C 52 ? PRO C 946 ILE C 972 1 ? 27 HELX_P HELX_P11 AB2 THR C 59 ? TYR C 87 ? THR C 979 TYR C 1007 1 ? 29 HELX_P HELX_P12 AB3 LEU C 92 ? LEU C 126 ? LEU C 1012 LEU C 1046 1 ? 35 HELX_P HELX_P13 AB4 ASP D 2 ? ALA D 19 ? ASP D 1422 ALA D 1439 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A SER 20 O ? ? ? 1_555 E CA . CA ? ? A SER 940 A CA 1101 1_555 ? ? ? ? ? ? ? 2.379 ? metalc2 metalc ? ? A LYS 21 O ? ? ? 1_555 E CA . CA ? ? A LYS 941 A CA 1101 1_555 ? ? ? ? ? ? ? 2.612 ? metalc3 metalc ? ? A GLN 23 O ? ? ? 1_555 E CA . CA ? ? A GLN 943 A CA 1101 1_555 ? ? ? ? ? ? ? 2.367 ? metalc4 metalc ? ? C SER 20 O ? ? ? 1_555 E CA . CA ? ? C SER 940 A CA 1101 1_555 ? ? ? ? ? ? ? 2.360 ? metalc5 metalc ? ? C LYS 21 O ? ? ? 1_555 E CA . CA ? ? C LYS 941 A CA 1101 1_555 ? ? ? ? ? ? ? 2.462 ? metalc6 metalc ? ? C GLN 23 O ? ? ? 1_555 E CA . CA ? ? C GLN 943 A CA 1101 1_555 ? ? ? ? ? ? ? 2.308 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 1101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue CA A 1101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 20 ? SER A 940 . ? 1_555 ? 2 AC1 6 LYS A 21 ? LYS A 941 . ? 1_555 ? 3 AC1 6 GLN A 23 ? GLN A 943 . ? 1_555 ? 4 AC1 6 SER C 20 ? SER C 940 . ? 1_555 ? 5 AC1 6 LYS C 21 ? LYS C 941 . ? 1_555 ? 6 AC1 6 GLN C 23 ? GLN C 943 . ? 1_555 ? # _atom_sites.entry_id 6BZ3 _atom_sites.fract_transf_matrix[1][1] 0.007741 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001973 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027678 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015772 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 921 ? ? ? A . n A 1 2 ASP 2 922 922 ASP ASP A . n A 1 3 LYS 3 923 923 LYS LYS A . n A 1 4 VAL 4 924 924 VAL VAL A . n A 1 5 TYR 5 925 925 TYR TYR A . n A 1 6 GLU 6 926 926 GLU GLU A . n A 1 7 ASN 7 927 927 ASN ASN A . n A 1 8 VAL 8 928 928 VAL VAL A . n A 1 9 THR 9 929 929 THR THR A . n A 1 10 GLY 10 930 930 GLY GLY A . n A 1 11 LEU 11 931 931 LEU LEU A . n A 1 12 VAL 12 932 932 VAL VAL A . n A 1 13 LYS 13 933 933 LYS LYS A . n A 1 14 ALA 14 934 934 ALA ALA A . n A 1 15 VAL 15 935 935 VAL VAL A . n A 1 16 ILE 16 936 936 ILE ILE A . n A 1 17 GLU 17 937 937 GLU GLU A . n A 1 18 MET 18 938 938 MET MET A . n A 1 19 SER 19 939 939 SER SER A . n A 1 20 SER 20 940 940 SER SER A . n A 1 21 LYS 21 941 941 LYS LYS A . n A 1 22 ILE 22 942 942 ILE ILE A . n A 1 23 GLN 23 943 943 GLN GLN A . n A 1 24 PRO 24 944 944 PRO PRO A . n A 1 25 ALA 25 945 945 ALA ALA A . n A 1 26 PRO 26 946 946 PRO PRO A . n A 1 27 PRO 27 947 947 PRO PRO A . n A 1 28 GLU 28 948 948 GLU GLU A . n A 1 29 GLU 29 949 949 GLU GLU A . n A 1 30 TYR 30 950 950 TYR TYR A . n A 1 31 VAL 31 951 951 VAL VAL A . n A 1 32 PRO 32 952 952 PRO PRO A . n A 1 33 MET 33 953 953 MET MET A . n A 1 34 VAL 34 954 954 VAL VAL A . n A 1 35 LYS 35 955 955 LYS LYS A . n A 1 36 GLU 36 956 956 GLU GLU A . n A 1 37 VAL 37 957 957 VAL VAL A . n A 1 38 GLY 38 958 958 GLY GLY A . n A 1 39 LEU 39 959 959 LEU LEU A . n A 1 40 ALA 40 960 960 ALA ALA A . n A 1 41 LEU 41 961 961 LEU LEU A . n A 1 42 ARG 42 962 962 ARG ARG A . n A 1 43 THR 43 963 963 THR THR A . n A 1 44 LEU 44 964 964 LEU LEU A . n A 1 45 LEU 45 965 965 LEU LEU A . n A 1 46 ALA 46 966 966 ALA ALA A . n A 1 47 THR 47 967 967 THR THR A . n A 1 48 VAL 48 968 968 VAL VAL A . n A 1 49 ASP 49 969 969 ASP ASP A . n A 1 50 GLU 50 970 970 GLU GLU A . n A 1 51 THR 51 971 971 THR THR A . n A 1 52 ILE 52 972 972 ILE ILE A . n A 1 53 PRO 53 973 973 PRO PRO A . n A 1 54 ALA 54 974 974 ALA ALA A . n A 1 55 LEU 55 975 975 LEU LEU A . n A 1 56 PRO 56 976 976 PRO PRO A . n A 1 57 ALA 57 977 977 ALA ALA A . n A 1 58 SER 58 978 978 SER SER A . n A 1 59 THR 59 979 979 THR THR A . n A 1 60 HIS 60 980 980 HIS HIS A . n A 1 61 ARG 61 981 981 ARG ARG A . n A 1 62 GLU 62 982 982 GLU GLU A . n A 1 63 ILE 63 983 983 ILE ILE A . n A 1 64 GLU 64 984 984 GLU GLU A . n A 1 65 MET 65 985 985 MET MET A . n A 1 66 ALA 66 986 986 ALA ALA A . n A 1 67 GLN 67 987 987 GLN GLN A . n A 1 68 LYS 68 988 988 LYS LYS A . n A 1 69 LEU 69 989 989 LEU LEU A . n A 1 70 LEU 70 990 990 LEU LEU A . n A 1 71 ASN 71 991 991 ASN ASN A . n A 1 72 SER 72 992 992 SER SER A . n A 1 73 ASP 73 993 993 ASP ASP A . n A 1 74 LEU 74 994 994 LEU LEU A . n A 1 75 GLY 75 995 995 GLY GLY A . n A 1 76 GLU 76 996 996 GLU GLU A . n A 1 77 LEU 77 997 997 LEU LEU A . n A 1 78 ILE 78 998 998 ILE ILE A . n A 1 79 SER 79 999 999 SER SER A . n A 1 80 LYS 80 1000 1000 LYS LYS A . n A 1 81 MET 81 1001 1001 MET MET A . n A 1 82 LYS 82 1002 1002 LYS LYS A . n A 1 83 LEU 83 1003 1003 LEU LEU A . n A 1 84 ALA 84 1004 1004 ALA ALA A . n A 1 85 GLN 85 1005 1005 GLN GLN A . n A 1 86 GLN 86 1006 1006 GLN GLN A . n A 1 87 TYR 87 1007 1007 TYR TYR A . n A 1 88 VAL 88 1008 1008 VAL VAL A . n A 1 89 MET 89 1009 1009 MET MET A . n A 1 90 THR 90 1010 1010 THR THR A . n A 1 91 SER 91 1011 1011 SER SER A . n A 1 92 LEU 92 1012 1012 LEU LEU A . n A 1 93 GLN 93 1013 1013 GLN GLN A . n A 1 94 GLN 94 1014 1014 GLN GLN A . n A 1 95 GLU 95 1015 1015 GLU GLU A . n A 1 96 TYR 96 1016 1016 TYR TYR A . n A 1 97 LYS 97 1017 1017 LYS LYS A . n A 1 98 LYS 98 1018 1018 LYS LYS A . n A 1 99 GLN 99 1019 1019 GLN GLN A . n A 1 100 MET 100 1020 1020 MET MET A . n A 1 101 LEU 101 1021 1021 LEU LEU A . n A 1 102 THR 102 1022 1022 THR THR A . n A 1 103 ALA 103 1023 1023 ALA ALA A . n A 1 104 ALA 104 1024 1024 ALA ALA A . n A 1 105 HIS 105 1025 1025 HIS HIS A . n A 1 106 ALA 106 1026 1026 ALA ALA A . n A 1 107 LEU 107 1027 1027 LEU LEU A . n A 1 108 ALA 108 1028 1028 ALA ALA A . n A 1 109 VAL 109 1029 1029 VAL VAL A . n A 1 110 ASP 110 1030 1030 ASP ASP A . n A 1 111 ALA 111 1031 1031 ALA ALA A . n A 1 112 LYS 112 1032 1032 LYS LYS A . n A 1 113 ASN 113 1033 1033 ASN ASN A . n A 1 114 LEU 114 1034 1034 LEU LEU A . n A 1 115 LEU 115 1035 1035 LEU LEU A . n A 1 116 ASP 116 1036 1036 ASP ASP A . n A 1 117 VAL 117 1037 1037 VAL VAL A . n A 1 118 ILE 118 1038 1038 ILE ILE A . n A 1 119 ASP 119 1039 1039 ASP ASP A . n A 1 120 GLN 120 1040 1040 GLN GLN A . n A 1 121 ALA 121 1041 1041 ALA ALA A . n A 1 122 ARG 122 1042 1042 ARG ARG A . n A 1 123 LEU 123 1043 1043 LEU LEU A . n A 1 124 LYS 124 1044 1044 LYS LYS A . n A 1 125 MET 125 1045 1045 MET MET A . n A 1 126 LEU 126 1046 1046 LEU LEU A . n B 2 1 ASP 1 1421 1421 ASP ASP B . n B 2 2 ASP 2 1422 1422 ASP ASP B . n B 2 3 LEU 3 1423 1423 LEU LEU B . n B 2 4 SER 4 1424 1424 SER SER B . n B 2 5 GLU 5 1425 1425 GLU GLU B . n B 2 6 GLN 6 1426 1426 GLN GLN B . n B 2 7 MET 7 1427 1427 MET MET B . n B 2 8 ALA 8 1428 1428 ALA ALA B . n B 2 9 SER 9 1429 1429 SER SER B . n B 2 10 LEU 10 1430 1430 LEU LEU B . n B 2 11 GLU 11 1431 1431 GLU GLU B . n B 2 12 GLY 12 1432 1432 GLY GLY B . n B 2 13 LEU 13 1433 1433 LEU LEU B . n B 2 14 MET 14 1434 1434 MET MET B . n B 2 15 LYS 15 1435 1435 LYS LYS B . n B 2 16 GLN 16 1436 1436 GLN GLN B . n B 2 17 LEU 17 1437 1437 LEU LEU B . n B 2 18 ASN 18 1438 1438 ASN ASN B . n B 2 19 ALA 19 1439 ? ? ? B . n B 2 20 ILE 20 1440 ? ? ? B . n B 2 21 THR 21 1441 ? ? ? B . n B 2 22 GLY 22 1442 ? ? ? B . n B 2 23 SER 23 1443 ? ? ? B . n C 1 1 ASN 1 921 ? ? ? C . n C 1 2 ASP 2 922 922 ASP ASP C . n C 1 3 LYS 3 923 923 LYS LYS C . n C 1 4 VAL 4 924 924 VAL VAL C . n C 1 5 TYR 5 925 925 TYR TYR C . n C 1 6 GLU 6 926 926 GLU GLU C . n C 1 7 ASN 7 927 927 ASN ASN C . n C 1 8 VAL 8 928 928 VAL VAL C . n C 1 9 THR 9 929 929 THR THR C . n C 1 10 GLY 10 930 930 GLY GLY C . n C 1 11 LEU 11 931 931 LEU LEU C . n C 1 12 VAL 12 932 932 VAL VAL C . n C 1 13 LYS 13 933 933 LYS LYS C . n C 1 14 ALA 14 934 934 ALA ALA C . n C 1 15 VAL 15 935 935 VAL VAL C . n C 1 16 ILE 16 936 936 ILE ILE C . n C 1 17 GLU 17 937 937 GLU GLU C . n C 1 18 MET 18 938 938 MET MET C . n C 1 19 SER 19 939 939 SER SER C . n C 1 20 SER 20 940 940 SER SER C . n C 1 21 LYS 21 941 941 LYS LYS C . n C 1 22 ILE 22 942 942 ILE ILE C . n C 1 23 GLN 23 943 943 GLN GLN C . n C 1 24 PRO 24 944 944 PRO PRO C . n C 1 25 ALA 25 945 945 ALA ALA C . n C 1 26 PRO 26 946 946 PRO PRO C . n C 1 27 PRO 27 947 947 PRO PRO C . n C 1 28 GLU 28 948 948 GLU GLU C . n C 1 29 GLU 29 949 949 GLU GLU C . n C 1 30 TYR 30 950 950 TYR TYR C . n C 1 31 VAL 31 951 951 VAL VAL C . n C 1 32 PRO 32 952 952 PRO PRO C . n C 1 33 MET 33 953 953 MET MET C . n C 1 34 VAL 34 954 954 VAL VAL C . n C 1 35 LYS 35 955 955 LYS LYS C . n C 1 36 GLU 36 956 956 GLU GLU C . n C 1 37 VAL 37 957 957 VAL VAL C . n C 1 38 GLY 38 958 958 GLY GLY C . n C 1 39 LEU 39 959 959 LEU LEU C . n C 1 40 ALA 40 960 960 ALA ALA C . n C 1 41 LEU 41 961 961 LEU LEU C . n C 1 42 ARG 42 962 962 ARG ARG C . n C 1 43 THR 43 963 963 THR THR C . n C 1 44 LEU 44 964 964 LEU LEU C . n C 1 45 LEU 45 965 965 LEU LEU C . n C 1 46 ALA 46 966 966 ALA ALA C . n C 1 47 THR 47 967 967 THR THR C . n C 1 48 VAL 48 968 968 VAL VAL C . n C 1 49 ASP 49 969 969 ASP ASP C . n C 1 50 GLU 50 970 970 GLU GLU C . n C 1 51 THR 51 971 971 THR THR C . n C 1 52 ILE 52 972 972 ILE ILE C . n C 1 53 PRO 53 973 973 PRO PRO C . n C 1 54 ALA 54 974 974 ALA ALA C . n C 1 55 LEU 55 975 975 LEU LEU C . n C 1 56 PRO 56 976 976 PRO PRO C . n C 1 57 ALA 57 977 977 ALA ALA C . n C 1 58 SER 58 978 978 SER SER C . n C 1 59 THR 59 979 979 THR THR C . n C 1 60 HIS 60 980 980 HIS HIS C . n C 1 61 ARG 61 981 981 ARG ARG C . n C 1 62 GLU 62 982 982 GLU GLU C . n C 1 63 ILE 63 983 983 ILE ILE C . n C 1 64 GLU 64 984 984 GLU GLU C . n C 1 65 MET 65 985 985 MET MET C . n C 1 66 ALA 66 986 986 ALA ALA C . n C 1 67 GLN 67 987 987 GLN GLN C . n C 1 68 LYS 68 988 988 LYS LYS C . n C 1 69 LEU 69 989 989 LEU LEU C . n C 1 70 LEU 70 990 990 LEU LEU C . n C 1 71 ASN 71 991 991 ASN ASN C . n C 1 72 SER 72 992 992 SER SER C . n C 1 73 ASP 73 993 993 ASP ASP C . n C 1 74 LEU 74 994 994 LEU LEU C . n C 1 75 GLY 75 995 995 GLY GLY C . n C 1 76 GLU 76 996 996 GLU GLU C . n C 1 77 LEU 77 997 997 LEU LEU C . n C 1 78 ILE 78 998 998 ILE ILE C . n C 1 79 SER 79 999 999 SER SER C . n C 1 80 LYS 80 1000 1000 LYS LYS C . n C 1 81 MET 81 1001 1001 MET MET C . n C 1 82 LYS 82 1002 1002 LYS LYS C . n C 1 83 LEU 83 1003 1003 LEU LEU C . n C 1 84 ALA 84 1004 1004 ALA ALA C . n C 1 85 GLN 85 1005 1005 GLN GLN C . n C 1 86 GLN 86 1006 1006 GLN GLN C . n C 1 87 TYR 87 1007 1007 TYR TYR C . n C 1 88 VAL 88 1008 1008 VAL VAL C . n C 1 89 MET 89 1009 1009 MET MET C . n C 1 90 THR 90 1010 1010 THR THR C . n C 1 91 SER 91 1011 1011 SER SER C . n C 1 92 LEU 92 1012 1012 LEU LEU C . n C 1 93 GLN 93 1013 1013 GLN GLN C . n C 1 94 GLN 94 1014 1014 GLN GLN C . n C 1 95 GLU 95 1015 1015 GLU GLU C . n C 1 96 TYR 96 1016 1016 TYR TYR C . n C 1 97 LYS 97 1017 1017 LYS LYS C . n C 1 98 LYS 98 1018 1018 LYS LYS C . n C 1 99 GLN 99 1019 1019 GLN GLN C . n C 1 100 MET 100 1020 1020 MET MET C . n C 1 101 LEU 101 1021 1021 LEU LEU C . n C 1 102 THR 102 1022 1022 THR THR C . n C 1 103 ALA 103 1023 1023 ALA ALA C . n C 1 104 ALA 104 1024 1024 ALA ALA C . n C 1 105 HIS 105 1025 1025 HIS HIS C . n C 1 106 ALA 106 1026 1026 ALA ALA C . n C 1 107 LEU 107 1027 1027 LEU LEU C . n C 1 108 ALA 108 1028 1028 ALA ALA C . n C 1 109 VAL 109 1029 1029 VAL VAL C . n C 1 110 ASP 110 1030 1030 ASP ASP C . n C 1 111 ALA 111 1031 1031 ALA ALA C . n C 1 112 LYS 112 1032 1032 LYS LYS C . n C 1 113 ASN 113 1033 1033 ASN ASN C . n C 1 114 LEU 114 1034 1034 LEU LEU C . n C 1 115 LEU 115 1035 1035 LEU LEU C . n C 1 116 ASP 116 1036 1036 ASP ASP C . n C 1 117 VAL 117 1037 1037 VAL VAL C . n C 1 118 ILE 118 1038 1038 ILE ILE C . n C 1 119 ASP 119 1039 1039 ASP ASP C . n C 1 120 GLN 120 1040 1040 GLN GLN C . n C 1 121 ALA 121 1041 1041 ALA ALA C . n C 1 122 ARG 122 1042 1042 ARG ARG C . n C 1 123 LEU 123 1043 1043 LEU LEU C . n C 1 124 LYS 124 1044 1044 LYS LYS C . n C 1 125 MET 125 1045 1045 MET MET C . n C 1 126 LEU 126 1046 1046 LEU LEU C . n D 2 1 ASP 1 1421 1421 ASP ASP D . n D 2 2 ASP 2 1422 1422 ASP ASP D . n D 2 3 LEU 3 1423 1423 LEU LEU D . n D 2 4 SER 4 1424 1424 SER SER D . n D 2 5 GLU 5 1425 1425 GLU GLU D . n D 2 6 GLN 6 1426 1426 GLN GLN D . n D 2 7 MET 7 1427 1427 MET MET D . n D 2 8 ALA 8 1428 1428 ALA ALA D . n D 2 9 SER 9 1429 1429 SER SER D . n D 2 10 LEU 10 1430 1430 LEU LEU D . n D 2 11 GLU 11 1431 1431 GLU GLU D . n D 2 12 GLY 12 1432 1432 GLY GLY D . n D 2 13 LEU 13 1433 1433 LEU LEU D . n D 2 14 MET 14 1434 1434 MET MET D . n D 2 15 LYS 15 1435 1435 LYS LYS D . n D 2 16 GLN 16 1436 1436 GLN GLN D . n D 2 17 LEU 17 1437 1437 LEU LEU D . n D 2 18 ASN 18 1438 1438 ASN ASN D . n D 2 19 ALA 19 1439 1439 ALA ALA D . n D 2 20 ILE 20 1440 ? ? ? D . n D 2 21 THR 21 1441 ? ? ? D . n D 2 22 GLY 22 1442 ? ? ? D . n D 2 23 SER 23 1443 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 CA 1 1101 1 CA CA A . F 4 HOH 1 1201 3 HOH HOH A . F 4 HOH 2 1202 1 HOH HOH A . F 4 HOH 3 1203 6 HOH HOH A . F 4 HOH 4 1204 10 HOH HOH A . F 4 HOH 5 1205 5 HOH HOH A . G 4 HOH 1 1201 11 HOH HOH C . G 4 HOH 2 1202 12 HOH HOH C . G 4 HOH 3 1203 8 HOH HOH C . G 4 HOH 4 1204 9 HOH HOH C . G 4 HOH 5 1205 4 HOH HOH C . G 4 HOH 6 1206 7 HOH HOH C . H 4 HOH 1 1501 2 HOH HOH D . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6860 ? 1 MORE -77 ? 1 'SSA (A^2)' 15090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 20 ? A SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? A LYS 21 ? A LYS 941 ? 1_555 92.6 ? 2 O ? A SER 20 ? A SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? A GLN 23 ? A GLN 943 ? 1_555 77.4 ? 3 O ? A LYS 21 ? A LYS 941 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? A GLN 23 ? A GLN 943 ? 1_555 93.7 ? 4 O ? A SER 20 ? A SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C SER 20 ? C SER 940 ? 1_555 100.5 ? 5 O ? A LYS 21 ? A LYS 941 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C SER 20 ? C SER 940 ? 1_555 92.0 ? 6 O ? A GLN 23 ? A GLN 943 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C SER 20 ? C SER 940 ? 1_555 173.9 ? 7 O ? A SER 20 ? A SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C LYS 21 ? C LYS 941 ? 1_555 89.8 ? 8 O ? A LYS 21 ? A LYS 941 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C LYS 21 ? C LYS 941 ? 1_555 173.1 ? 9 O ? A GLN 23 ? A GLN 943 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C LYS 21 ? C LYS 941 ? 1_555 80.4 ? 10 O ? C SER 20 ? C SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C LYS 21 ? C LYS 941 ? 1_555 94.0 ? 11 O ? A SER 20 ? A SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C GLN 23 ? C GLN 943 ? 1_555 167.7 ? 12 O ? A LYS 21 ? A LYS 941 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C GLN 23 ? C GLN 943 ? 1_555 75.1 ? 13 O ? A GLN 23 ? A GLN 943 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C GLN 23 ? C GLN 943 ? 1_555 102.8 ? 14 O ? C SER 20 ? C SER 940 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C GLN 23 ? C GLN 943 ? 1_555 80.5 ? 15 O ? C LYS 21 ? C LYS 941 ? 1_555 CA ? E CA . ? A CA 1101 ? 1_555 O ? C GLN 23 ? C GLN 943 ? 1_555 102.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-04 2 'Structure model' 1 1 2019-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -25.3816 5.1778 26.1822 0.4522 0.4309 0.3948 0.0895 -0.0334 0.0959 2.8764 1.3281 3.5559 -0.4676 -1.8624 1.6542 0.3230 -0.4711 0.0119 0.0486 -0.0287 -0.5983 -0.0408 0.3675 0.4486 'X-RAY DIFFRACTION' 2 ? refined -6.3982 -1.4668 7.4161 0.3380 0.3024 0.3401 -0.0152 0.0464 -0.0180 3.0832 3.2642 2.6942 -0.9790 -0.5997 0.2265 0.2183 -0.0765 -0.1467 0.2834 -0.0437 0.1487 -0.2031 -0.1201 -0.2097 'X-RAY DIFFRACTION' 3 ? refined -20.7631 -6.6481 9.6660 0.5719 0.6008 0.8669 0.0012 0.0276 -0.0090 1.9281 6.4448 2.5390 -0.3224 -1.0128 -2.3640 -0.0219 -0.4034 0.1672 0.0715 -0.7819 0.4899 0.0002 0.6495 -0.6442 'X-RAY DIFFRACTION' 4 ? refined -14.8693 -2.5059 14.7046 0.4672 0.3053 0.4139 0.0259 0.0394 0.0310 3.7667 1.4641 2.1801 -2.0487 -1.3663 1.6356 -0.2505 0.2332 -0.0624 -0.3579 -0.1450 -0.2337 0.0931 -0.0779 -0.5156 'X-RAY DIFFRACTION' 5 ? refined -36.0527 6.0248 29.8777 0.4114 0.5781 0.3960 -0.0282 -0.0053 0.0215 2.8721 1.9710 4.3134 0.5319 1.4621 1.2188 0.3136 -0.0824 0.0498 -0.1172 -0.1614 0.0767 -0.0160 0.3353 -1.3044 'X-RAY DIFFRACTION' 6 ? refined -23.7510 14.2969 24.9765 0.7001 0.7576 0.6969 -0.0798 0.1945 -0.0232 3.9793 1.7862 5.9085 0.8827 -1.2751 1.8169 0.2220 -0.6999 -0.1566 0.8561 0.5353 -1.1484 -0.6624 -0.9086 0.8612 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 922 A 946 ;chain 'A' and (resid 922 through 946 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 947 A 1046 ;chain 'A' and (resid 947 through 1046 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 B 0 B 0 ;chain 'B' and (resid 1423 through 1440 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 C 922 C 946 ;chain 'C' and (resid 922 through 946 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 C 947 C 1046 ;chain 'C' and (resid 947 through 1046 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 D 0 D 0 ;chain 'D' and (resid 1423 through 1441 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id C _pdbx_validate_torsion.auth_seq_id 977 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -75.38 _pdbx_validate_torsion.psi 36.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 921 ? A ASN 1 2 1 Y 1 B ALA 1439 ? B ALA 19 3 1 Y 1 B ILE 1440 ? B ILE 20 4 1 Y 1 B THR 1441 ? B THR 21 5 1 Y 1 B GLY 1442 ? B GLY 22 6 1 Y 1 B SER 1443 ? B SER 23 7 1 Y 1 C ASN 921 ? C ASN 1 8 1 Y 1 D ILE 1440 ? D ILE 20 9 1 Y 1 D THR 1441 ? D THR 21 10 1 Y 1 D GLY 1442 ? D GLY 22 11 1 Y 1 D SER 1443 ? D SER 23 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number P01HL103526 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #