data_6CKJ # _entry.id 6CKJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CKJ pdb_00006ckj 10.2210/pdb6ckj/pdb WWPDB D_1000231070 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CKJ _pdbx_database_status.recvd_initial_deposition_date 2018-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Matthews, M.M.' 1 0000-0002-9762-9467 'Fisher, A.J.' 2 0000-0003-3488-6594 'Chen, X.' 3 0000-0002-3160-614X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Catalytic Cycle ofNeisseria meningitidisCMP-Sialic Acid Synthetase Illustrated by High-Resolution Protein Crystallography.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.9b00517 _citation.pdbx_database_id_PubMed 31583886 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matthews, M.M.' 1 ? primary 'McArthur, J.B.' 2 ? primary 'Li, Y.' 3 ? primary 'Yu, H.' 4 0000-0002-4378-0532 primary 'Chen, X.' 5 0000-0002-3160-614X primary 'Fisher, A.J.' 6 0000-0003-3488-6594 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6CKJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.783 _cell.length_a_esd ? _cell.length_b 155.056 _cell.length_b_esd ? _cell.length_c 38.777 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CKJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'N-acylneuraminate cytidylyltransferase' 24920.408 1 2.7.7.43 ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 water nat water 18.015 245 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTA SSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSD LEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTA SSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSD LEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 GLN n 1 5 ASN n 1 6 ILE n 1 7 ALA n 1 8 VAL n 1 9 ILE n 1 10 LEU n 1 11 ALA n 1 12 ARG n 1 13 GLN n 1 14 ASN n 1 15 SER n 1 16 LYS n 1 17 GLY n 1 18 LEU n 1 19 PRO n 1 20 LEU n 1 21 LYS n 1 22 ASN n 1 23 LEU n 1 24 ARG n 1 25 LYS n 1 26 MET n 1 27 ASN n 1 28 GLY n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 GLY n 1 34 HIS n 1 35 THR n 1 36 ILE n 1 37 ASN n 1 38 ALA n 1 39 ALA n 1 40 ILE n 1 41 SER n 1 42 SER n 1 43 LYS n 1 44 CYS n 1 45 PHE n 1 46 ASP n 1 47 ARG n 1 48 ILE n 1 49 ILE n 1 50 VAL n 1 51 SER n 1 52 THR n 1 53 ASP n 1 54 GLY n 1 55 GLY n 1 56 LEU n 1 57 ILE n 1 58 ALA n 1 59 GLU n 1 60 GLU n 1 61 ALA n 1 62 LYS n 1 63 ASN n 1 64 PHE n 1 65 GLY n 1 66 VAL n 1 67 GLU n 1 68 VAL n 1 69 VAL n 1 70 LEU n 1 71 ARG n 1 72 PRO n 1 73 ALA n 1 74 GLU n 1 75 LEU n 1 76 ALA n 1 77 SER n 1 78 ASP n 1 79 THR n 1 80 ALA n 1 81 SER n 1 82 SER n 1 83 ILE n 1 84 SER n 1 85 GLY n 1 86 VAL n 1 87 ILE n 1 88 HIS n 1 89 ALA n 1 90 LEU n 1 91 GLU n 1 92 THR n 1 93 ILE n 1 94 GLY n 1 95 SER n 1 96 ASN n 1 97 SER n 1 98 GLY n 1 99 THR n 1 100 VAL n 1 101 THR n 1 102 LEU n 1 103 LEU n 1 104 GLN n 1 105 PRO n 1 106 THR n 1 107 SER n 1 108 PRO n 1 109 LEU n 1 110 ARG n 1 111 THR n 1 112 GLY n 1 113 ALA n 1 114 HIS n 1 115 ILE n 1 116 ARG n 1 117 GLU n 1 118 ALA n 1 119 PHE n 1 120 SER n 1 121 LEU n 1 122 PHE n 1 123 ASP n 1 124 GLU n 1 125 LYS n 1 126 ILE n 1 127 LYS n 1 128 GLY n 1 129 SER n 1 130 VAL n 1 131 VAL n 1 132 SER n 1 133 ALA n 1 134 CYS n 1 135 PRO n 1 136 MET n 1 137 GLU n 1 138 HIS n 1 139 HIS n 1 140 PRO n 1 141 LEU n 1 142 LYS n 1 143 THR n 1 144 LEU n 1 145 LEU n 1 146 GLN n 1 147 ILE n 1 148 ASN n 1 149 ASN n 1 150 GLY n 1 151 GLU n 1 152 TYR n 1 153 ALA n 1 154 PRO n 1 155 MET n 1 156 ARG n 1 157 HIS n 1 158 LEU n 1 159 SER n 1 160 ASP n 1 161 LEU n 1 162 GLU n 1 163 GLN n 1 164 PRO n 1 165 ARG n 1 166 GLN n 1 167 GLN n 1 168 LEU n 1 169 PRO n 1 170 GLN n 1 171 ALA n 1 172 PHE n 1 173 ARG n 1 174 PRO n 1 175 ASN n 1 176 GLY n 1 177 ALA n 1 178 ILE n 1 179 TYR n 1 180 ILE n 1 181 ASN n 1 182 ASP n 1 183 THR n 1 184 ALA n 1 185 SER n 1 186 LEU n 1 187 ILE n 1 188 ALA n 1 189 ASN n 1 190 ASN n 1 191 CYS n 1 192 PHE n 1 193 PHE n 1 194 ILE n 1 195 ALA n 1 196 PRO n 1 197 THR n 1 198 LYS n 1 199 LEU n 1 200 TYR n 1 201 ILE n 1 202 MET n 1 203 SER n 1 204 HIS n 1 205 GLN n 1 206 ASP n 1 207 SER n 1 208 ILE n 1 209 ASP n 1 210 ILE n 1 211 ASP n 1 212 THR n 1 213 GLU n 1 214 LEU n 1 215 ASP n 1 216 LEU n 1 217 GLN n 1 218 GLN n 1 219 ALA n 1 220 GLU n 1 221 ASN n 1 222 ILE n 1 223 LEU n 1 224 ASN n 1 225 HIS n 1 226 LYS n 1 227 GLU n 1 228 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'neuA, siaB, synB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria meningitidis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 487 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'BL21(DE3)' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEUA_NEIME _struct_ref.pdbx_db_accession P0A0Z8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTA SSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSD LEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CKJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A0Z8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 228 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CKJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.27 _exptl_crystal.description 'long rectangular prism' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.16M calcium acetate, 0.08M sodium cacodylate pH 6.5, 14.4% PEG 8000, and 20% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CKJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 38.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27855 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.43 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.90 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1446 _reflns_shell.percent_possible_all 91.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.515 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.794 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CKJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 38.777 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27840 _refine.ls_number_reflns_R_free 1405 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.53 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1586 _refine.ls_R_factor_R_free 0.1865 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1571 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.89 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1EYR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.08 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.13 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1714 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 245 _refine_hist.number_atoms_total 1969 _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 38.777 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1754 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.751 ? 2379 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.890 ? 1078 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 281 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 314 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.75 1.8120 . . 130 2574 94.00 . . . 0.2378 . 0.1981 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8120 1.8846 . . 130 2634 97.00 . . . 0.2072 . 0.1851 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8846 1.9703 . . 154 2641 97.00 . . . 0.2475 . 0.1740 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9703 2.0742 . . 130 2643 97.00 . . . 0.2006 . 0.1649 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0742 2.2041 . . 134 2398 87.00 . . . 0.1919 . 0.1543 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2041 2.3743 . . 154 2676 98.00 . . . 0.1921 . 0.1508 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3743 2.6132 . . 148 2715 99.00 . . . 0.1800 . 0.1542 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6132 2.9912 . . 148 2724 98.00 . . . 0.1731 . 0.1598 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9912 3.7681 . . 134 2692 96.00 . . . 0.1901 . 0.1475 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7681 38.7865 . . 143 2738 93.00 . . . 0.1573 . 0.1490 . . . . . . . . . . # _struct.entry_id 6CKJ _struct.title 'N. meningitidis CMP-sialic acid synthetase, ligand-free' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CKJ _struct_keywords.text 'polysaccharide synthesis, sialic acid-activator, CMP-transferase, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 20 ? LEU A 23 ? LEU A 20 LEU A 23 5 ? 4 HELX_P HELX_P2 AA2 LEU A 31 ? LYS A 43 ? LEU A 31 LYS A 43 1 ? 13 HELX_P HELX_P3 AA3 GLY A 54 ? PHE A 64 ? GLY A 54 PHE A 64 1 ? 11 HELX_P HELX_P4 AA4 PRO A 72 ? ALA A 76 ? PRO A 72 ALA A 76 5 ? 5 HELX_P HELX_P5 AA5 SER A 81 ? GLY A 94 ? SER A 81 GLY A 94 1 ? 14 HELX_P HELX_P6 AA6 THR A 111 ? LEU A 121 ? THR A 111 LEU A 121 1 ? 11 HELX_P HELX_P7 AA7 HIS A 157 ? GLN A 163 ? HIS A 157 GLN A 163 5 ? 7 HELX_P HELX_P8 AA8 PRO A 164 ? LEU A 168 ? PRO A 164 LEU A 168 5 ? 5 HELX_P HELX_P9 AA9 THR A 183 ? ASN A 190 ? THR A 183 ASN A 190 1 ? 8 HELX_P HELX_P10 AB1 HIS A 204 ? ILE A 208 ? HIS A 204 ILE A 208 5 ? 5 HELX_P HELX_P11 AB2 THR A 212 ? ASN A 224 ? THR A 212 ASN A 224 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ARG 156 O ? ? ? 1_555 D CA . CA ? ? A ARG 156 A CA 303 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc2 metalc ? ? A ARG 156 O ? ? ? 1_555 D CA . CA ? ? A ARG 156 A CA 303 3_555 ? ? ? ? ? ? ? 2.250 ? ? metalc3 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 501 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc4 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 501 3_555 ? ? ? ? ? ? ? 2.551 ? ? metalc5 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 564 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc6 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 564 3_555 ? ? ? ? ? ? ? 2.218 ? ? metalc7 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 574 1_555 ? ? ? ? ? ? ? 2.376 ? ? metalc8 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 574 3_555 ? ? ? ? ? ? ? 2.376 ? ? metalc9 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 416 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc10 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 416 6_575 ? ? ? ? ? ? ? 2.226 ? ? metalc11 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 483 1_555 ? ? ? ? ? ? ? 2.208 ? ? metalc12 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 483 6_575 ? ? ? ? ? ? ? 2.208 ? ? metalc13 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 616 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc14 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 304 A HOH 616 6_575 ? ? ? ? ? ? ? 2.323 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 195 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 195 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 196 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 196 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.56 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 67 ? LEU A 70 ? GLU A 67 LEU A 70 AA1 2 ARG A 47 ? THR A 52 ? ARG A 47 THR A 52 AA1 3 GLN A 4 ? LEU A 10 ? GLN A 4 LEU A 10 AA1 4 GLY A 98 ? LEU A 102 ? GLY A 98 LEU A 102 AA1 5 PHE A 172 ? ASP A 182 ? PHE A 172 ASP A 182 AA1 6 VAL A 130 ? PRO A 135 ? VAL A 130 PRO A 135 AA1 7 LYS A 198 ? ILE A 201 ? LYS A 198 ILE A 201 AA2 1 LYS A 25 ? MET A 26 ? LYS A 25 MET A 26 AA2 2 ILE A 29 ? SER A 30 ? ILE A 29 SER A 30 AA3 1 LEU A 144 ? ASN A 148 ? LEU A 144 ASN A 148 AA3 2 GLU A 151 ? PRO A 154 ? GLU A 151 PRO A 154 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 67 ? O GLU A 67 N VAL A 50 ? N VAL A 50 AA1 2 3 O ILE A 49 ? O ILE A 49 N ILE A 9 ? N ILE A 9 AA1 3 4 N VAL A 8 ? N VAL A 8 O THR A 101 ? O THR A 101 AA1 4 5 N VAL A 100 ? N VAL A 100 O ASN A 181 ? O ASN A 181 AA1 5 6 O ILE A 180 ? O ILE A 180 N VAL A 130 ? N VAL A 130 AA1 6 7 N ALA A 133 ? N ALA A 133 O TYR A 200 ? O TYR A 200 AA2 1 2 N MET A 26 ? N MET A 26 O ILE A 29 ? O ILE A 29 AA3 1 2 N LEU A 145 ? N LEU A 145 O ALA A 153 ? O ALA A 153 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 301 ? 3 'binding site for residue ACT A 301' AC2 Software A ACT 302 ? 6 'binding site for residue ACT A 302' AC3 Software A CA 303 ? 8 'binding site for residue CA A 303' AC4 Software A CA 304 ? 6 'binding site for residue CA A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLN A 104 ? GLN A 104 . ? 1_555 ? 2 AC1 3 HOH F . ? HOH A 502 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 533 . ? 1_555 ? 4 AC2 6 ARG A 47 ? ARG A 47 . ? 6_575 ? 5 AC2 6 ARG A 47 ? ARG A 47 . ? 1_555 ? 6 AC2 6 ILE A 48 ? ILE A 48 . ? 1_555 ? 7 AC2 6 GLY A 65 ? GLY A 65 . ? 1_555 ? 8 AC2 6 VAL A 66 ? VAL A 66 . ? 1_555 ? 9 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? 10 AC3 8 ARG A 156 ? ARG A 156 . ? 3_555 ? 11 AC3 8 ARG A 156 ? ARG A 156 . ? 1_555 ? 12 AC3 8 HOH F . ? HOH A 501 . ? 3_555 ? 13 AC3 8 HOH F . ? HOH A 501 . ? 1_555 ? 14 AC3 8 HOH F . ? HOH A 564 . ? 3_555 ? 15 AC3 8 HOH F . ? HOH A 564 . ? 1_555 ? 16 AC3 8 HOH F . ? HOH A 574 . ? 3_555 ? 17 AC3 8 HOH F . ? HOH A 574 . ? 1_555 ? 18 AC4 6 HOH F . ? HOH A 416 . ? 1_555 ? 19 AC4 6 HOH F . ? HOH A 416 . ? 6_575 ? 20 AC4 6 HOH F . ? HOH A 483 . ? 6_575 ? 21 AC4 6 HOH F . ? HOH A 483 . ? 1_555 ? 22 AC4 6 HOH F . ? HOH A 616 . ? 6_575 ? 23 AC4 6 HOH F . ? HOH A 616 . ? 1_555 ? # _atom_sites.entry_id 6CKJ _atom_sites.fract_transf_matrix[1][1] 0.010663 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006449 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025788 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 CYS 191 191 191 CYS CYS A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 MET 202 202 202 MET MET A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 LYS 226 226 ? ? ? A . n A 1 227 GLU 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 301 293 ACT ACT A . C 2 ACT 1 302 294 ACT ACT A . D 3 CA 1 303 295 CA CA A . E 3 CA 1 304 296 CA CA A . F 4 HOH 1 401 268 HOH HOH A . F 4 HOH 2 402 199 HOH HOH A . F 4 HOH 3 403 187 HOH HOH A . F 4 HOH 4 404 197 HOH HOH A . F 4 HOH 5 405 166 HOH HOH A . F 4 HOH 6 406 212 HOH HOH A . F 4 HOH 7 407 57 HOH HOH A . F 4 HOH 8 408 149 HOH HOH A . F 4 HOH 9 409 5 HOH HOH A . F 4 HOH 10 410 186 HOH HOH A . F 4 HOH 11 411 43 HOH HOH A . F 4 HOH 12 412 236 HOH HOH A . F 4 HOH 13 413 10 HOH HOH A . F 4 HOH 14 414 180 HOH HOH A . F 4 HOH 15 415 264 HOH HOH A . F 4 HOH 16 416 131 HOH HOH A . F 4 HOH 17 417 74 HOH HOH A . F 4 HOH 18 418 143 HOH HOH A . F 4 HOH 19 419 53 HOH HOH A . F 4 HOH 20 420 34 HOH HOH A . F 4 HOH 21 421 172 HOH HOH A . F 4 HOH 22 422 36 HOH HOH A . F 4 HOH 23 423 132 HOH HOH A . F 4 HOH 24 424 111 HOH HOH A . F 4 HOH 25 425 59 HOH HOH A . F 4 HOH 26 426 107 HOH HOH A . F 4 HOH 27 427 23 HOH HOH A . F 4 HOH 28 428 203 HOH HOH A . F 4 HOH 29 429 58 HOH HOH A . F 4 HOH 30 430 32 HOH HOH A . F 4 HOH 31 431 78 HOH HOH A . F 4 HOH 32 432 234 HOH HOH A . F 4 HOH 33 433 35 HOH HOH A . F 4 HOH 34 434 154 HOH HOH A . F 4 HOH 35 435 70 HOH HOH A . F 4 HOH 36 436 82 HOH HOH A . F 4 HOH 37 437 54 HOH HOH A . F 4 HOH 38 438 19 HOH HOH A . F 4 HOH 39 439 31 HOH HOH A . F 4 HOH 40 440 150 HOH HOH A . F 4 HOH 41 441 48 HOH HOH A . F 4 HOH 42 442 142 HOH HOH A . F 4 HOH 43 443 239 HOH HOH A . F 4 HOH 44 444 198 HOH HOH A . F 4 HOH 45 445 41 HOH HOH A . F 4 HOH 46 446 87 HOH HOH A . F 4 HOH 47 447 81 HOH HOH A . F 4 HOH 48 448 4 HOH HOH A . F 4 HOH 49 449 20 HOH HOH A . F 4 HOH 50 450 77 HOH HOH A . F 4 HOH 51 451 39 HOH HOH A . F 4 HOH 52 452 108 HOH HOH A . F 4 HOH 53 453 8 HOH HOH A . F 4 HOH 54 454 1 HOH HOH A . F 4 HOH 55 455 66 HOH HOH A . F 4 HOH 56 456 139 HOH HOH A . F 4 HOH 57 457 221 HOH HOH A . F 4 HOH 58 458 7 HOH HOH A . F 4 HOH 59 459 33 HOH HOH A . F 4 HOH 60 460 62 HOH HOH A . F 4 HOH 61 461 223 HOH HOH A . F 4 HOH 62 462 281 HOH HOH A . F 4 HOH 63 463 148 HOH HOH A . F 4 HOH 64 464 190 HOH HOH A . F 4 HOH 65 465 45 HOH HOH A . F 4 HOH 66 466 25 HOH HOH A . F 4 HOH 67 467 51 HOH HOH A . F 4 HOH 68 468 29 HOH HOH A . F 4 HOH 69 469 160 HOH HOH A . F 4 HOH 70 470 12 HOH HOH A . F 4 HOH 71 471 2 HOH HOH A . F 4 HOH 72 472 46 HOH HOH A . F 4 HOH 73 473 121 HOH HOH A . F 4 HOH 74 474 15 HOH HOH A . F 4 HOH 75 475 105 HOH HOH A . F 4 HOH 76 476 99 HOH HOH A . F 4 HOH 77 477 76 HOH HOH A . F 4 HOH 78 478 50 HOH HOH A . F 4 HOH 79 479 145 HOH HOH A . F 4 HOH 80 480 97 HOH HOH A . F 4 HOH 81 481 137 HOH HOH A . F 4 HOH 82 482 14 HOH HOH A . F 4 HOH 83 483 94 HOH HOH A . F 4 HOH 84 484 3 HOH HOH A . F 4 HOH 85 485 113 HOH HOH A . F 4 HOH 86 486 292 HOH HOH A . F 4 HOH 87 487 120 HOH HOH A . F 4 HOH 88 488 286 HOH HOH A . F 4 HOH 89 489 95 HOH HOH A . F 4 HOH 90 490 60 HOH HOH A . F 4 HOH 91 491 144 HOH HOH A . F 4 HOH 92 492 72 HOH HOH A . F 4 HOH 93 493 61 HOH HOH A . F 4 HOH 94 494 16 HOH HOH A . F 4 HOH 95 495 17 HOH HOH A . F 4 HOH 96 496 9 HOH HOH A . F 4 HOH 97 497 156 HOH HOH A . F 4 HOH 98 498 69 HOH HOH A . F 4 HOH 99 499 83 HOH HOH A . F 4 HOH 100 500 44 HOH HOH A . F 4 HOH 101 501 129 HOH HOH A . F 4 HOH 102 502 258 HOH HOH A . F 4 HOH 103 503 6 HOH HOH A . F 4 HOH 104 504 30 HOH HOH A . F 4 HOH 105 505 147 HOH HOH A . F 4 HOH 106 506 135 HOH HOH A . F 4 HOH 107 507 103 HOH HOH A . F 4 HOH 108 508 207 HOH HOH A . F 4 HOH 109 509 63 HOH HOH A . F 4 HOH 110 510 109 HOH HOH A . F 4 HOH 111 511 138 HOH HOH A . F 4 HOH 112 512 40 HOH HOH A . F 4 HOH 113 513 155 HOH HOH A . F 4 HOH 114 514 67 HOH HOH A . F 4 HOH 115 515 101 HOH HOH A . F 4 HOH 116 516 146 HOH HOH A . F 4 HOH 117 517 102 HOH HOH A . F 4 HOH 118 518 181 HOH HOH A . F 4 HOH 119 519 140 HOH HOH A . F 4 HOH 120 520 114 HOH HOH A . F 4 HOH 121 521 125 HOH HOH A . F 4 HOH 122 522 49 HOH HOH A . F 4 HOH 123 523 290 HOH HOH A . F 4 HOH 124 524 75 HOH HOH A . F 4 HOH 125 525 167 HOH HOH A . F 4 HOH 126 526 117 HOH HOH A . F 4 HOH 127 527 93 HOH HOH A . F 4 HOH 128 528 112 HOH HOH A . F 4 HOH 129 529 110 HOH HOH A . F 4 HOH 130 530 206 HOH HOH A . F 4 HOH 131 531 133 HOH HOH A . F 4 HOH 132 532 28 HOH HOH A . F 4 HOH 133 533 271 HOH HOH A . F 4 HOH 134 534 233 HOH HOH A . F 4 HOH 135 535 104 HOH HOH A . F 4 HOH 136 536 136 HOH HOH A . F 4 HOH 137 537 88 HOH HOH A . F 4 HOH 138 538 116 HOH HOH A . F 4 HOH 139 539 27 HOH HOH A . F 4 HOH 140 540 13 HOH HOH A . F 4 HOH 141 541 37 HOH HOH A . F 4 HOH 142 542 171 HOH HOH A . F 4 HOH 143 543 265 HOH HOH A . F 4 HOH 144 544 272 HOH HOH A . F 4 HOH 145 545 84 HOH HOH A . F 4 HOH 146 546 229 HOH HOH A . F 4 HOH 147 547 276 HOH HOH A . F 4 HOH 148 548 22 HOH HOH A . F 4 HOH 149 549 279 HOH HOH A . F 4 HOH 150 550 18 HOH HOH A . F 4 HOH 151 551 118 HOH HOH A . F 4 HOH 152 552 73 HOH HOH A . F 4 HOH 153 553 90 HOH HOH A . F 4 HOH 154 554 26 HOH HOH A . F 4 HOH 155 555 79 HOH HOH A . F 4 HOH 156 556 204 HOH HOH A . F 4 HOH 157 557 11 HOH HOH A . F 4 HOH 158 558 91 HOH HOH A . F 4 HOH 159 559 168 HOH HOH A . F 4 HOH 160 560 157 HOH HOH A . F 4 HOH 161 561 24 HOH HOH A . F 4 HOH 162 562 42 HOH HOH A . F 4 HOH 163 563 285 HOH HOH A . F 4 HOH 164 564 177 HOH HOH A . F 4 HOH 165 565 134 HOH HOH A . F 4 HOH 166 566 47 HOH HOH A . F 4 HOH 167 567 196 HOH HOH A . F 4 HOH 168 568 80 HOH HOH A . F 4 HOH 169 569 21 HOH HOH A . F 4 HOH 170 570 71 HOH HOH A . F 4 HOH 171 571 115 HOH HOH A . F 4 HOH 172 572 56 HOH HOH A . F 4 HOH 173 573 213 HOH HOH A . F 4 HOH 174 574 280 HOH HOH A . F 4 HOH 175 575 153 HOH HOH A . F 4 HOH 176 576 266 HOH HOH A . F 4 HOH 177 577 244 HOH HOH A . F 4 HOH 178 578 122 HOH HOH A . F 4 HOH 179 579 163 HOH HOH A . F 4 HOH 180 580 278 HOH HOH A . F 4 HOH 181 581 161 HOH HOH A . F 4 HOH 182 582 100 HOH HOH A . F 4 HOH 183 583 200 HOH HOH A . F 4 HOH 184 584 185 HOH HOH A . F 4 HOH 185 585 85 HOH HOH A . F 4 HOH 186 586 189 HOH HOH A . F 4 HOH 187 587 173 HOH HOH A . F 4 HOH 188 588 240 HOH HOH A . F 4 HOH 189 589 273 HOH HOH A . F 4 HOH 190 590 183 HOH HOH A . F 4 HOH 191 591 165 HOH HOH A . F 4 HOH 192 592 159 HOH HOH A . F 4 HOH 193 593 194 HOH HOH A . F 4 HOH 194 594 96 HOH HOH A . F 4 HOH 195 595 222 HOH HOH A . F 4 HOH 196 596 55 HOH HOH A . F 4 HOH 197 597 89 HOH HOH A . F 4 HOH 198 598 98 HOH HOH A . F 4 HOH 199 599 106 HOH HOH A . F 4 HOH 200 600 174 HOH HOH A . F 4 HOH 201 601 253 HOH HOH A . F 4 HOH 202 602 235 HOH HOH A . F 4 HOH 203 603 65 HOH HOH A . F 4 HOH 204 604 214 HOH HOH A . F 4 HOH 205 605 193 HOH HOH A . F 4 HOH 206 606 152 HOH HOH A . F 4 HOH 207 607 68 HOH HOH A . F 4 HOH 208 608 38 HOH HOH A . F 4 HOH 209 609 86 HOH HOH A . F 4 HOH 210 610 184 HOH HOH A . F 4 HOH 211 611 64 HOH HOH A . F 4 HOH 212 612 126 HOH HOH A . F 4 HOH 213 613 263 HOH HOH A . F 4 HOH 214 614 182 HOH HOH A . F 4 HOH 215 615 210 HOH HOH A . F 4 HOH 216 616 130 HOH HOH A . F 4 HOH 217 617 188 HOH HOH A . F 4 HOH 218 618 119 HOH HOH A . F 4 HOH 219 619 162 HOH HOH A . F 4 HOH 220 620 251 HOH HOH A . F 4 HOH 221 621 241 HOH HOH A . F 4 HOH 222 622 123 HOH HOH A . F 4 HOH 223 623 52 HOH HOH A . F 4 HOH 224 624 274 HOH HOH A . F 4 HOH 225 625 289 HOH HOH A . F 4 HOH 226 626 124 HOH HOH A . F 4 HOH 227 627 208 HOH HOH A . F 4 HOH 228 628 216 HOH HOH A . F 4 HOH 229 629 127 HOH HOH A . F 4 HOH 230 630 218 HOH HOH A . F 4 HOH 231 631 246 HOH HOH A . F 4 HOH 232 632 176 HOH HOH A . F 4 HOH 233 633 249 HOH HOH A . F 4 HOH 234 634 219 HOH HOH A . F 4 HOH 235 635 220 HOH HOH A . F 4 HOH 236 636 92 HOH HOH A . F 4 HOH 237 637 205 HOH HOH A . F 4 HOH 238 638 128 HOH HOH A . F 4 HOH 239 639 237 HOH HOH A . F 4 HOH 240 640 217 HOH HOH A . F 4 HOH 241 641 287 HOH HOH A . F 4 HOH 242 642 211 HOH HOH A . F 4 HOH 243 643 284 HOH HOH A . F 4 HOH 244 644 170 HOH HOH A . F 4 HOH 245 645 225 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3180 ? 1 MORE -24 ? 1 'SSA (A^2)' 20220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_575 x,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 310.1120000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 303 ? D CA . 2 1 A CA 304 ? E CA . 3 1 A HOH 574 ? F HOH . 4 1 A HOH 605 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A ARG 156 ? A ARG 156 ? 1_555 0.0 ? 2 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 96.5 ? 3 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 96.5 ? 4 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 501 ? 3_555 82.9 ? 5 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 501 ? 3_555 82.9 ? 6 O ? F HOH . ? A HOH 501 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 501 ? 3_555 155.5 ? 7 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 1_555 83.5 ? 8 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 1_555 83.5 ? 9 O ? F HOH . ? A HOH 501 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 1_555 133.1 ? 10 O ? F HOH . ? A HOH 501 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 1_555 71.3 ? 11 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 3_555 96.8 ? 12 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 3_555 96.8 ? 13 O ? F HOH . ? A HOH 501 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 3_555 82.5 ? 14 O ? F HOH . ? A HOH 501 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 3_555 121.9 ? 15 O ? F HOH . ? A HOH 564 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 564 ? 3_555 51.2 ? 16 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 88.6 ? 17 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 88.6 ? 18 O ? F HOH . ? A HOH 501 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 81.6 ? 19 O ? F HOH . ? A HOH 501 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 73.9 ? 20 O ? F HOH . ? A HOH 564 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 145.0 ? 21 O ? F HOH . ? A HOH 564 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 1_555 163.7 ? 22 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 88.6 ? 23 O ? A ARG 156 ? A ARG 156 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 88.6 ? 24 O ? F HOH . ? A HOH 501 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 81.6 ? 25 O ? F HOH . ? A HOH 501 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 73.9 ? 26 O ? F HOH . ? A HOH 564 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 145.0 ? 27 O ? F HOH . ? A HOH 564 ? 3_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 163.7 ? 28 O ? F HOH . ? A HOH 574 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 574 ? 3_555 0.0 ? 29 O ? F HOH . ? A HOH 416 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 416 ? 6_575 106.3 ? 30 O ? F HOH . ? A HOH 416 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 483 ? 1_555 86.2 ? 31 O ? F HOH . ? A HOH 416 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 483 ? 1_555 89.1 ? 32 O ? F HOH . ? A HOH 416 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 483 ? 6_575 89.1 ? 33 O ? F HOH . ? A HOH 416 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 483 ? 6_575 86.2 ? 34 O ? F HOH . ? A HOH 483 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 483 ? 6_575 172.3 ? 35 O ? F HOH . ? A HOH 416 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 1_555 79.5 ? 36 O ? F HOH . ? A HOH 416 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 1_555 172.0 ? 37 O ? F HOH . ? A HOH 483 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 1_555 85.7 ? 38 O ? F HOH . ? A HOH 483 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 1_555 99.6 ? 39 O ? F HOH . ? A HOH 416 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 6_575 172.0 ? 40 O ? F HOH . ? A HOH 416 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 6_575 79.5 ? 41 O ? F HOH . ? A HOH 483 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 6_575 99.6 ? 42 O ? F HOH . ? A HOH 483 ? 6_575 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 6_575 85.7 ? 43 O ? F HOH . ? A HOH 616 ? 1_555 CA ? E CA . ? A CA 304 ? 1_555 O ? F HOH . ? A HOH 616 ? 6_575 95.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-06 2 'Structure model' 1 1 2019-04-10 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2020-03-18 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' citation 4 4 'Structure model' citation_author 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_citation.country' 4 4 'Structure model' '_citation.journal_abbrev' 5 4 'Structure model' '_citation.journal_id_ASTM' 6 4 'Structure model' '_citation.journal_id_CSD' 7 4 'Structure model' '_citation.journal_id_ISSN' 8 4 'Structure model' '_citation.pdbx_database_id_DOI' 9 4 'Structure model' '_citation.pdbx_database_id_PubMed' 10 4 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.year' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 26 5 'Structure model' '_pdbx_struct_conn_angle.value' 27 5 'Structure model' '_struct_conn.pdbx_dist_value' 28 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 34 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 35 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 36 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 37 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 38 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 39 5 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 28.0576 179.3257 4.4090 0.0693 0.0799 0.0933 0.0141 -0.0166 0.0081 0.5568 0.7831 0.5052 0.7251 0.3251 0.6439 0.0518 0.0573 -0.0575 0.1107 0.0246 -0.2021 0.1319 0.0594 0.0168 'X-RAY DIFFRACTION' 2 ? refined 19.9171 180.9291 4.0720 0.0741 0.0740 0.0627 -0.0028 -0.0077 0.0245 0.9678 0.9438 0.4634 0.6319 -0.0102 0.2242 0.0647 -0.0548 -0.0353 0.0692 -0.0432 -0.0806 0.0371 0.0286 0.0139 'X-RAY DIFFRACTION' 3 ? refined 9.6811 150.2371 -2.0226 0.1624 0.0726 0.0717 -0.0033 0.0114 0.0224 0.3289 0.5415 0.1721 -0.1334 -0.0125 -0.0477 -0.0600 -0.1095 -0.0633 -0.1003 -0.0020 -0.0121 0.0474 0.0855 -0.0004 'X-RAY DIFFRACTION' 4 ? refined 14.4360 172.9905 -0.5766 0.0601 0.0574 0.0791 -0.0026 0.0004 0.0100 0.2269 0.3564 0.4506 0.2951 0.1687 -0.0622 0.0429 -0.0694 -0.0782 -0.0471 -0.0031 0.0146 0.0656 0.0413 0.0000 'X-RAY DIFFRACTION' 5 ? refined 35.9408 165.7816 -0.7177 -0.0351 0.1508 0.6269 0.4429 -0.2498 -0.0421 0.0250 0.1467 0.0755 0.0483 0.0488 0.1044 0.3016 0.1797 -0.1256 0.3238 0.3105 -0.3263 0.3815 0.1139 0.0026 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resseq 1:43)) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resseq 44:136)) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resseq 137:174)) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resseq 175:209)) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resseq 210:225)) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 564 ? ? 1_555 O A HOH 564 ? ? 3_555 2.00 2 1 O A HOH 596 ? ? 1_555 O A HOH 596 ? ? 3_555 2.05 3 1 O A HOH 608 ? ? 1_555 O A HOH 608 ? ? 3_555 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 14 ? ? -100.92 65.47 2 1 SER A 107 ? ? -117.74 73.01 3 1 LYS A 142 ? ? -92.04 50.84 4 1 ARG A 156 ? ? -131.62 -88.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A LYS 16 ? CG ? A LYS 16 CG 6 1 Y 1 A LYS 16 ? CD ? A LYS 16 CD 7 1 Y 1 A LYS 16 ? CE ? A LYS 16 CE 8 1 Y 1 A LYS 16 ? NZ ? A LYS 16 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 226 ? A LYS 226 2 1 Y 1 A GLU 227 ? A GLU 227 3 1 Y 1 A SER 228 ? A SER 228 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CA CA CA N N 81 CYS N N N N 82 CYS CA C N R 83 CYS C C N N 84 CYS O O N N 85 CYS CB C N N 86 CYS SG S N N 87 CYS OXT O N N 88 CYS H H N N 89 CYS H2 H N N 90 CYS HA H N N 91 CYS HB2 H N N 92 CYS HB3 H N N 93 CYS HG H N N 94 CYS HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HIS N N N N 145 HIS CA C N S 146 HIS C C N N 147 HIS O O N N 148 HIS CB C N N 149 HIS CG C Y N 150 HIS ND1 N Y N 151 HIS CD2 C Y N 152 HIS CE1 C Y N 153 HIS NE2 N Y N 154 HIS OXT O N N 155 HIS H H N N 156 HIS H2 H N N 157 HIS HA H N N 158 HIS HB2 H N N 159 HIS HB3 H N N 160 HIS HD1 H N N 161 HIS HD2 H N N 162 HIS HE1 H N N 163 HIS HE2 H N N 164 HIS HXT H N N 165 HOH O O N N 166 HOH H1 H N N 167 HOH H2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 PHE N N N N 258 PHE CA C N S 259 PHE C C N N 260 PHE O O N N 261 PHE CB C N N 262 PHE CG C Y N 263 PHE CD1 C Y N 264 PHE CD2 C Y N 265 PHE CE1 C Y N 266 PHE CE2 C Y N 267 PHE CZ C Y N 268 PHE OXT O N N 269 PHE H H N N 270 PHE H2 H N N 271 PHE HA H N N 272 PHE HB2 H N N 273 PHE HB3 H N N 274 PHE HD1 H N N 275 PHE HD2 H N N 276 PHE HE1 H N N 277 PHE HE2 H N N 278 PHE HZ H N N 279 PHE HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TYR N N N N 329 TYR CA C N S 330 TYR C C N N 331 TYR O O N N 332 TYR CB C N N 333 TYR CG C Y N 334 TYR CD1 C Y N 335 TYR CD2 C Y N 336 TYR CE1 C Y N 337 TYR CE2 C Y N 338 TYR CZ C Y N 339 TYR OH O N N 340 TYR OXT O N N 341 TYR H H N N 342 TYR H2 H N N 343 TYR HA H N N 344 TYR HB2 H N N 345 TYR HB3 H N N 346 TYR HD1 H N N 347 TYR HD2 H N N 348 TYR HE1 H N N 349 TYR HE2 H N N 350 TYR HH H N N 351 TYR HXT H N N 352 VAL N N N N 353 VAL CA C N S 354 VAL C C N N 355 VAL O O N N 356 VAL CB C N N 357 VAL CG1 C N N 358 VAL CG2 C N N 359 VAL OXT O N N 360 VAL H H N N 361 VAL H2 H N N 362 VAL HA H N N 363 VAL HB H N N 364 VAL HG11 H N N 365 VAL HG12 H N N 366 VAL HG13 H N N 367 VAL HG21 H N N 368 VAL HG22 H N N 369 VAL HG23 H N N 370 VAL HXT H N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 THR N CA sing N N 296 THR N H sing N N 297 THR N H2 sing N N 298 THR CA C sing N N 299 THR CA CB sing N N 300 THR CA HA sing N N 301 THR C O doub N N 302 THR C OXT sing N N 303 THR CB OG1 sing N N 304 THR CB CG2 sing N N 305 THR CB HB sing N N 306 THR OG1 HG1 sing N N 307 THR CG2 HG21 sing N N 308 THR CG2 HG22 sing N N 309 THR CG2 HG23 sing N N 310 THR OXT HXT sing N N 311 TYR N CA sing N N 312 TYR N H sing N N 313 TYR N H2 sing N N 314 TYR CA C sing N N 315 TYR CA CB sing N N 316 TYR CA HA sing N N 317 TYR C O doub N N 318 TYR C OXT sing N N 319 TYR CB CG sing N N 320 TYR CB HB2 sing N N 321 TYR CB HB3 sing N N 322 TYR CG CD1 doub Y N 323 TYR CG CD2 sing Y N 324 TYR CD1 CE1 sing Y N 325 TYR CD1 HD1 sing N N 326 TYR CD2 CE2 doub Y N 327 TYR CD2 HD2 sing N N 328 TYR CE1 CZ doub Y N 329 TYR CE1 HE1 sing N N 330 TYR CE2 CZ sing Y N 331 TYR CE2 HE2 sing N N 332 TYR CZ OH sing N N 333 TYR OH HH sing N N 334 TYR OXT HXT sing N N 335 VAL N CA sing N N 336 VAL N H sing N N 337 VAL N H2 sing N N 338 VAL CA C sing N N 339 VAL CA CB sing N N 340 VAL CA HA sing N N 341 VAL C O doub N N 342 VAL C OXT sing N N 343 VAL CB CG1 sing N N 344 VAL CB CG2 sing N N 345 VAL CB HB sing N N 346 VAL CG1 HG11 sing N N 347 VAL CG1 HG12 sing N N 348 VAL CG1 HG13 sing N N 349 VAL CG2 HG21 sing N N 350 VAL CG2 HG22 sing N N 351 VAL CG2 HG23 sing N N 352 VAL OXT HXT sing N N 353 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01AI130684 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'CALCIUM ION' CA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1EYR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #