data_6CKQ # _entry.id 6CKQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CKQ pdb_00006ckq 10.2210/pdb6ckq/pdb WWPDB D_1000232899 ? ? BMRB 30421 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution structure of the Burkholderia thailandensis transcription antitermination protein NusB (BTH_I1529) - Seattle Structural Genomics Center for Infectious Disease target ButhA.17903.a ; _pdbx_database_related.db_id 30421 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6CKQ _pdbx_database_status.recvd_initial_deposition_date 2018-02-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchko, G.W.' 1 0000-0002-3639-1061 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution structure of the Burkholderia thailandensis transcription antitermination protein NusB (BTH_I1529).' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription antitermination protein NusB' _entity.formula_weight 16301.551 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Antitermination factor NusB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMKKSARRQSRELATQGLYQWLLSNAAPGEIDAQLRGALGYDKADKTLLDTILHGVIREHATLAEAISPSLDRPIDQ LSPVERAVLLIATYELTHQIETPYRVIINEAVELAKTFGGSDGYKYVNGVLDKLAVKLRPAETQARRGA ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMKKSARRQSRELATQGLYQWLLSNAAPGEIDAQLRGALGYDKADKTLLDTILHGVIREHATLAEAISPSLDRPIDQ LSPVERAVLLIATYELTHQIETPYRVIINEAVELAKTFGGSDGYKYVNGVLDKLAVKLRPAETQARRGA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LYS n 1 7 LYS n 1 8 SER n 1 9 ALA n 1 10 ARG n 1 11 ARG n 1 12 GLN n 1 13 SER n 1 14 ARG n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 THR n 1 19 GLN n 1 20 GLY n 1 21 LEU n 1 22 TYR n 1 23 GLN n 1 24 TRP n 1 25 LEU n 1 26 LEU n 1 27 SER n 1 28 ASN n 1 29 ALA n 1 30 ALA n 1 31 PRO n 1 32 GLY n 1 33 GLU n 1 34 ILE n 1 35 ASP n 1 36 ALA n 1 37 GLN n 1 38 LEU n 1 39 ARG n 1 40 GLY n 1 41 ALA n 1 42 LEU n 1 43 GLY n 1 44 TYR n 1 45 ASP n 1 46 LYS n 1 47 ALA n 1 48 ASP n 1 49 LYS n 1 50 THR n 1 51 LEU n 1 52 LEU n 1 53 ASP n 1 54 THR n 1 55 ILE n 1 56 LEU n 1 57 HIS n 1 58 GLY n 1 59 VAL n 1 60 ILE n 1 61 ARG n 1 62 GLU n 1 63 HIS n 1 64 ALA n 1 65 THR n 1 66 LEU n 1 67 ALA n 1 68 GLU n 1 69 ALA n 1 70 ILE n 1 71 SER n 1 72 PRO n 1 73 SER n 1 74 LEU n 1 75 ASP n 1 76 ARG n 1 77 PRO n 1 78 ILE n 1 79 ASP n 1 80 GLN n 1 81 LEU n 1 82 SER n 1 83 PRO n 1 84 VAL n 1 85 GLU n 1 86 ARG n 1 87 ALA n 1 88 VAL n 1 89 LEU n 1 90 LEU n 1 91 ILE n 1 92 ALA n 1 93 THR n 1 94 TYR n 1 95 GLU n 1 96 LEU n 1 97 THR n 1 98 HIS n 1 99 GLN n 1 100 ILE n 1 101 GLU n 1 102 THR n 1 103 PRO n 1 104 TYR n 1 105 ARG n 1 106 VAL n 1 107 ILE n 1 108 ILE n 1 109 ASN n 1 110 GLU n 1 111 ALA n 1 112 VAL n 1 113 GLU n 1 114 LEU n 1 115 ALA n 1 116 LYS n 1 117 THR n 1 118 PHE n 1 119 GLY n 1 120 GLY n 1 121 SER n 1 122 ASP n 1 123 GLY n 1 124 TYR n 1 125 LYS n 1 126 TYR n 1 127 VAL n 1 128 ASN n 1 129 GLY n 1 130 VAL n 1 131 LEU n 1 132 ASP n 1 133 LYS n 1 134 LEU n 1 135 ALA n 1 136 VAL n 1 137 LYS n 1 138 LEU n 1 139 ARG n 1 140 PRO n 1 141 ALA n 1 142 GLU n 1 143 THR n 1 144 GLN n 1 145 ALA n 1 146 ARG n 1 147 ARG n 1 148 GLY n 1 149 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 149 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nusB, BTH_I1529' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700388 / DSM 13276 / CIP 106301 / E264' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 271848 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUSB_BURTA _struct_ref.pdbx_db_accession Q2SYC5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKSARRQSRELATQGLYQWLLSNAAPGEIDAQLRGALGYDKADKTLLDTILHGVIREHATLAEAISPSLDRPIDQLSPV ERAVLLIATYELTHQIETPYRVIINEAVELAKTFGGSDGYKYVNGVLDKLAVKLRPAETQARRGA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CKQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2SYC5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CKQ GLY A 1 ? UNP Q2SYC5 ? ? 'expression tag' 1 1 1 6CKQ PRO A 2 ? UNP Q2SYC5 ? ? 'expression tag' 2 2 1 6CKQ GLY A 3 ? UNP Q2SYC5 ? ? 'expression tag' 3 3 1 6CKQ SER A 4 ? UNP Q2SYC5 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 11 1 1 '3D C(CO)NH' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 3 isotropic 9 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 8 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 7 1 1 'deuterium exchange' 1 isotropic 6 1 1 '2D Deltas' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.4 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] NusB, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label NusB _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 VXRS ? Varian 600 ? 2 VXRS ? Agilent 750 ? 3 VXRS ? Agilent 800 ? # _pdbx_nmr_refine.entry_id 6CKQ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) AFTER ADDING 5% TO THE UPPER BOUNDARY LIMIT OF THE DISTANCE RESTRAINTS AND THE VDW ; _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6CKQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6CKQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' Sparky 3.13 Goddard 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 refinement CNS 1.1 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 'peak picking' PSVS 1.5 'Bhattacharya and Montelione' 5 processing Felix 2007 'Accelrys Software Inc.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CKQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6CKQ _struct.title ;Solution structure of the Burkholderia thailandensis transcription antitermination protein NusB (BTH_I1529) - Seattle Structural Genomics Center for Infectious Disease target ButhA.17903.a ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CKQ _struct_keywords.text ;infectious disease model, transcription antitermnation, NusA, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 9 ? ASN A 28 ? ALA A 9 ASN A 28 1 ? 20 HELX_P HELX_P2 AA2 ALA A 30 ? ALA A 41 ? ALA A 30 ALA A 41 1 ? 12 HELX_P HELX_P3 AA3 LEU A 42 ? ALA A 47 ? LEU A 42 ALA A 47 1 ? 6 HELX_P HELX_P4 AA4 THR A 50 ? LEU A 74 ? THR A 50 LEU A 74 1 ? 25 HELX_P HELX_P5 AA5 PRO A 77 ? LEU A 81 ? PRO A 77 LEU A 81 5 ? 5 HELX_P HELX_P6 AA6 SER A 82 ? ILE A 100 ? SER A 82 ILE A 100 1 ? 19 HELX_P HELX_P7 AA7 PRO A 103 ? GLY A 119 ? PRO A 103 GLY A 119 1 ? 17 HELX_P HELX_P8 AA8 GLY A 119 ? ARG A 139 ? GLY A 119 ARG A 139 1 ? 21 HELX_P HELX_P9 AA9 ARG A 139 ? GLN A 144 ? ARG A 139 GLN A 144 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6CKQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ALA 149 149 149 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-04 2 'Structure model' 1 1 2019-12-18 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_nmr_software 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 NusB 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 TRIS 20 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 10 _pdbx_validate_close_contact.auth_atom_id_1 HA _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 122 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ3 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 125 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.27 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 48 ? ? 175.98 153.00 2 1 ARG A 139 ? ? -162.07 61.32 3 2 ASP A 48 ? ? -176.29 136.58 4 3 SER A 4 ? ? -144.69 33.79 5 3 MET A 5 ? ? -67.24 89.58 6 3 ALA A 29 ? ? -70.72 -85.21 7 3 GLN A 80 ? ? -62.78 -75.67 8 3 ARG A 139 ? ? -161.98 102.56 9 3 ALA A 145 ? ? 55.51 16.89 10 4 PRO A 2 ? ? -65.39 86.40 11 4 ALA A 145 ? ? 55.76 16.81 12 5 LYS A 7 ? ? 62.83 103.77 13 5 ASP A 48 ? ? 83.72 143.60 14 5 GLN A 99 ? ? -141.20 57.54 15 5 ALA A 145 ? ? 58.54 18.80 16 6 MET A 5 ? ? -69.03 82.63 17 6 ASP A 48 ? ? 159.18 146.34 18 6 ARG A 139 ? ? -161.94 76.83 19 7 SER A 4 ? ? 173.78 -37.59 20 7 MET A 5 ? ? -68.02 94.09 21 7 ASP A 48 ? ? 164.32 154.63 22 8 PRO A 2 ? ? -65.95 93.51 23 8 ALA A 29 ? ? -51.99 -77.98 24 8 ALA A 30 ? ? -174.99 145.84 25 8 ASP A 48 ? ? 166.36 146.60 26 8 GLN A 99 ? ? -141.81 37.03 27 8 ARG A 139 ? ? -152.51 88.26 28 8 ALA A 145 ? ? 49.97 29.96 29 8 ARG A 147 ? ? -65.07 99.82 30 9 LYS A 6 ? ? -143.62 -55.27 31 9 ASP A 48 ? ? -175.68 142.15 32 9 GLN A 99 ? ? -140.73 34.79 33 9 ARG A 139 ? ? -157.52 84.33 34 10 LYS A 6 ? ? -150.65 -36.48 35 10 LYS A 7 ? ? -53.02 107.30 36 10 GLN A 99 ? ? -141.05 23.29 37 10 ARG A 139 ? ? -157.49 83.38 38 10 ARG A 146 ? ? -57.10 106.75 39 11 PRO A 2 ? ? -78.00 -163.04 40 11 SER A 4 ? ? 62.98 74.54 41 11 ALA A 29 ? ? -58.52 -78.93 42 11 ALA A 30 ? ? -175.33 142.64 43 11 ASP A 48 ? ? 176.40 159.13 44 11 LEU A 81 ? ? 66.85 170.96 45 11 ARG A 139 ? ? -162.04 78.75 46 11 ALA A 145 ? ? -52.60 83.85 47 12 MET A 5 ? ? 55.50 -83.47 48 12 LYS A 6 ? ? 48.88 77.01 49 12 ALA A 29 ? ? -58.11 -76.48 50 12 ALA A 30 ? ? -177.35 140.40 51 12 LYS A 46 ? ? -98.11 37.86 52 12 ALA A 47 ? ? -68.96 89.41 53 12 GLN A 99 ? ? -140.93 27.56 54 12 ALA A 145 ? ? 55.56 17.40 55 13 LYS A 7 ? ? -98.21 -60.09 56 13 LYS A 46 ? ? -96.62 35.60 57 14 MET A 5 ? ? -53.74 105.58 58 14 LYS A 7 ? ? -107.10 -163.70 59 14 ASP A 48 ? ? 179.11 154.53 60 14 PRO A 77 ? ? -51.55 -176.74 61 14 ILE A 78 ? ? -48.27 -18.42 62 14 ARG A 139 ? ? -158.05 85.20 63 14 ARG A 147 ? ? -83.88 38.55 64 15 PRO A 2 ? ? -84.78 38.48 65 15 LYS A 7 ? ? -154.20 -54.02 66 15 ARG A 139 ? ? -154.42 47.17 67 16 MET A 5 ? ? -69.01 82.63 68 16 ASP A 48 ? ? -174.06 136.45 69 16 ARG A 76 ? ? 172.03 -49.30 70 16 ARG A 139 ? ? -150.17 64.19 71 17 ALA A 29 ? ? -58.33 -74.52 72 17 ALA A 30 ? ? 177.64 154.96 73 17 ASP A 48 ? ? 178.35 155.15 74 17 ARG A 76 ? ? -162.28 -63.07 75 17 ARG A 139 ? ? -162.35 74.95 76 18 PRO A 2 ? ? -63.30 97.67 77 18 MET A 5 ? ? 53.56 -78.80 78 18 ALA A 29 ? ? -59.08 -71.65 79 18 ALA A 30 ? ? -177.50 143.80 80 18 ASP A 48 ? ? 179.97 136.81 81 18 GLN A 144 ? ? -82.29 -86.57 82 18 ALA A 145 ? ? 57.36 17.86 83 19 PRO A 2 ? ? -67.31 79.29 84 19 ALA A 29 ? ? -64.48 -176.42 85 19 ARG A 76 ? ? 169.83 -52.94 86 19 ARG A 139 ? ? -162.07 80.16 87 20 PRO A 2 ? ? -67.58 87.88 88 20 ALA A 47 ? ? -66.13 97.64 89 20 ASP A 48 ? ? -170.34 133.46 90 20 ILE A 78 ? ? -57.73 -9.32 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HHSN272200700057C _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ;The protein was a eluted with a retention time characteristic of a monomer on a size exclusion column (Superdex75). Other spectra properties were consistent with a monomer. ; #