data_6CPJ # _entry.id 6CPJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6CPJ WWPDB D_1000232982 BMRB 30437 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of SH3 domain from Shank2' _pdbx_database_related.db_id 30437 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6CPJ _pdbx_database_status.recvd_initial_deposition_date 2018-03-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ishida, H.' 1 ? 'Vogel, H.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 1873-3468 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 592 _citation.language ? _citation.page_first 2786 _citation.page_last 2797 _citation.title 'Solution structures of the SH3 domains from Shank scaffold proteins and their interactions with Cav1.3 calcium channels.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.13209 _citation.pdbx_database_id_PubMed 30058071 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Skorobogatov, A.' 2 ? primary 'Yamniuk, A.P.' 3 ? primary 'Vogel, H.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3 and multiple ankyrin repeat domains protein 2' _entity.formula_weight 6741.667 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Shank2,Cortactin-binding protein 1,CortBP1,GKAP/SAPAP-interacting protein,Proline-rich synapse-associated protein 1,ProSAP1,SPANK-3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQS _entity_poly.pdbx_seq_one_letter_code_can MVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 PRO n 1 4 GLY n 1 5 ARG n 1 6 LEU n 1 7 PHE n 1 8 VAL n 1 9 ALA n 1 10 ILE n 1 11 LYS n 1 12 PRO n 1 13 TYR n 1 14 GLN n 1 15 PRO n 1 16 GLN n 1 17 VAL n 1 18 ASP n 1 19 GLY n 1 20 GLU n 1 21 ILE n 1 22 PRO n 1 23 LEU n 1 24 HIS n 1 25 ARG n 1 26 GLY n 1 27 ASP n 1 28 ARG n 1 29 VAL n 1 30 LYS n 1 31 VAL n 1 32 LEU n 1 33 SER n 1 34 ILE n 1 35 GLY n 1 36 GLU n 1 37 GLY n 1 38 GLY n 1 39 PHE n 1 40 TRP n 1 41 GLU n 1 42 GLY n 1 43 SER n 1 44 ALA n 1 45 ARG n 1 46 GLY n 1 47 HIS n 1 48 ILE n 1 49 GLY n 1 50 TRP n 1 51 PHE n 1 52 PRO n 1 53 ALA n 1 54 GLU n 1 55 CYS n 1 56 VAL n 1 57 GLU n 1 58 GLU n 1 59 VAL n 1 60 GLN n 1 61 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 61 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Shank2, Cortbp1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHAN2_RAT _struct_ref.pdbx_db_accession Q9QX74 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQ _struct_ref.pdbx_align_begin 148 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CPJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9QX74 _struct_ref_seq.db_align_beg 148 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 206 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 526 _struct_ref_seq.pdbx_auth_seq_align_end 584 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CPJ MET A 1 ? UNP Q9QX74 ? ? 'initiating methionine' 525 1 1 6CPJ SER A 61 ? UNP Q9QX74 ? ? 'expression tag' 585 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 3 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D HBHA(CO)NH' 1 isotropic 10 1 2 '3D 1H-13C NOESY' 1 isotropic 12 1 3 '3D 1H-15N NOESY' 1 isotropic 11 1 4 '2D NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-99% 13C; U-99% 15N] Shank2 SH3, 20 mM Bis-Tris, 100 mM KCl, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C,15N_sample solution ? 2 '1 mM [U-99% 13C; U-99% 15N] Shank2 SH3, 20 mM Bis-Tris, 100 mM KCl, 100% D2O' '100% D2O' 13C,15N_sample2 solution ? 3 '1 mM [U-99% 13C; U-99% 15N] Shank2 SH3, 20 mM Bis-Tris, 100 mM KCl, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 4 '1 mM Shank2 SH3, 20 mM Bis-Tris, 100 mM KCl, 100% D2O' '100% D2O' unlabeled_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6CPJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 6CPJ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6CPJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 3 'structure calculation' CYANA 2.0 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CPJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6CPJ _struct.title 'Solution structure of SH3 domain from Shank2' _struct.pdbx_descriptor 'SH3 and multiple ankyrin repeat domains protein 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CPJ _struct_keywords.text 'PSD, scaffold protein, postsynaptic density, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 47 ? PRO A 52 ? HIS A 571 PRO A 576 AA1 2 PHE A 39 ? ALA A 44 ? PHE A 563 ALA A 568 AA1 3 ASP A 27 ? ILE A 34 ? ASP A 551 ILE A 558 AA1 4 LEU A 6 ? ALA A 9 ? LEU A 530 ALA A 533 AA1 5 VAL A 56 ? GLU A 58 ? VAL A 580 GLU A 582 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 49 ? O GLY A 573 N GLY A 42 ? N GLY A 566 AA1 2 3 O GLU A 41 ? O GLU A 565 N LEU A 32 ? N LEU A 556 AA1 3 4 O ASP A 27 ? O ASP A 551 N ALA A 9 ? N ALA A 533 AA1 4 5 N VAL A 8 ? N VAL A 532 O GLU A 57 ? O GLU A 581 # _atom_sites.entry_id 6CPJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 525 525 MET MET A . n A 1 2 VAL 2 526 526 VAL VAL A . n A 1 3 PRO 3 527 527 PRO PRO A . n A 1 4 GLY 4 528 528 GLY GLY A . n A 1 5 ARG 5 529 529 ARG ARG A . n A 1 6 LEU 6 530 530 LEU LEU A . n A 1 7 PHE 7 531 531 PHE PHE A . n A 1 8 VAL 8 532 532 VAL VAL A . n A 1 9 ALA 9 533 533 ALA ALA A . n A 1 10 ILE 10 534 534 ILE ILE A . n A 1 11 LYS 11 535 535 LYS LYS A . n A 1 12 PRO 12 536 536 PRO PRO A . n A 1 13 TYR 13 537 537 TYR TYR A . n A 1 14 GLN 14 538 538 GLN GLN A . n A 1 15 PRO 15 539 539 PRO PRO A . n A 1 16 GLN 16 540 540 GLN GLN A . n A 1 17 VAL 17 541 541 VAL VAL A . n A 1 18 ASP 18 542 542 ASP ASP A . n A 1 19 GLY 19 543 543 GLY GLY A . n A 1 20 GLU 20 544 544 GLU GLU A . n A 1 21 ILE 21 545 545 ILE ILE A . n A 1 22 PRO 22 546 546 PRO PRO A . n A 1 23 LEU 23 547 547 LEU LEU A . n A 1 24 HIS 24 548 548 HIS HIS A . n A 1 25 ARG 25 549 549 ARG ARG A . n A 1 26 GLY 26 550 550 GLY GLY A . n A 1 27 ASP 27 551 551 ASP ASP A . n A 1 28 ARG 28 552 552 ARG ARG A . n A 1 29 VAL 29 553 553 VAL VAL A . n A 1 30 LYS 30 554 554 LYS LYS A . n A 1 31 VAL 31 555 555 VAL VAL A . n A 1 32 LEU 32 556 556 LEU LEU A . n A 1 33 SER 33 557 557 SER SER A . n A 1 34 ILE 34 558 558 ILE ILE A . n A 1 35 GLY 35 559 559 GLY GLY A . n A 1 36 GLU 36 560 560 GLU GLU A . n A 1 37 GLY 37 561 561 GLY GLY A . n A 1 38 GLY 38 562 562 GLY GLY A . n A 1 39 PHE 39 563 563 PHE PHE A . n A 1 40 TRP 40 564 564 TRP TRP A . n A 1 41 GLU 41 565 565 GLU GLU A . n A 1 42 GLY 42 566 566 GLY GLY A . n A 1 43 SER 43 567 567 SER SER A . n A 1 44 ALA 44 568 568 ALA ALA A . n A 1 45 ARG 45 569 569 ARG ARG A . n A 1 46 GLY 46 570 570 GLY GLY A . n A 1 47 HIS 47 571 571 HIS HIS A . n A 1 48 ILE 48 572 572 ILE ILE A . n A 1 49 GLY 49 573 573 GLY GLY A . n A 1 50 TRP 50 574 574 TRP TRP A . n A 1 51 PHE 51 575 575 PHE PHE A . n A 1 52 PRO 52 576 576 PRO PRO A . n A 1 53 ALA 53 577 577 ALA ALA A . n A 1 54 GLU 54 578 578 GLU GLU A . n A 1 55 CYS 55 579 579 CYS CYS A . n A 1 56 VAL 56 580 580 VAL VAL A . n A 1 57 GLU 57 581 581 GLU GLU A . n A 1 58 GLU 58 582 582 GLU GLU A . n A 1 59 VAL 59 583 583 VAL VAL A . n A 1 60 GLN 60 584 584 GLN GLN A . n A 1 61 SER 61 585 585 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-15 2 'Structure model' 1 1 2018-09-12 3 'Structure model' 1 2 2020-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Shank2 SH3' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 Bis-Tris 20 ? mM 'natural abundance' 1 KCl 100 ? mM 'natural abundance' 2 'Shank2 SH3' 1 ? mM '[U-99% 13C; U-99% 15N]' 2 Bis-Tris 20 ? mM 'natural abundance' 2 KCl 100 ? mM 'natural abundance' 3 'Shank2 SH3' 1 ? mM '[U-99% 13C; U-99% 15N]' 3 Bis-Tris 20 ? mM 'natural abundance' 3 KCl 100 ? mM 'natural abundance' 4 'Shank2 SH3' 1 ? mM 'natural abundance' 4 Bis-Tris 20 ? mM 'natural abundance' 4 KCl 100 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 527 ? ? -69.75 -171.28 2 3 GLU A 560 ? ? -178.56 116.23 3 4 PRO A 527 ? ? -69.77 -170.63 4 4 LEU A 556 ? ? -128.28 -55.96 5 5 PRO A 527 ? ? -69.79 -171.37 6 6 PRO A 527 ? ? -69.72 -171.15 7 7 PRO A 527 ? ? -69.83 -171.97 8 10 PRO A 527 ? ? -69.73 -175.85 9 11 PRO A 527 ? ? -69.69 -170.72 10 11 ARG A 529 ? ? -51.71 -72.24 11 12 PRO A 527 ? ? -69.78 -171.08 12 13 LEU A 556 ? ? -130.95 -51.15 13 14 PRO A 527 ? ? -69.67 -170.03 14 14 ARG A 529 ? ? -104.94 -61.99 15 15 PRO A 527 ? ? -69.68 -169.37 16 15 ARG A 529 ? ? -95.59 -62.77 17 16 GLU A 560 ? ? -178.13 106.97 18 17 PRO A 527 ? ? -69.70 -177.32 19 18 PRO A 527 ? ? -69.80 -171.31 20 18 LEU A 556 ? ? -124.73 -51.36 21 19 ARG A 529 ? ? -148.25 -59.63 22 19 GLU A 560 ? ? -177.26 101.25 23 20 PRO A 527 ? ? -69.74 98.96 24 21 ARG A 529 ? ? -137.64 -60.50 25 21 GLU A 560 ? ? -173.89 107.40 26 23 LEU A 556 ? ? -122.70 -50.88 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #