data_6CSO # _entry.id 6CSO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CSO pdb_00006cso 10.2210/pdb6cso/pdb WWPDB D_1000233323 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CSO _pdbx_database_status.recvd_initial_deposition_date 2018-03-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kato, H.E.' 1 0000-0002-1941-5535 'Kim, Y.' 2 ? 'Yamashita, K.' 3 0000-0002-5442-7582 'Kobilka, B.K.' 4 ? 'Deisseroth, K.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 561 _citation.language ? _citation.page_first 349 _citation.page_last 354 _citation.title 'Structural mechanisms of selectivity and gating in anion channelrhodopsins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-018-0504-5 _citation.pdbx_database_id_PubMed 30158697 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kato, H.E.' 1 ? primary 'Kim, Y.S.' 2 ? primary 'Paggi, J.M.' 3 ? primary 'Evans, K.E.' 4 ? primary 'Allen, W.E.' 5 ? primary 'Richardson, C.' 6 ? primary 'Inoue, K.' 7 ? primary 'Ito, S.' 8 ? primary 'Ramakrishnan, C.' 9 ? primary 'Fenno, L.E.' 10 ? primary 'Yamashita, K.' 11 ? primary 'Hilger, D.' 12 ? primary 'Lee, S.Y.' 13 ? primary 'Berndt, A.' 14 ? primary 'Shen, K.' 15 ? primary 'Kandori, H.' 16 ? primary 'Dror, R.O.' 17 ? primary 'Kobilka, B.K.' 18 ? primary 'Deisseroth, K.' 19 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6CSO _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.960 _cell.length_a_esd ? _cell.length_b 141.100 _cell.length_b_esd ? _cell.length_c 90.060 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CSO _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man iC++ 34564.047 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 non-polymer syn 'OLEIC ACID' 282.461 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDYGGALSAVGLFQTSYTLENQGSVICIPNNGQCFCLAWLKSNGTNAEKLAANILQWISFALSALCLMFYGYQTWKSTCG WENIYVATIQMIKFIIEYFHSFDEPAVIYSSNGNKTRWLRYASWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTI VWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL SRYGSNVGHTIIDLMSKQCWGLLGHYLRVLIHSHILIHGDIRKTTKLNIGGTEIEVETLVEDEAEAGAV ; _entity_poly.pdbx_seq_one_letter_code_can ;MDYGGALSAVGLFQTSYTLENQGSVICIPNNGQCFCLAWLKSNGTNAEKLAANILQWISFALSALCLMFYGYQTWKSTCG WENIYVATIQMIKFIIEYFHSFDEPAVIYSSNGNKTRWLRYASWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTI VWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL SRYGSNVGHTIIDLMSKQCWGLLGHYLRVLIHSHILIHGDIRKTTKLNIGGTEIEVETLVEDEAEAGAV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 TYR n 1 4 GLY n 1 5 GLY n 1 6 ALA n 1 7 LEU n 1 8 SER n 1 9 ALA n 1 10 VAL n 1 11 GLY n 1 12 LEU n 1 13 PHE n 1 14 GLN n 1 15 THR n 1 16 SER n 1 17 TYR n 1 18 THR n 1 19 LEU n 1 20 GLU n 1 21 ASN n 1 22 GLN n 1 23 GLY n 1 24 SER n 1 25 VAL n 1 26 ILE n 1 27 CYS n 1 28 ILE n 1 29 PRO n 1 30 ASN n 1 31 ASN n 1 32 GLY n 1 33 GLN n 1 34 CYS n 1 35 PHE n 1 36 CYS n 1 37 LEU n 1 38 ALA n 1 39 TRP n 1 40 LEU n 1 41 LYS n 1 42 SER n 1 43 ASN n 1 44 GLY n 1 45 THR n 1 46 ASN n 1 47 ALA n 1 48 GLU n 1 49 LYS n 1 50 LEU n 1 51 ALA n 1 52 ALA n 1 53 ASN n 1 54 ILE n 1 55 LEU n 1 56 GLN n 1 57 TRP n 1 58 ILE n 1 59 SER n 1 60 PHE n 1 61 ALA n 1 62 LEU n 1 63 SER n 1 64 ALA n 1 65 LEU n 1 66 CYS n 1 67 LEU n 1 68 MET n 1 69 PHE n 1 70 TYR n 1 71 GLY n 1 72 TYR n 1 73 GLN n 1 74 THR n 1 75 TRP n 1 76 LYS n 1 77 SER n 1 78 THR n 1 79 CYS n 1 80 GLY n 1 81 TRP n 1 82 GLU n 1 83 ASN n 1 84 ILE n 1 85 TYR n 1 86 VAL n 1 87 ALA n 1 88 THR n 1 89 ILE n 1 90 GLN n 1 91 MET n 1 92 ILE n 1 93 LYS n 1 94 PHE n 1 95 ILE n 1 96 ILE n 1 97 GLU n 1 98 TYR n 1 99 PHE n 1 100 HIS n 1 101 SER n 1 102 PHE n 1 103 ASP n 1 104 GLU n 1 105 PRO n 1 106 ALA n 1 107 VAL n 1 108 ILE n 1 109 TYR n 1 110 SER n 1 111 SER n 1 112 ASN n 1 113 GLY n 1 114 ASN n 1 115 LYS n 1 116 THR n 1 117 ARG n 1 118 TRP n 1 119 LEU n 1 120 ARG n 1 121 TYR n 1 122 ALA n 1 123 SER n 1 124 TRP n 1 125 LEU n 1 126 LEU n 1 127 THR n 1 128 CYS n 1 129 PRO n 1 130 VAL n 1 131 ILE n 1 132 LEU n 1 133 ILE n 1 134 HIS n 1 135 LEU n 1 136 SER n 1 137 ASN n 1 138 LEU n 1 139 THR n 1 140 GLY n 1 141 LEU n 1 142 ALA n 1 143 ASN n 1 144 ASP n 1 145 TYR n 1 146 ASN n 1 147 LYS n 1 148 ARG n 1 149 THR n 1 150 MET n 1 151 GLY n 1 152 LEU n 1 153 LEU n 1 154 VAL n 1 155 SER n 1 156 ASP n 1 157 ILE n 1 158 GLY n 1 159 THR n 1 160 ILE n 1 161 VAL n 1 162 TRP n 1 163 GLY n 1 164 THR n 1 165 THR n 1 166 ALA n 1 167 ALA n 1 168 LEU n 1 169 SER n 1 170 LYS n 1 171 GLY n 1 172 TYR n 1 173 VAL n 1 174 ARG n 1 175 VAL n 1 176 ILE n 1 177 PHE n 1 178 PHE n 1 179 LEU n 1 180 MET n 1 181 GLY n 1 182 LEU n 1 183 CYS n 1 184 TYR n 1 185 GLY n 1 186 ILE n 1 187 TYR n 1 188 THR n 1 189 PHE n 1 190 PHE n 1 191 ASN n 1 192 ALA n 1 193 ALA n 1 194 LYS n 1 195 VAL n 1 196 TYR n 1 197 ILE n 1 198 GLU n 1 199 ALA n 1 200 TYR n 1 201 HIS n 1 202 THR n 1 203 VAL n 1 204 PRO n 1 205 LYS n 1 206 GLY n 1 207 ARG n 1 208 CYS n 1 209 ARG n 1 210 GLN n 1 211 VAL n 1 212 VAL n 1 213 THR n 1 214 GLY n 1 215 MET n 1 216 ALA n 1 217 TRP n 1 218 LEU n 1 219 PHE n 1 220 PHE n 1 221 VAL n 1 222 SER n 1 223 TRP n 1 224 GLY n 1 225 MET n 1 226 PHE n 1 227 PRO n 1 228 ILE n 1 229 LEU n 1 230 PHE n 1 231 ILE n 1 232 LEU n 1 233 GLY n 1 234 PRO n 1 235 GLU n 1 236 GLY n 1 237 PHE n 1 238 GLY n 1 239 VAL n 1 240 LEU n 1 241 SER n 1 242 ARG n 1 243 TYR n 1 244 GLY n 1 245 SER n 1 246 ASN n 1 247 VAL n 1 248 GLY n 1 249 HIS n 1 250 THR n 1 251 ILE n 1 252 ILE n 1 253 ASP n 1 254 LEU n 1 255 MET n 1 256 SER n 1 257 LYS n 1 258 GLN n 1 259 CYS n 1 260 TRP n 1 261 GLY n 1 262 LEU n 1 263 LEU n 1 264 GLY n 1 265 HIS n 1 266 TYR n 1 267 LEU n 1 268 ARG n 1 269 VAL n 1 270 LEU n 1 271 ILE n 1 272 HIS n 1 273 SER n 1 274 HIS n 1 275 ILE n 1 276 LEU n 1 277 ILE n 1 278 HIS n 1 279 GLY n 1 280 ASP n 1 281 ILE n 1 282 ARG n 1 283 LYS n 1 284 THR n 1 285 THR n 1 286 LYS n 1 287 LEU n 1 288 ASN n 1 289 ILE n 1 290 GLY n 1 291 GLY n 1 292 THR n 1 293 GLU n 1 294 ILE n 1 295 GLU n 1 296 VAL n 1 297 GLU n 1 298 THR n 1 299 LEU n 1 300 VAL n 1 301 GLU n 1 302 ASP n 1 303 GLU n 1 304 ALA n 1 305 GLU n 1 306 ALA n 1 307 GLY n 1 308 ALA n 1 309 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 294 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydomonas reinhardtii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6CSO _struct_ref.pdbx_db_accession 6CSO _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CSO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 294 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6CSO _struct_ref_seq.db_align_beg 40 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 333 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 40 _struct_ref_seq.pdbx_auth_seq_align_end 333 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OLA non-polymer . 'OLEIC ACID' ? 'C18 H34 O2' 282.461 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CSO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 350MME, 100 mM sodium phosphate pH 6.5, 200 mM sodium malonate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 63.960 _reflns.entry_id 6CSO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.200 _reflns.d_resolution_low 47.053 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6602 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.884 _reflns.pdbx_Rmerge_I_obs 0.518 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.270 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.330 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.551 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.978 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.200 3.390 ? 1.190 ? ? ? ? 1020 100.000 ? ? ? ? 3.313 ? ? ? ? ? ? ? ? 8.698 ? ? ? ? 3.527 ? ? 1 1 0.412 ? 3.390 3.630 ? 2.200 ? ? ? ? 1012 100.000 ? ? ? ? 1.712 ? ? ? ? ? ? ? ? 9.338 ? ? ? ? 1.813 ? ? 2 1 0.758 ? 3.630 3.920 ? 3.580 ? ? ? ? 912 100.000 ? ? ? ? 0.992 ? ? ? ? ? ? ? ? 9.206 ? ? ? ? 1.053 ? ? 3 1 0.823 ? 3.920 4.290 ? 6.070 ? ? ? ? 851 99.900 ? ? ? ? 0.522 ? ? ? ? ? ? ? ? 8.984 ? ? ? ? 0.554 ? ? 4 1 0.936 ? 4.290 4.800 ? 8.080 ? ? ? ? 772 100.000 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 9.043 ? ? ? ? 0.393 ? ? 5 1 0.938 ? 4.800 5.540 ? 7.540 ? ? ? ? 690 100.000 ? ? ? ? 0.343 ? ? ? ? ? ? ? ? 8.461 ? ? ? ? 0.366 ? ? 6 1 0.963 ? 5.540 6.780 ? 7.820 ? ? ? ? 587 99.800 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 7.961 ? ? ? ? 0.330 ? ? 7 1 0.945 ? 6.780 9.560 ? 15.210 ? ? ? ? 474 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 9.222 ? ? ? ? 0.151 ? ? 8 1 0.993 ? 9.560 47.053 ? 22.030 ? ? ? ? 284 98.300 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 8.535 ? ? ? ? 0.109 ? ? 9 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CSO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.200 _refine.ls_d_res_low 47.053 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6577 _refine.ls_number_reflns_R_free 325 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.77 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2234 _refine.ls_R_factor_R_free 0.2714 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2208 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3UG9 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.97 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2194 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2227 _refine_hist.d_res_high 3.200 _refine_hist.d_res_low 47.053 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2285 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.041 ? 3106 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.617 ? 1288 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.110 ? 351 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 377 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2003 4.0316 . . 157 3077 100.00 . . . 0.3076 . 0.2362 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0316 47.0583 . . 168 3175 100.00 . . . 0.2514 . 0.2123 . . . . . . . . . . # _struct.entry_id 6CSO _struct.title 'Crystal structure of the designed light-gated anion channel iC++ at pH6.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CSO _struct_keywords.text 'rhodopsin, channelrhodopsin, anion channel, optogenetics, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 37 ? LYS A 41 ? LEU A 76 LYS A 80 5 ? 5 HELX_P HELX_P2 AA2 THR A 45 ? GLY A 71 ? THR A 84 GLY A 110 1 ? 27 HELX_P HELX_P3 AA3 GLY A 80 ? SER A 101 ? GLY A 119 SER A 140 1 ? 22 HELX_P HELX_P4 AA4 ARG A 117 ? ASN A 137 ? ARG A 156 ASN A 176 1 ? 21 HELX_P HELX_P5 AA5 ASN A 146 ? SER A 169 ? ASN A 185 SER A 208 1 ? 24 HELX_P HELX_P6 AA6 GLY A 171 ? VAL A 203 ? GLY A 210 VAL A 242 1 ? 33 HELX_P HELX_P7 AA7 GLY A 206 ? GLY A 233 ? GLY A 245 GLY A 272 1 ? 28 HELX_P HELX_P8 AA8 SER A 241 ? HIS A 278 ? SER A 280 HIS A 317 1 ? 38 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 66 A CYS 66 3_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 73 A CYS 75 3_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale one ? A LYS 257 NZ ? ? ? 1_555 B RET . C15 ? ? A LYS 296 A RET 401 1_555 ? ? ? ? ? ? ? 1.455 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 104 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 143 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 105 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 144 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.95 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 18 ? GLU A 20 ? THR A 57 GLU A 59 AA1 2 VAL A 25 ? CYS A 27 ? VAL A 64 CYS A 66 AA2 1 ILE A 108 ? TYR A 109 ? ILE A 147 TYR A 148 AA2 2 LYS A 115 ? THR A 116 ? LYS A 154 THR A 155 AA3 1 ARG A 282 ? THR A 285 ? ARG A 321 THR A 324 AA3 2 VAL A 296 ? LEU A 299 ? VAL A 335 LEU A 338 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 20 ? N GLU A 59 O VAL A 25 ? O VAL A 64 AA2 1 2 N ILE A 108 ? N ILE A 147 O THR A 116 ? O THR A 155 AA3 1 2 N THR A 285 ? N THR A 324 O VAL A 296 ? O VAL A 335 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A RET 401 ? 9 'binding site for residue RET A 401' AC2 Software A OLA 402 ? 7 'binding site for residue OLA A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 TRP A 124 ? TRP A 163 . ? 1_555 ? 2 AC1 9 CYS A 128 ? CYS A 167 . ? 1_555 ? 3 AC1 9 THR A 159 ? THR A 198 . ? 1_555 ? 4 AC1 9 PHE A 178 ? PHE A 217 . ? 1_555 ? 5 AC1 9 GLY A 181 ? GLY A 220 . ? 1_555 ? 6 AC1 9 TRP A 223 ? TRP A 262 . ? 1_555 ? 7 AC1 9 PHE A 226 ? PHE A 265 . ? 1_555 ? 8 AC1 9 SER A 256 ? SER A 295 . ? 1_555 ? 9 AC1 9 LYS A 257 ? LYS A 296 . ? 1_555 ? 10 AC2 7 TRP A 81 ? TRP A 120 . ? 3_555 ? 11 AC2 7 LYS A 147 ? LYS A 186 . ? 1_555 ? 12 AC2 7 GLY A 151 ? GLY A 190 . ? 1_555 ? 13 AC2 7 VAL A 154 ? VAL A 193 . ? 1_555 ? 14 AC2 7 SER A 155 ? SER A 194 . ? 1_555 ? 15 AC2 7 TYR A 184 ? TYR A 223 . ? 1_555 ? 16 AC2 7 TYR A 187 ? TYR A 226 . ? 1_555 ? # _atom_sites.entry_id 6CSO _atom_sites.fract_transf_matrix[1][1] 0.016678 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007087 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011104 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 40 ? ? ? A . n A 1 2 ASP 2 41 ? ? ? A . n A 1 3 TYR 3 42 ? ? ? A . n A 1 4 GLY 4 43 ? ? ? A . n A 1 5 GLY 5 44 ? ? ? A . n A 1 6 ALA 6 45 ? ? ? A . n A 1 7 LEU 7 46 ? ? ? A . n A 1 8 SER 8 47 ? ? ? A . n A 1 9 ALA 9 48 ? ? ? A . n A 1 10 VAL 10 49 49 VAL VAL A . n A 1 11 GLY 11 50 50 GLY GLY A . n A 1 12 LEU 12 51 51 LEU LEU A . n A 1 13 PHE 13 52 52 PHE PHE A . n A 1 14 GLN 14 53 53 GLN GLN A . n A 1 15 THR 15 54 54 THR THR A . n A 1 16 SER 16 55 55 SER SER A . n A 1 17 TYR 17 56 56 TYR TYR A . n A 1 18 THR 18 57 57 THR THR A . n A 1 19 LEU 19 58 58 LEU LEU A . n A 1 20 GLU 20 59 59 GLU GLU A . n A 1 21 ASN 21 60 60 ASN ASN A . n A 1 22 GLN 22 61 61 GLN GLN A . n A 1 23 GLY 23 62 62 GLY GLY A . n A 1 24 SER 24 63 63 SER SER A . n A 1 25 VAL 25 64 64 VAL VAL A . n A 1 26 ILE 26 65 65 ILE ILE A . n A 1 27 CYS 27 66 66 CYS CYS A . n A 1 28 ILE 28 67 67 ILE ILE A . n A 1 29 PRO 29 68 68 PRO PRO A . n A 1 30 ASN 30 69 69 ASN ASN A . n A 1 31 ASN 31 70 70 ASN ASN A . n A 1 32 GLY 32 71 71 GLY GLY A . n A 1 33 GLN 33 72 72 GLN GLN A . n A 1 34 CYS 34 73 73 CYS CYS A . n A 1 35 PHE 35 74 74 PHE PHE A . n A 1 36 CYS 36 75 75 CYS CYS A . n A 1 37 LEU 37 76 76 LEU LEU A . n A 1 38 ALA 38 77 77 ALA ALA A . n A 1 39 TRP 39 78 78 TRP TRP A . n A 1 40 LEU 40 79 79 LEU LEU A . n A 1 41 LYS 41 80 80 LYS LYS A . n A 1 42 SER 42 81 81 SER SER A . n A 1 43 ASN 43 82 82 ASN ASN A . n A 1 44 GLY 44 83 83 GLY GLY A . n A 1 45 THR 45 84 84 THR THR A . n A 1 46 ASN 46 85 85 ASN ASN A . n A 1 47 ALA 47 86 86 ALA ALA A . n A 1 48 GLU 48 87 87 GLU GLU A . n A 1 49 LYS 49 88 88 LYS LYS A . n A 1 50 LEU 50 89 89 LEU LEU A . n A 1 51 ALA 51 90 90 ALA ALA A . n A 1 52 ALA 52 91 91 ALA ALA A . n A 1 53 ASN 53 92 92 ASN ASN A . n A 1 54 ILE 54 93 93 ILE ILE A . n A 1 55 LEU 55 94 94 LEU LEU A . n A 1 56 GLN 56 95 95 GLN GLN A . n A 1 57 TRP 57 96 96 TRP TRP A . n A 1 58 ILE 58 97 97 ILE ILE A . n A 1 59 SER 59 98 98 SER SER A . n A 1 60 PHE 60 99 99 PHE PHE A . n A 1 61 ALA 61 100 100 ALA ALA A . n A 1 62 LEU 62 101 101 LEU LEU A . n A 1 63 SER 63 102 102 SER SER A . n A 1 64 ALA 64 103 103 ALA ALA A . n A 1 65 LEU 65 104 104 LEU LEU A . n A 1 66 CYS 66 105 105 CYS CYS A . n A 1 67 LEU 67 106 106 LEU LEU A . n A 1 68 MET 68 107 107 MET MET A . n A 1 69 PHE 69 108 108 PHE PHE A . n A 1 70 TYR 70 109 109 TYR TYR A . n A 1 71 GLY 71 110 110 GLY GLY A . n A 1 72 TYR 72 111 ? ? ? A . n A 1 73 GLN 73 112 ? ? ? A . n A 1 74 THR 74 113 ? ? ? A . n A 1 75 TRP 75 114 ? ? ? A . n A 1 76 LYS 76 115 ? ? ? A . n A 1 77 SER 77 116 ? ? ? A . n A 1 78 THR 78 117 117 THR THR A . n A 1 79 CYS 79 118 118 CYS CYS A . n A 1 80 GLY 80 119 119 GLY GLY A . n A 1 81 TRP 81 120 120 TRP TRP A . n A 1 82 GLU 82 121 121 GLU GLU A . n A 1 83 ASN 83 122 122 ASN ASN A . n A 1 84 ILE 84 123 123 ILE ILE A . n A 1 85 TYR 85 124 124 TYR TYR A . n A 1 86 VAL 86 125 125 VAL VAL A . n A 1 87 ALA 87 126 126 ALA ALA A . n A 1 88 THR 88 127 127 THR THR A . n A 1 89 ILE 89 128 128 ILE ILE A . n A 1 90 GLN 90 129 129 GLN GLN A . n A 1 91 MET 91 130 130 MET MET A . n A 1 92 ILE 92 131 131 ILE ILE A . n A 1 93 LYS 93 132 132 LYS LYS A . n A 1 94 PHE 94 133 133 PHE PHE A . n A 1 95 ILE 95 134 134 ILE ILE A . n A 1 96 ILE 96 135 135 ILE ILE A . n A 1 97 GLU 97 136 136 GLU GLU A . n A 1 98 TYR 98 137 137 TYR TYR A . n A 1 99 PHE 99 138 138 PHE PHE A . n A 1 100 HIS 100 139 139 HIS HIS A . n A 1 101 SER 101 140 140 SER SER A . n A 1 102 PHE 102 141 141 PHE PHE A . n A 1 103 ASP 103 142 142 ASP ASP A . n A 1 104 GLU 104 143 143 GLU GLU A . n A 1 105 PRO 105 144 144 PRO PRO A . n A 1 106 ALA 106 145 145 ALA ALA A . n A 1 107 VAL 107 146 146 VAL VAL A . n A 1 108 ILE 108 147 147 ILE ILE A . n A 1 109 TYR 109 148 148 TYR TYR A . n A 1 110 SER 110 149 149 SER SER A . n A 1 111 SER 111 150 150 SER SER A . n A 1 112 ASN 112 151 151 ASN ASN A . n A 1 113 GLY 113 152 152 GLY GLY A . n A 1 114 ASN 114 153 153 ASN ASN A . n A 1 115 LYS 115 154 154 LYS LYS A . n A 1 116 THR 116 155 155 THR THR A . n A 1 117 ARG 117 156 156 ARG ARG A . n A 1 118 TRP 118 157 157 TRP TRP A . n A 1 119 LEU 119 158 158 LEU LEU A . n A 1 120 ARG 120 159 159 ARG ARG A . n A 1 121 TYR 121 160 160 TYR TYR A . n A 1 122 ALA 122 161 161 ALA ALA A . n A 1 123 SER 123 162 162 SER SER A . n A 1 124 TRP 124 163 163 TRP TRP A . n A 1 125 LEU 125 164 164 LEU LEU A . n A 1 126 LEU 126 165 165 LEU LEU A . n A 1 127 THR 127 166 166 THR THR A . n A 1 128 CYS 128 167 167 CYS CYS A . n A 1 129 PRO 129 168 168 PRO PRO A . n A 1 130 VAL 130 169 169 VAL VAL A . n A 1 131 ILE 131 170 170 ILE ILE A . n A 1 132 LEU 132 171 171 LEU LEU A . n A 1 133 ILE 133 172 172 ILE ILE A . n A 1 134 HIS 134 173 173 HIS HIS A . n A 1 135 LEU 135 174 174 LEU LEU A . n A 1 136 SER 136 175 175 SER SER A . n A 1 137 ASN 137 176 176 ASN ASN A . n A 1 138 LEU 138 177 177 LEU LEU A . n A 1 139 THR 139 178 178 THR THR A . n A 1 140 GLY 140 179 179 GLY GLY A . n A 1 141 LEU 141 180 180 LEU LEU A . n A 1 142 ALA 142 181 181 ALA ALA A . n A 1 143 ASN 143 182 182 ASN ASN A . n A 1 144 ASP 144 183 183 ASP ASP A . n A 1 145 TYR 145 184 184 TYR TYR A . n A 1 146 ASN 146 185 185 ASN ASN A . n A 1 147 LYS 147 186 186 LYS LYS A . n A 1 148 ARG 148 187 187 ARG ARG A . n A 1 149 THR 149 188 188 THR THR A . n A 1 150 MET 150 189 189 MET MET A . n A 1 151 GLY 151 190 190 GLY GLY A . n A 1 152 LEU 152 191 191 LEU LEU A . n A 1 153 LEU 153 192 192 LEU LEU A . n A 1 154 VAL 154 193 193 VAL VAL A . n A 1 155 SER 155 194 194 SER SER A . n A 1 156 ASP 156 195 195 ASP ASP A . n A 1 157 ILE 157 196 196 ILE ILE A . n A 1 158 GLY 158 197 197 GLY GLY A . n A 1 159 THR 159 198 198 THR THR A . n A 1 160 ILE 160 199 199 ILE ILE A . n A 1 161 VAL 161 200 200 VAL VAL A . n A 1 162 TRP 162 201 201 TRP TRP A . n A 1 163 GLY 163 202 202 GLY GLY A . n A 1 164 THR 164 203 203 THR THR A . n A 1 165 THR 165 204 204 THR THR A . n A 1 166 ALA 166 205 205 ALA ALA A . n A 1 167 ALA 167 206 206 ALA ALA A . n A 1 168 LEU 168 207 207 LEU LEU A . n A 1 169 SER 169 208 208 SER SER A . n A 1 170 LYS 170 209 209 LYS LYS A . n A 1 171 GLY 171 210 210 GLY GLY A . n A 1 172 TYR 172 211 211 TYR TYR A . n A 1 173 VAL 173 212 212 VAL VAL A . n A 1 174 ARG 174 213 213 ARG ARG A . n A 1 175 VAL 175 214 214 VAL VAL A . n A 1 176 ILE 176 215 215 ILE ILE A . n A 1 177 PHE 177 216 216 PHE PHE A . n A 1 178 PHE 178 217 217 PHE PHE A . n A 1 179 LEU 179 218 218 LEU LEU A . n A 1 180 MET 180 219 219 MET MET A . n A 1 181 GLY 181 220 220 GLY GLY A . n A 1 182 LEU 182 221 221 LEU LEU A . n A 1 183 CYS 183 222 222 CYS CYS A . n A 1 184 TYR 184 223 223 TYR TYR A . n A 1 185 GLY 185 224 224 GLY GLY A . n A 1 186 ILE 186 225 225 ILE ILE A . n A 1 187 TYR 187 226 226 TYR TYR A . n A 1 188 THR 188 227 227 THR THR A . n A 1 189 PHE 189 228 228 PHE PHE A . n A 1 190 PHE 190 229 229 PHE PHE A . n A 1 191 ASN 191 230 230 ASN ASN A . n A 1 192 ALA 192 231 231 ALA ALA A . n A 1 193 ALA 193 232 232 ALA ALA A . n A 1 194 LYS 194 233 233 LYS LYS A . n A 1 195 VAL 195 234 234 VAL VAL A . n A 1 196 TYR 196 235 235 TYR TYR A . n A 1 197 ILE 197 236 236 ILE ILE A . n A 1 198 GLU 198 237 237 GLU GLU A . n A 1 199 ALA 199 238 238 ALA ALA A . n A 1 200 TYR 200 239 239 TYR TYR A . n A 1 201 HIS 201 240 240 HIS HIS A . n A 1 202 THR 202 241 241 THR THR A . n A 1 203 VAL 203 242 242 VAL VAL A . n A 1 204 PRO 204 243 243 PRO PRO A . n A 1 205 LYS 205 244 244 LYS LYS A . n A 1 206 GLY 206 245 245 GLY GLY A . n A 1 207 ARG 207 246 246 ARG ARG A . n A 1 208 CYS 208 247 247 CYS CYS A . n A 1 209 ARG 209 248 248 ARG ARG A . n A 1 210 GLN 210 249 249 GLN GLN A . n A 1 211 VAL 211 250 250 VAL VAL A . n A 1 212 VAL 212 251 251 VAL VAL A . n A 1 213 THR 213 252 252 THR THR A . n A 1 214 GLY 214 253 253 GLY GLY A . n A 1 215 MET 215 254 254 MET MET A . n A 1 216 ALA 216 255 255 ALA ALA A . n A 1 217 TRP 217 256 256 TRP TRP A . n A 1 218 LEU 218 257 257 LEU LEU A . n A 1 219 PHE 219 258 258 PHE PHE A . n A 1 220 PHE 220 259 259 PHE PHE A . n A 1 221 VAL 221 260 260 VAL VAL A . n A 1 222 SER 222 261 261 SER SER A . n A 1 223 TRP 223 262 262 TRP TRP A . n A 1 224 GLY 224 263 263 GLY GLY A . n A 1 225 MET 225 264 264 MET MET A . n A 1 226 PHE 226 265 265 PHE PHE A . n A 1 227 PRO 227 266 266 PRO PRO A . n A 1 228 ILE 228 267 267 ILE ILE A . n A 1 229 LEU 229 268 268 LEU LEU A . n A 1 230 PHE 230 269 269 PHE PHE A . n A 1 231 ILE 231 270 270 ILE ILE A . n A 1 232 LEU 232 271 271 LEU LEU A . n A 1 233 GLY 233 272 272 GLY GLY A . n A 1 234 PRO 234 273 273 PRO PRO A . n A 1 235 GLU 235 274 274 GLU GLU A . n A 1 236 GLY 236 275 275 GLY GLY A . n A 1 237 PHE 237 276 276 PHE PHE A . n A 1 238 GLY 238 277 277 GLY GLY A . n A 1 239 VAL 239 278 278 VAL VAL A . n A 1 240 LEU 240 279 279 LEU LEU A . n A 1 241 SER 241 280 280 SER SER A . n A 1 242 ARG 242 281 281 ARG ARG A . n A 1 243 TYR 243 282 282 TYR TYR A . n A 1 244 GLY 244 283 283 GLY GLY A . n A 1 245 SER 245 284 284 SER SER A . n A 1 246 ASN 246 285 285 ASN ASN A . n A 1 247 VAL 247 286 286 VAL VAL A . n A 1 248 GLY 248 287 287 GLY GLY A . n A 1 249 HIS 249 288 288 HIS HIS A . n A 1 250 THR 250 289 289 THR THR A . n A 1 251 ILE 251 290 290 ILE ILE A . n A 1 252 ILE 252 291 291 ILE ILE A . n A 1 253 ASP 253 292 292 ASP ASP A . n A 1 254 LEU 254 293 293 LEU LEU A . n A 1 255 MET 255 294 294 MET MET A . n A 1 256 SER 256 295 295 SER SER A . n A 1 257 LYS 257 296 296 LYS LYS A . n A 1 258 GLN 258 297 297 GLN GLN A . n A 1 259 CYS 259 298 298 CYS CYS A . n A 1 260 TRP 260 299 299 TRP TRP A . n A 1 261 GLY 261 300 300 GLY GLY A . n A 1 262 LEU 262 301 301 LEU LEU A . n A 1 263 LEU 263 302 302 LEU LEU A . n A 1 264 GLY 264 303 303 GLY GLY A . n A 1 265 HIS 265 304 304 HIS HIS A . n A 1 266 TYR 266 305 305 TYR TYR A . n A 1 267 LEU 267 306 306 LEU LEU A . n A 1 268 ARG 268 307 307 ARG ARG A . n A 1 269 VAL 269 308 308 VAL VAL A . n A 1 270 LEU 270 309 309 LEU LEU A . n A 1 271 ILE 271 310 310 ILE ILE A . n A 1 272 HIS 272 311 311 HIS HIS A . n A 1 273 SER 273 312 312 SER SER A . n A 1 274 HIS 274 313 313 HIS HIS A . n A 1 275 ILE 275 314 314 ILE ILE A . n A 1 276 LEU 276 315 315 LEU LEU A . n A 1 277 ILE 277 316 316 ILE ILE A . n A 1 278 HIS 278 317 317 HIS HIS A . n A 1 279 GLY 279 318 318 GLY GLY A . n A 1 280 ASP 280 319 319 ASP ASP A . n A 1 281 ILE 281 320 320 ILE ILE A . n A 1 282 ARG 282 321 321 ARG ARG A . n A 1 283 LYS 283 322 322 LYS LYS A . n A 1 284 THR 284 323 323 THR THR A . n A 1 285 THR 285 324 324 THR THR A . n A 1 286 LYS 286 325 325 LYS LYS A . n A 1 287 LEU 287 326 326 LEU LEU A . n A 1 288 ASN 288 327 ? ? ? A . n A 1 289 ILE 289 328 ? ? ? A . n A 1 290 GLY 290 329 ? ? ? A . n A 1 291 GLY 291 330 ? ? ? A . n A 1 292 THR 292 331 ? ? ? A . n A 1 293 GLU 293 332 ? ? ? A . n A 1 294 ILE 294 333 333 ILE ILE A . n A 1 295 GLU 295 334 334 GLU GLU A . n A 1 296 VAL 296 335 335 VAL VAL A . n A 1 297 GLU 297 336 336 GLU GLU A . n A 1 298 THR 298 337 337 THR THR A . n A 1 299 LEU 299 338 338 LEU LEU A . n A 1 300 VAL 300 339 339 VAL VAL A . n A 1 301 GLU 301 340 340 GLU GLU A . n A 1 302 ASP 302 341 341 ASP ASP A . n A 1 303 GLU 303 342 342 GLU GLU A . n A 1 304 ALA 304 343 ? ? ? A . n A 1 305 GLU 305 344 ? ? ? A . n A 1 306 ALA 306 345 ? ? ? A . n A 1 307 GLY 307 346 ? ? ? A . n A 1 308 ALA 308 347 ? ? ? A . n A 1 309 VAL 309 348 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 401 401 RET RET A . C 3 OLA 1 402 501 OLA OLA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7270 ? 1 MORE -42 ? 1 'SSA (A^2)' 23200 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.0300000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-05 2 'Structure model' 1 1 2018-09-12 3 'Structure model' 1 2 2018-10-03 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -4.6859 -3.5512 18.6992 0.0892 0.3678 0.8374 0.0567 -0.0945 0.0490 0.1409 0.5067 1.5433 0.1919 -0.4049 -0.3813 -0.1065 0.0361 0.6151 -0.0710 -0.0503 0.2019 0.1777 0.4332 -0.0058 'X-RAY DIFFRACTION' 2 ? refined -22.1419 -32.0224 12.8472 0.2763 0.5803 0.8109 -0.0105 -0.1164 0.0666 0.0884 3.9728 2.3041 -0.3226 -0.0882 -1.3307 -0.5240 -0.0327 0.2139 0.6930 -0.0387 0.1934 -0.6976 0.0252 -0.3482 'X-RAY DIFFRACTION' 3 ? refined -16.4734 -36.5961 21.3535 0.4616 0.3700 0.5447 0.0143 0.0685 0.0379 0.3574 0.0031 0.0559 -0.0367 0.1504 -0.0074 -0.3615 -0.1875 0.5463 0.0663 0.3966 0.0588 0.2782 -0.0645 -0.0033 'X-RAY DIFFRACTION' 4 ? refined -0.6247 -38.1311 14.5998 0.2006 0.2095 0.1450 -0.0760 0.0332 -0.0492 1.8419 0.7164 2.0828 0.3972 0.3750 1.0554 -0.0479 0.2590 -0.4052 0.0661 0.1860 -0.0565 -0.0111 -0.0986 0.0151 'X-RAY DIFFRACTION' 5 ? refined -7.0350 -39.9888 4.2250 0.3174 0.2830 0.2034 -0.2090 0.0384 -0.0646 1.1591 1.6066 0.8673 -0.6681 -0.2996 0.4791 0.0957 -0.0601 0.1330 -0.5941 0.4431 -0.2022 0.4656 0.1096 0.4783 'X-RAY DIFFRACTION' 6 ? refined -12.6823 -52.5257 9.8123 0.5076 0.2576 0.4885 -0.1676 -0.0090 -0.0104 0.8526 0.4597 0.5394 0.0161 -0.0156 -0.4255 -0.6614 0.1258 -0.4942 0.1261 0.7112 -0.3619 -0.0306 0.1252 0.0953 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 49 through 84 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 85 through 109 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 110 through 139 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 140 through 241 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 242 through 280 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 281 through 342 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 139 ? ? -142.96 44.86 2 1 PHE A 141 ? ? -141.20 20.67 3 1 ASN A 176 ? ? -119.44 64.13 4 1 ALA A 181 ? ? 66.33 176.52 5 1 ASP A 183 ? ? -108.68 -96.18 6 1 TYR A 184 ? ? 61.57 -159.68 7 1 LYS A 296 ? ? -106.41 -62.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 49 ? CG1 ? A VAL 10 CG1 2 1 Y 1 A VAL 49 ? CG2 ? A VAL 10 CG2 3 1 Y 1 A LEU 51 ? CG ? A LEU 12 CG 4 1 Y 1 A LEU 51 ? CD1 ? A LEU 12 CD1 5 1 Y 1 A LEU 51 ? CD2 ? A LEU 12 CD2 6 1 Y 1 A LYS 80 ? CD ? A LYS 41 CD 7 1 Y 1 A LYS 80 ? CE ? A LYS 41 CE 8 1 Y 1 A LYS 80 ? NZ ? A LYS 41 NZ 9 1 Y 1 A THR 117 ? OG1 ? A THR 78 OG1 10 1 Y 1 A THR 117 ? CG2 ? A THR 78 CG2 11 1 Y 1 A CYS 118 ? SG ? A CYS 79 SG 12 1 Y 1 A TYR 211 ? CG ? A TYR 172 CG 13 1 Y 1 A TYR 211 ? CD1 ? A TYR 172 CD1 14 1 Y 1 A TYR 211 ? CD2 ? A TYR 172 CD2 15 1 Y 1 A TYR 211 ? CE1 ? A TYR 172 CE1 16 1 Y 1 A TYR 211 ? CE2 ? A TYR 172 CE2 17 1 Y 1 A TYR 211 ? CZ ? A TYR 172 CZ 18 1 Y 1 A TYR 211 ? OH ? A TYR 172 OH 19 1 Y 1 A LYS 244 ? CG ? A LYS 205 CG 20 1 Y 1 A LYS 244 ? CD ? A LYS 205 CD 21 1 Y 1 A LYS 244 ? CE ? A LYS 205 CE 22 1 Y 1 A LYS 244 ? NZ ? A LYS 205 NZ 23 1 Y 1 A ARG 246 ? NE ? A ARG 207 NE 24 1 Y 1 A ARG 246 ? CZ ? A ARG 207 CZ 25 1 Y 1 A ARG 246 ? NH1 ? A ARG 207 NH1 26 1 Y 1 A ARG 246 ? NH2 ? A ARG 207 NH2 27 1 Y 1 A LYS 322 ? CG ? A LYS 283 CG 28 1 Y 1 A LYS 322 ? CD ? A LYS 283 CD 29 1 Y 1 A LYS 322 ? CE ? A LYS 283 CE 30 1 Y 1 A LYS 322 ? NZ ? A LYS 283 NZ 31 1 Y 1 A LYS 325 ? CG ? A LYS 286 CG 32 1 Y 1 A LYS 325 ? CD ? A LYS 286 CD 33 1 Y 1 A LYS 325 ? CE ? A LYS 286 CE 34 1 Y 1 A LYS 325 ? NZ ? A LYS 286 NZ 35 1 Y 1 A ILE 333 ? CG1 ? A ILE 294 CG1 36 1 Y 1 A ILE 333 ? CG2 ? A ILE 294 CG2 37 1 Y 1 A ILE 333 ? CD1 ? A ILE 294 CD1 38 1 Y 1 A GLU 334 ? CG ? A GLU 295 CG 39 1 Y 1 A GLU 334 ? CD ? A GLU 295 CD 40 1 Y 1 A GLU 334 ? OE1 ? A GLU 295 OE1 41 1 Y 1 A GLU 334 ? OE2 ? A GLU 295 OE2 42 1 Y 1 A ASP 341 ? CG ? A ASP 302 CG 43 1 Y 1 A ASP 341 ? OD1 ? A ASP 302 OD1 44 1 Y 1 A ASP 341 ? OD2 ? A ASP 302 OD2 45 1 Y 1 A GLU 342 ? CG ? A GLU 303 CG 46 1 Y 1 A GLU 342 ? CD ? A GLU 303 CD 47 1 Y 1 A GLU 342 ? OE1 ? A GLU 303 OE1 48 1 Y 1 A GLU 342 ? OE2 ? A GLU 303 OE2 49 1 N 1 A OLA 402 ? C12 ? C OLA 1 C12 50 1 N 1 A OLA 402 ? C13 ? C OLA 1 C13 51 1 N 1 A OLA 402 ? C14 ? C OLA 1 C14 52 1 N 1 A OLA 402 ? C15 ? C OLA 1 C15 53 1 N 1 A OLA 402 ? C16 ? C OLA 1 C16 54 1 N 1 A OLA 402 ? C17 ? C OLA 1 C17 55 1 N 1 A OLA 402 ? C18 ? C OLA 1 C18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 40 ? A MET 1 2 1 Y 1 A ASP 41 ? A ASP 2 3 1 Y 1 A TYR 42 ? A TYR 3 4 1 Y 1 A GLY 43 ? A GLY 4 5 1 Y 1 A GLY 44 ? A GLY 5 6 1 Y 1 A ALA 45 ? A ALA 6 7 1 Y 1 A LEU 46 ? A LEU 7 8 1 Y 1 A SER 47 ? A SER 8 9 1 Y 1 A ALA 48 ? A ALA 9 10 1 Y 1 A TYR 111 ? A TYR 72 11 1 Y 1 A GLN 112 ? A GLN 73 12 1 Y 1 A THR 113 ? A THR 74 13 1 Y 1 A TRP 114 ? A TRP 75 14 1 Y 1 A LYS 115 ? A LYS 76 15 1 Y 1 A SER 116 ? A SER 77 16 1 Y 1 A ASN 327 ? A ASN 288 17 1 Y 1 A ILE 328 ? A ILE 289 18 1 Y 1 A GLY 329 ? A GLY 290 19 1 Y 1 A GLY 330 ? A GLY 291 20 1 Y 1 A THR 331 ? A THR 292 21 1 Y 1 A GLU 332 ? A GLU 293 22 1 Y 1 A ALA 343 ? A ALA 304 23 1 Y 1 A GLU 344 ? A GLU 305 24 1 Y 1 A ALA 345 ? A ALA 306 25 1 Y 1 A GLY 346 ? A GLY 307 26 1 Y 1 A ALA 347 ? A ALA 308 27 1 Y 1 A VAL 348 ? A VAL 309 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 OLA C1 C N N 247 OLA O1 O N N 248 OLA O2 O N N 249 OLA C2 C N N 250 OLA C3 C N N 251 OLA C4 C N N 252 OLA C5 C N N 253 OLA C6 C N N 254 OLA C7 C N N 255 OLA C8 C N N 256 OLA C9 C N N 257 OLA C10 C N N 258 OLA C11 C N N 259 OLA C12 C N N 260 OLA C13 C N N 261 OLA C14 C N N 262 OLA C15 C N N 263 OLA C16 C N N 264 OLA C17 C N N 265 OLA C18 C N N 266 OLA HO2 H N N 267 OLA H21 H N N 268 OLA H22 H N N 269 OLA H31 H N N 270 OLA H32 H N N 271 OLA H41 H N N 272 OLA H42 H N N 273 OLA H51 H N N 274 OLA H52 H N N 275 OLA H61 H N N 276 OLA H62 H N N 277 OLA H71 H N N 278 OLA H72 H N N 279 OLA H81 H N N 280 OLA H82 H N N 281 OLA H9 H N N 282 OLA H10 H N N 283 OLA H111 H N N 284 OLA H112 H N N 285 OLA H121 H N N 286 OLA H122 H N N 287 OLA H131 H N N 288 OLA H132 H N N 289 OLA H141 H N N 290 OLA H142 H N N 291 OLA H151 H N N 292 OLA H152 H N N 293 OLA H161 H N N 294 OLA H162 H N N 295 OLA H171 H N N 296 OLA H172 H N N 297 OLA H181 H N N 298 OLA H182 H N N 299 OLA H183 H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 RET C1 C N N 341 RET C2 C N N 342 RET C3 C N N 343 RET C4 C N N 344 RET C5 C N N 345 RET C6 C N N 346 RET C7 C N N 347 RET C8 C N N 348 RET C9 C N N 349 RET C10 C N N 350 RET C11 C N N 351 RET C12 C N N 352 RET C13 C N N 353 RET C14 C N N 354 RET C15 C N N 355 RET O1 O N N 356 RET C16 C N N 357 RET C17 C N N 358 RET C18 C N N 359 RET C19 C N N 360 RET C20 C N N 361 RET H21 H N N 362 RET H22 H N N 363 RET H31 H N N 364 RET H32 H N N 365 RET H41 H N N 366 RET H42 H N N 367 RET H7 H N N 368 RET H8 H N N 369 RET H10 H N N 370 RET H11 H N N 371 RET H12 H N N 372 RET H14 H N N 373 RET H15 H N N 374 RET H161 H N N 375 RET H162 H N N 376 RET H163 H N N 377 RET H171 H N N 378 RET H172 H N N 379 RET H173 H N N 380 RET H181 H N N 381 RET H182 H N N 382 RET H183 H N N 383 RET H191 H N N 384 RET H192 H N N 385 RET H193 H N N 386 RET H201 H N N 387 RET H202 H N N 388 RET H203 H N N 389 SER N N N N 390 SER CA C N S 391 SER C C N N 392 SER O O N N 393 SER CB C N N 394 SER OG O N N 395 SER OXT O N N 396 SER H H N N 397 SER H2 H N N 398 SER HA H N N 399 SER HB2 H N N 400 SER HB3 H N N 401 SER HG H N N 402 SER HXT H N N 403 THR N N N N 404 THR CA C N S 405 THR C C N N 406 THR O O N N 407 THR CB C N R 408 THR OG1 O N N 409 THR CG2 C N N 410 THR OXT O N N 411 THR H H N N 412 THR H2 H N N 413 THR HA H N N 414 THR HB H N N 415 THR HG1 H N N 416 THR HG21 H N N 417 THR HG22 H N N 418 THR HG23 H N N 419 THR HXT H N N 420 TRP N N N N 421 TRP CA C N S 422 TRP C C N N 423 TRP O O N N 424 TRP CB C N N 425 TRP CG C Y N 426 TRP CD1 C Y N 427 TRP CD2 C Y N 428 TRP NE1 N Y N 429 TRP CE2 C Y N 430 TRP CE3 C Y N 431 TRP CZ2 C Y N 432 TRP CZ3 C Y N 433 TRP CH2 C Y N 434 TRP OXT O N N 435 TRP H H N N 436 TRP H2 H N N 437 TRP HA H N N 438 TRP HB2 H N N 439 TRP HB3 H N N 440 TRP HD1 H N N 441 TRP HE1 H N N 442 TRP HE3 H N N 443 TRP HZ2 H N N 444 TRP HZ3 H N N 445 TRP HH2 H N N 446 TRP HXT H N N 447 TYR N N N N 448 TYR CA C N S 449 TYR C C N N 450 TYR O O N N 451 TYR CB C N N 452 TYR CG C Y N 453 TYR CD1 C Y N 454 TYR CD2 C Y N 455 TYR CE1 C Y N 456 TYR CE2 C Y N 457 TYR CZ C Y N 458 TYR OH O N N 459 TYR OXT O N N 460 TYR H H N N 461 TYR H2 H N N 462 TYR HA H N N 463 TYR HB2 H N N 464 TYR HB3 H N N 465 TYR HD1 H N N 466 TYR HD2 H N N 467 TYR HE1 H N N 468 TYR HE2 H N N 469 TYR HH H N N 470 TYR HXT H N N 471 VAL N N N N 472 VAL CA C N S 473 VAL C C N N 474 VAL O O N N 475 VAL CB C N N 476 VAL CG1 C N N 477 VAL CG2 C N N 478 VAL OXT O N N 479 VAL H H N N 480 VAL H2 H N N 481 VAL HA H N N 482 VAL HB H N N 483 VAL HG11 H N N 484 VAL HG12 H N N 485 VAL HG13 H N N 486 VAL HG21 H N N 487 VAL HG22 H N N 488 VAL HG23 H N N 489 VAL HXT H N N 490 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 OLA C1 O1 doub N N 235 OLA C1 O2 sing N N 236 OLA C1 C2 sing N N 237 OLA O2 HO2 sing N N 238 OLA C2 C3 sing N N 239 OLA C2 H21 sing N N 240 OLA C2 H22 sing N N 241 OLA C3 C4 sing N N 242 OLA C3 H31 sing N N 243 OLA C3 H32 sing N N 244 OLA C4 C5 sing N N 245 OLA C4 H41 sing N N 246 OLA C4 H42 sing N N 247 OLA C5 C6 sing N N 248 OLA C5 H51 sing N N 249 OLA C5 H52 sing N N 250 OLA C6 C7 sing N N 251 OLA C6 H61 sing N N 252 OLA C6 H62 sing N N 253 OLA C7 C8 sing N N 254 OLA C7 H71 sing N N 255 OLA C7 H72 sing N N 256 OLA C8 C9 sing N N 257 OLA C8 H81 sing N N 258 OLA C8 H82 sing N N 259 OLA C9 C10 doub N Z 260 OLA C9 H9 sing N N 261 OLA C10 C11 sing N N 262 OLA C10 H10 sing N N 263 OLA C11 C12 sing N N 264 OLA C11 H111 sing N N 265 OLA C11 H112 sing N N 266 OLA C12 C13 sing N N 267 OLA C12 H121 sing N N 268 OLA C12 H122 sing N N 269 OLA C13 C14 sing N N 270 OLA C13 H131 sing N N 271 OLA C13 H132 sing N N 272 OLA C14 C15 sing N N 273 OLA C14 H141 sing N N 274 OLA C14 H142 sing N N 275 OLA C15 C16 sing N N 276 OLA C15 H151 sing N N 277 OLA C15 H152 sing N N 278 OLA C16 C17 sing N N 279 OLA C16 H161 sing N N 280 OLA C16 H162 sing N N 281 OLA C17 C18 sing N N 282 OLA C17 H171 sing N N 283 OLA C17 H172 sing N N 284 OLA C18 H181 sing N N 285 OLA C18 H182 sing N N 286 OLA C18 H183 sing N N 287 PHE N CA sing N N 288 PHE N H sing N N 289 PHE N H2 sing N N 290 PHE CA C sing N N 291 PHE CA CB sing N N 292 PHE CA HA sing N N 293 PHE C O doub N N 294 PHE C OXT sing N N 295 PHE CB CG sing N N 296 PHE CB HB2 sing N N 297 PHE CB HB3 sing N N 298 PHE CG CD1 doub Y N 299 PHE CG CD2 sing Y N 300 PHE CD1 CE1 sing Y N 301 PHE CD1 HD1 sing N N 302 PHE CD2 CE2 doub Y N 303 PHE CD2 HD2 sing N N 304 PHE CE1 CZ doub Y N 305 PHE CE1 HE1 sing N N 306 PHE CE2 CZ sing Y N 307 PHE CE2 HE2 sing N N 308 PHE CZ HZ sing N N 309 PHE OXT HXT sing N N 310 PRO N CA sing N N 311 PRO N CD sing N N 312 PRO N H sing N N 313 PRO CA C sing N N 314 PRO CA CB sing N N 315 PRO CA HA sing N N 316 PRO C O doub N N 317 PRO C OXT sing N N 318 PRO CB CG sing N N 319 PRO CB HB2 sing N N 320 PRO CB HB3 sing N N 321 PRO CG CD sing N N 322 PRO CG HG2 sing N N 323 PRO CG HG3 sing N N 324 PRO CD HD2 sing N N 325 PRO CD HD3 sing N N 326 PRO OXT HXT sing N N 327 RET C1 C2 sing N N 328 RET C1 C6 sing N N 329 RET C1 C16 sing N N 330 RET C1 C17 sing N N 331 RET C2 C3 sing N N 332 RET C2 H21 sing N N 333 RET C2 H22 sing N N 334 RET C3 C4 sing N N 335 RET C3 H31 sing N N 336 RET C3 H32 sing N N 337 RET C4 C5 sing N N 338 RET C4 H41 sing N N 339 RET C4 H42 sing N N 340 RET C5 C6 doub N N 341 RET C5 C18 sing N N 342 RET C6 C7 sing N N 343 RET C7 C8 doub N E 344 RET C7 H7 sing N N 345 RET C8 C9 sing N N 346 RET C8 H8 sing N N 347 RET C9 C10 doub N E 348 RET C9 C19 sing N N 349 RET C10 C11 sing N N 350 RET C10 H10 sing N N 351 RET C11 C12 doub N E 352 RET C11 H11 sing N N 353 RET C12 C13 sing N N 354 RET C12 H12 sing N N 355 RET C13 C14 doub N E 356 RET C13 C20 sing N N 357 RET C14 C15 sing N N 358 RET C14 H14 sing N N 359 RET C15 O1 doub N N 360 RET C15 H15 sing N N 361 RET C16 H161 sing N N 362 RET C16 H162 sing N N 363 RET C16 H163 sing N N 364 RET C17 H171 sing N N 365 RET C17 H172 sing N N 366 RET C17 H173 sing N N 367 RET C18 H181 sing N N 368 RET C18 H182 sing N N 369 RET C18 H183 sing N N 370 RET C19 H191 sing N N 371 RET C19 H192 sing N N 372 RET C19 H193 sing N N 373 RET C20 H201 sing N N 374 RET C20 H202 sing N N 375 RET C20 H203 sing N N 376 SER N CA sing N N 377 SER N H sing N N 378 SER N H2 sing N N 379 SER CA C sing N N 380 SER CA CB sing N N 381 SER CA HA sing N N 382 SER C O doub N N 383 SER C OXT sing N N 384 SER CB OG sing N N 385 SER CB HB2 sing N N 386 SER CB HB3 sing N N 387 SER OG HG sing N N 388 SER OXT HXT sing N N 389 THR N CA sing N N 390 THR N H sing N N 391 THR N H2 sing N N 392 THR CA C sing N N 393 THR CA CB sing N N 394 THR CA HA sing N N 395 THR C O doub N N 396 THR C OXT sing N N 397 THR CB OG1 sing N N 398 THR CB CG2 sing N N 399 THR CB HB sing N N 400 THR OG1 HG1 sing N N 401 THR CG2 HG21 sing N N 402 THR CG2 HG22 sing N N 403 THR CG2 HG23 sing N N 404 THR OXT HXT sing N N 405 TRP N CA sing N N 406 TRP N H sing N N 407 TRP N H2 sing N N 408 TRP CA C sing N N 409 TRP CA CB sing N N 410 TRP CA HA sing N N 411 TRP C O doub N N 412 TRP C OXT sing N N 413 TRP CB CG sing N N 414 TRP CB HB2 sing N N 415 TRP CB HB3 sing N N 416 TRP CG CD1 doub Y N 417 TRP CG CD2 sing Y N 418 TRP CD1 NE1 sing Y N 419 TRP CD1 HD1 sing N N 420 TRP CD2 CE2 doub Y N 421 TRP CD2 CE3 sing Y N 422 TRP NE1 CE2 sing Y N 423 TRP NE1 HE1 sing N N 424 TRP CE2 CZ2 sing Y N 425 TRP CE3 CZ3 doub Y N 426 TRP CE3 HE3 sing N N 427 TRP CZ2 CH2 doub Y N 428 TRP CZ2 HZ2 sing N N 429 TRP CZ3 CH2 sing Y N 430 TRP CZ3 HZ3 sing N N 431 TRP CH2 HH2 sing N N 432 TRP OXT HXT sing N N 433 TYR N CA sing N N 434 TYR N H sing N N 435 TYR N H2 sing N N 436 TYR CA C sing N N 437 TYR CA CB sing N N 438 TYR CA HA sing N N 439 TYR C O doub N N 440 TYR C OXT sing N N 441 TYR CB CG sing N N 442 TYR CB HB2 sing N N 443 TYR CB HB3 sing N N 444 TYR CG CD1 doub Y N 445 TYR CG CD2 sing Y N 446 TYR CD1 CE1 sing Y N 447 TYR CD1 HD1 sing N N 448 TYR CD2 CE2 doub Y N 449 TYR CD2 HD2 sing N N 450 TYR CE1 CZ doub Y N 451 TYR CE1 HE1 sing N N 452 TYR CE2 CZ sing Y N 453 TYR CE2 HE2 sing N N 454 TYR CZ OH sing N N 455 TYR OH HH sing N N 456 TYR OXT HXT sing N N 457 VAL N CA sing N N 458 VAL N H sing N N 459 VAL N H2 sing N N 460 VAL CA C sing N N 461 VAL CA CB sing N N 462 VAL CA HA sing N N 463 VAL C O doub N N 464 VAL C OXT sing N N 465 VAL CB CG1 sing N N 466 VAL CB CG2 sing N N 467 VAL CB HB sing N N 468 VAL CG1 HG11 sing N N 469 VAL CG1 HG12 sing N N 470 VAL CG1 HG13 sing N N 471 VAL CG2 HG21 sing N N 472 VAL CG2 HG22 sing N N 473 VAL CG2 HG23 sing N N 474 VAL OXT HXT sing N N 475 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Science and Technology' Japan JPMJPR1782 1 'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' R01MH075957 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 'OLEIC ACID' OLA # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3UG9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #