data_6CVH # _entry.id 6CVH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.293 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6CVH WWPDB D_1000233576 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CVH _pdbx_database_status.recvd_initial_deposition_date 2018-03-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Spurlino, J.' 1 ? 'Milligan, C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bioorg. Med. Chem. Lett.' _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 1446 _citation.page_last 1455 _citation.title 'Identification and biological evaluation of thiazole-based inverse agonists of ROR gamma t.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2018.03.093 _citation.pdbx_database_id_PubMed 29631962 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gege, C.' 1 primary 'Cummings, M.D.' 2 primary 'Albers, M.' 3 primary 'Kinzel, O.' 4 primary 'Kleymann, G.' 5 primary 'Schluter, T.' 6 primary 'Steeneck, C.' 7 primary 'Nelen, M.I.' 8 primary 'Milligan, C.' 9 primary 'Spurlino, J.' 10 primary 'Xue, X.' 11 primary 'Leonard, K.' 12 primary 'Edwards, J.P.' 13 primary 'Fourie, A.' 14 primary 'Goldberg, S.D.' 15 primary 'Hoffmann, T.' 16 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6CVH _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.378 _cell.length_a_esd ? _cell.length_b 92.378 _cell.length_b_esd ? _cell.length_c 141.898 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CVH _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor ROR-gamma' 26435.604 1 ? ? ? ? 2 non-polymer syn ;trans-3-({4-(cyclohexylmethyl)-5-[3-(1-methylcyclopropyl)-5-{[(2R)-1,1,1-trifluoropropan-2-yl]carbamoyl}phenyl]-1,3-thiazole-2-carbonyl}amino)cyclobutane-1-carboxylic acid ; 591.685 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Nuclear receptor RZR-gamma,Nuclear receptor subfamily 1 group F member 3,RAR-related orphan receptor C,Retinoid-related orphan receptor-gamma ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMEL CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLPA ; _entity_poly.pdbx_seq_one_letter_code_can ;ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMEL CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 LEU n 1 4 THR n 1 5 GLU n 1 6 ILE n 1 7 GLU n 1 8 HIS n 1 9 LEU n 1 10 VAL n 1 11 GLN n 1 12 SER n 1 13 VAL n 1 14 CYS n 1 15 LYS n 1 16 SER n 1 17 TYR n 1 18 ARG n 1 19 GLU n 1 20 THR n 1 21 CYS n 1 22 GLN n 1 23 LEU n 1 24 ARG n 1 25 LEU n 1 26 GLU n 1 27 ASP n 1 28 LEU n 1 29 LEU n 1 30 ARG n 1 31 GLN n 1 32 ARG n 1 33 SER n 1 34 ASN n 1 35 ILE n 1 36 PHE n 1 37 SER n 1 38 ARG n 1 39 GLU n 1 40 GLU n 1 41 VAL n 1 42 THR n 1 43 GLY n 1 44 TYR n 1 45 GLN n 1 46 ARG n 1 47 LYS n 1 48 SER n 1 49 MET n 1 50 TRP n 1 51 GLU n 1 52 MET n 1 53 TRP n 1 54 GLU n 1 55 ARG n 1 56 CYS n 1 57 ALA n 1 58 HIS n 1 59 HIS n 1 60 LEU n 1 61 THR n 1 62 GLU n 1 63 ALA n 1 64 ILE n 1 65 GLN n 1 66 TYR n 1 67 VAL n 1 68 VAL n 1 69 GLU n 1 70 PHE n 1 71 ALA n 1 72 LYS n 1 73 ARG n 1 74 LEU n 1 75 SER n 1 76 GLY n 1 77 PHE n 1 78 MET n 1 79 GLU n 1 80 LEU n 1 81 CYS n 1 82 GLN n 1 83 ASN n 1 84 ASP n 1 85 GLN n 1 86 ILE n 1 87 VAL n 1 88 LEU n 1 89 LEU n 1 90 LYS n 1 91 ALA n 1 92 GLY n 1 93 ALA n 1 94 MET n 1 95 GLU n 1 96 VAL n 1 97 VAL n 1 98 LEU n 1 99 VAL n 1 100 ARG n 1 101 MET n 1 102 CYS n 1 103 ARG n 1 104 ALA n 1 105 TYR n 1 106 ASN n 1 107 ALA n 1 108 ASP n 1 109 ASN n 1 110 ARG n 1 111 THR n 1 112 VAL n 1 113 PHE n 1 114 PHE n 1 115 GLU n 1 116 GLY n 1 117 LYS n 1 118 TYR n 1 119 GLY n 1 120 GLY n 1 121 MET n 1 122 GLU n 1 123 LEU n 1 124 PHE n 1 125 ARG n 1 126 ALA n 1 127 LEU n 1 128 GLY n 1 129 CYS n 1 130 SER n 1 131 GLU n 1 132 LEU n 1 133 ILE n 1 134 SER n 1 135 SER n 1 136 ILE n 1 137 PHE n 1 138 ASP n 1 139 PHE n 1 140 SER n 1 141 HIS n 1 142 SER n 1 143 LEU n 1 144 SER n 1 145 ALA n 1 146 LEU n 1 147 HIS n 1 148 PHE n 1 149 SER n 1 150 GLU n 1 151 ASP n 1 152 GLU n 1 153 ILE n 1 154 ALA n 1 155 LEU n 1 156 TYR n 1 157 THR n 1 158 ALA n 1 159 LEU n 1 160 VAL n 1 161 LEU n 1 162 ILE n 1 163 ASN n 1 164 ALA n 1 165 HIS n 1 166 ARG n 1 167 PRO n 1 168 GLY n 1 169 LEU n 1 170 GLN n 1 171 GLU n 1 172 LYS n 1 173 ARG n 1 174 LYS n 1 175 VAL n 1 176 GLU n 1 177 GLN n 1 178 LEU n 1 179 GLN n 1 180 TYR n 1 181 ASN n 1 182 LEU n 1 183 GLU n 1 184 LEU n 1 185 ALA n 1 186 PHE n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 LEU n 1 191 CYS n 1 192 LYS n 1 193 THR n 1 194 HIS n 1 195 ARG n 1 196 GLN n 1 197 SER n 1 198 ILE n 1 199 LEU n 1 200 ALA n 1 201 LYS n 1 202 LEU n 1 203 PRO n 1 204 PRO n 1 205 LYS n 1 206 GLY n 1 207 LYS n 1 208 LEU n 1 209 ARG n 1 210 SER n 1 211 LEU n 1 212 CYS n 1 213 SER n 1 214 GLN n 1 215 HIS n 1 216 VAL n 1 217 GLU n 1 218 ARG n 1 219 LEU n 1 220 GLN n 1 221 ILE n 1 222 PHE n 1 223 GLN n 1 224 HIS n 1 225 LEU n 1 226 PRO n 1 227 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 227 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RORC, NR1F3, RORG, RZRG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RORG_HUMAN _struct_ref.pdbx_db_accession P51449 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMEL CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHL ; _struct_ref.pdbx_align_begin 265 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CVH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 225 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51449 _struct_ref_seq.db_align_beg 265 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 489 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 265 _struct_ref_seq.pdbx_auth_seq_align_end 489 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CVH PRO A 226 ? UNP P51449 ? ? 'expression tag' 490 1 1 6CVH ALA A 227 ? UNP P51449 ? ? 'expression tag' 491 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FJG non-polymer . ;trans-3-({4-(cyclohexylmethyl)-5-[3-(1-methylcyclopropyl)-5-{[(2R)-1,1,1-trifluoropropan-2-yl]carbamoyl}phenyl]-1,3-thiazole-2-carbonyl}amino)cyclobutane-1-carboxylic acid ; ? 'C30 H36 F3 N3 O4 S' 591.685 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CVH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.35M NaFormate, 0.1M Hepes pH7, 3%MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CVH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.5 _reflns.d_resolution_low 40.001 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4898 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.5 _reflns_shell.d_res_low 3.56 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 170.940 _refine.B_iso_mean 86.9507 _refine.B_iso_min 48.850 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CVH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.5000 _refine.ls_d_res_low 40.0010 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4875 _refine.ls_number_reflns_R_free 486 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2500 _refine.ls_percent_reflns_R_free 9.9700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2649 _refine.ls_R_factor_R_free 0.3096 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2598 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.1400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.5000 _refine_hist.d_res_low 40.0010 _refine_hist.pdbx_number_atoms_ligand 76 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1928 _refine_hist.pdbx_number_residues_total 227 _refine_hist.pdbx_B_iso_mean_ligand 74.03 _refine_hist.pdbx_number_atoms_protein 1852 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1934 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.428 ? 2609 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.029 ? 284 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 330 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.959 ? 1170 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.5000 4.0060 1554 . 155 1399 98.0000 . . . 0.3609 0.0000 0.3069 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 4.0060 5.0456 1592 . 158 1434 100.0000 . . . 0.3395 0.0000 0.2560 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 5.0456 40.0034 1729 . 173 1556 100.0000 . . . 0.2683 0.0000 0.2427 . . . . . . 3 . . . # _struct.entry_id 6CVH _struct.title 'Identification and biological evaluation of thiazole-based inverse agonists of RORgt' _struct.pdbx_descriptor 'Nuclear receptor ROR-gamma' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CVH _struct_keywords.text 'Nuclear Receptor RORgt, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? THR A 20 ? SER A 266 THR A 284 1 ? 19 HELX_P HELX_P2 AA2 ARG A 24 ? GLN A 31 ? ARG A 288 GLN A 295 1 ? 8 HELX_P HELX_P3 AA3 ARG A 32 ? ASN A 34 ? ARG A 296 ASN A 298 5 ? 3 HELX_P HELX_P4 AA4 SER A 37 ? LYS A 47 ? SER A 301 LYS A 311 1 ? 11 HELX_P HELX_P5 AA5 SER A 48 ? LYS A 72 ? SER A 312 LYS A 336 1 ? 25 HELX_P HELX_P6 AA6 CYS A 81 ? ARG A 103 ? CYS A 345 ARG A 367 1 ? 23 HELX_P HELX_P7 AA7 MET A 121 ? ARG A 125 ? MET A 385 ARG A 389 5 ? 5 HELX_P HELX_P8 AA8 CYS A 129 ? LEU A 146 ? CYS A 393 LEU A 410 1 ? 18 HELX_P HELX_P9 AA9 SER A 149 ? ILE A 162 ? SER A 413 ILE A 426 1 ? 14 HELX_P HELX_P10 AB1 GLU A 171 ? THR A 193 ? GLU A 435 THR A 457 1 ? 23 HELX_P HELX_P11 AB2 HIS A 194 ? LYS A 201 ? HIS A 458 LYS A 465 5 ? 8 HELX_P HELX_P12 AB3 GLY A 206 ? GLN A 223 ? GLY A 470 GLN A 487 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 205 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 469 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 206 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 470 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.52 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 105 ? ASN A 106 ? TYR A 369 ASN A 370 AA1 2 THR A 111 ? PHE A 113 ? THR A 375 PHE A 377 AA1 3 TYR A 118 ? GLY A 119 ? TYR A 382 GLY A 383 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 106 ? N ASN A 370 O THR A 111 ? O THR A 375 AA1 2 3 N VAL A 112 ? N VAL A 376 O GLY A 119 ? O GLY A 383 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FJG _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue FJG A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 GLN A 22 ? GLN A 286 . ? 1_555 ? 2 AC1 13 HIS A 59 ? HIS A 323 . ? 1_555 ? 3 AC1 13 LEU A 60 ? LEU A 324 . ? 1_555 ? 4 AC1 13 ALA A 63 ? ALA A 327 . ? 1_555 ? 5 AC1 13 MET A 94 ? MET A 358 . ? 1_555 ? 6 AC1 13 VAL A 97 ? VAL A 361 . ? 1_555 ? 7 AC1 13 LEU A 98 ? LEU A 362 . ? 1_555 ? 8 AC1 13 PHE A 113 ? PHE A 377 . ? 1_555 ? 9 AC1 13 GLU A 115 ? GLU A 379 . ? 1_555 ? 10 AC1 13 GLY A 116 ? GLY A 380 . ? 1_555 ? 11 AC1 13 PHE A 124 ? PHE A 388 . ? 1_555 ? 12 AC1 13 HIS A 215 ? HIS A 479 . ? 1_555 ? 13 AC1 13 LEU A 219 ? LEU A 483 . ? 1_555 ? # _atom_sites.entry_id 6CVH _atom_sites.fract_transf_matrix[1][1] 0.010825 _atom_sites.fract_transf_matrix[1][2] 0.006250 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012500 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007047 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 265 265 ALA ALA A . n A 1 2 SER 2 266 266 SER SER A . n A 1 3 LEU 3 267 267 LEU LEU A . n A 1 4 THR 4 268 268 THR THR A . n A 1 5 GLU 5 269 269 GLU GLU A . n A 1 6 ILE 6 270 270 ILE ILE A . n A 1 7 GLU 7 271 271 GLU GLU A . n A 1 8 HIS 8 272 272 HIS HIS A . n A 1 9 LEU 9 273 273 LEU LEU A . n A 1 10 VAL 10 274 274 VAL VAL A . n A 1 11 GLN 11 275 275 GLN GLN A . n A 1 12 SER 12 276 276 SER SER A . n A 1 13 VAL 13 277 277 VAL VAL A . n A 1 14 CYS 14 278 278 CYS CYS A . n A 1 15 LYS 15 279 279 LYS LYS A . n A 1 16 SER 16 280 280 SER SER A . n A 1 17 TYR 17 281 281 TYR TYR A . n A 1 18 ARG 18 282 282 ARG ARG A . n A 1 19 GLU 19 283 283 GLU GLU A . n A 1 20 THR 20 284 284 THR THR A . n A 1 21 CYS 21 285 285 CYS CYS A . n A 1 22 GLN 22 286 286 GLN GLN A . n A 1 23 LEU 23 287 287 LEU LEU A . n A 1 24 ARG 24 288 288 ARG ARG A . n A 1 25 LEU 25 289 289 LEU LEU A . n A 1 26 GLU 26 290 290 GLU GLU A . n A 1 27 ASP 27 291 291 ASP ASP A . n A 1 28 LEU 28 292 292 LEU LEU A . n A 1 29 LEU 29 293 293 LEU LEU A . n A 1 30 ARG 30 294 294 ARG ARG A . n A 1 31 GLN 31 295 295 GLN GLN A . n A 1 32 ARG 32 296 296 ARG ARG A . n A 1 33 SER 33 297 297 SER SER A . n A 1 34 ASN 34 298 298 ASN ASN A . n A 1 35 ILE 35 299 299 ILE ILE A . n A 1 36 PHE 36 300 300 PHE PHE A . n A 1 37 SER 37 301 301 SER SER A . n A 1 38 ARG 38 302 302 ARG ARG A . n A 1 39 GLU 39 303 303 GLU GLU A . n A 1 40 GLU 40 304 304 GLU GLU A . n A 1 41 VAL 41 305 305 VAL VAL A . n A 1 42 THR 42 306 306 THR THR A . n A 1 43 GLY 43 307 307 GLY GLY A . n A 1 44 TYR 44 308 308 TYR TYR A . n A 1 45 GLN 45 309 309 GLN GLN A . n A 1 46 ARG 46 310 310 ARG ARG A . n A 1 47 LYS 47 311 311 LYS LYS A . n A 1 48 SER 48 312 312 SER SER A . n A 1 49 MET 49 313 313 MET MET A . n A 1 50 TRP 50 314 314 TRP TRP A . n A 1 51 GLU 51 315 315 GLU GLU A . n A 1 52 MET 52 316 316 MET MET A . n A 1 53 TRP 53 317 317 TRP TRP A . n A 1 54 GLU 54 318 318 GLU GLU A . n A 1 55 ARG 55 319 319 ARG ARG A . n A 1 56 CYS 56 320 320 CYS CYS A . n A 1 57 ALA 57 321 321 ALA ALA A . n A 1 58 HIS 58 322 322 HIS HIS A . n A 1 59 HIS 59 323 323 HIS HIS A . n A 1 60 LEU 60 324 324 LEU LEU A . n A 1 61 THR 61 325 325 THR THR A . n A 1 62 GLU 62 326 326 GLU GLU A . n A 1 63 ALA 63 327 327 ALA ALA A . n A 1 64 ILE 64 328 328 ILE ILE A . n A 1 65 GLN 65 329 329 GLN GLN A . n A 1 66 TYR 66 330 330 TYR TYR A . n A 1 67 VAL 67 331 331 VAL VAL A . n A 1 68 VAL 68 332 332 VAL VAL A . n A 1 69 GLU 69 333 333 GLU GLU A . n A 1 70 PHE 70 334 334 PHE PHE A . n A 1 71 ALA 71 335 335 ALA ALA A . n A 1 72 LYS 72 336 336 LYS LYS A . n A 1 73 ARG 73 337 337 ARG ARG A . n A 1 74 LEU 74 338 338 LEU LEU A . n A 1 75 SER 75 339 339 SER SER A . n A 1 76 GLY 76 340 340 GLY GLY A . n A 1 77 PHE 77 341 341 PHE PHE A . n A 1 78 MET 78 342 342 MET MET A . n A 1 79 GLU 79 343 343 GLU GLU A . n A 1 80 LEU 80 344 344 LEU LEU A . n A 1 81 CYS 81 345 345 CYS CYS A . n A 1 82 GLN 82 346 346 GLN GLN A . n A 1 83 ASN 83 347 347 ASN ASN A . n A 1 84 ASP 84 348 348 ASP ASP A . n A 1 85 GLN 85 349 349 GLN GLN A . n A 1 86 ILE 86 350 350 ILE ILE A . n A 1 87 VAL 87 351 351 VAL VAL A . n A 1 88 LEU 88 352 352 LEU LEU A . n A 1 89 LEU 89 353 353 LEU LEU A . n A 1 90 LYS 90 354 354 LYS LYS A . n A 1 91 ALA 91 355 355 ALA ALA A . n A 1 92 GLY 92 356 356 GLY GLY A . n A 1 93 ALA 93 357 357 ALA ALA A . n A 1 94 MET 94 358 358 MET MET A . n A 1 95 GLU 95 359 359 GLU GLU A . n A 1 96 VAL 96 360 360 VAL VAL A . n A 1 97 VAL 97 361 361 VAL VAL A . n A 1 98 LEU 98 362 362 LEU LEU A . n A 1 99 VAL 99 363 363 VAL VAL A . n A 1 100 ARG 100 364 364 ARG ARG A . n A 1 101 MET 101 365 365 MET MET A . n A 1 102 CYS 102 366 366 CYS CYS A . n A 1 103 ARG 103 367 367 ARG ARG A . n A 1 104 ALA 104 368 368 ALA ALA A . n A 1 105 TYR 105 369 369 TYR TYR A . n A 1 106 ASN 106 370 370 ASN ASN A . n A 1 107 ALA 107 371 371 ALA ALA A . n A 1 108 ASP 108 372 372 ASP ASP A . n A 1 109 ASN 109 373 373 ASN ASN A . n A 1 110 ARG 110 374 374 ARG ARG A . n A 1 111 THR 111 375 375 THR THR A . n A 1 112 VAL 112 376 376 VAL VAL A . n A 1 113 PHE 113 377 377 PHE PHE A . n A 1 114 PHE 114 378 378 PHE PHE A . n A 1 115 GLU 115 379 379 GLU GLU A . n A 1 116 GLY 116 380 380 GLY GLY A . n A 1 117 LYS 117 381 381 LYS LYS A . n A 1 118 TYR 118 382 382 TYR TYR A . n A 1 119 GLY 119 383 383 GLY GLY A . n A 1 120 GLY 120 384 384 GLY GLY A . n A 1 121 MET 121 385 385 MET MET A . n A 1 122 GLU 122 386 386 GLU GLU A . n A 1 123 LEU 123 387 387 LEU LEU A . n A 1 124 PHE 124 388 388 PHE PHE A . n A 1 125 ARG 125 389 389 ARG ARG A . n A 1 126 ALA 126 390 390 ALA ALA A . n A 1 127 LEU 127 391 391 LEU LEU A . n A 1 128 GLY 128 392 392 GLY GLY A . n A 1 129 CYS 129 393 393 CYS CYS A . n A 1 130 SER 130 394 394 SER SER A . n A 1 131 GLU 131 395 395 GLU GLU A . n A 1 132 LEU 132 396 396 LEU LEU A . n A 1 133 ILE 133 397 397 ILE ILE A . n A 1 134 SER 134 398 398 SER SER A . n A 1 135 SER 135 399 399 SER SER A . n A 1 136 ILE 136 400 400 ILE ILE A . n A 1 137 PHE 137 401 401 PHE PHE A . n A 1 138 ASP 138 402 402 ASP ASP A . n A 1 139 PHE 139 403 403 PHE PHE A . n A 1 140 SER 140 404 404 SER SER A . n A 1 141 HIS 141 405 405 HIS HIS A . n A 1 142 SER 142 406 406 SER SER A . n A 1 143 LEU 143 407 407 LEU LEU A . n A 1 144 SER 144 408 408 SER SER A . n A 1 145 ALA 145 409 409 ALA ALA A . n A 1 146 LEU 146 410 410 LEU LEU A . n A 1 147 HIS 147 411 411 HIS HIS A . n A 1 148 PHE 148 412 412 PHE PHE A . n A 1 149 SER 149 413 413 SER SER A . n A 1 150 GLU 150 414 414 GLU GLU A . n A 1 151 ASP 151 415 415 ASP ASP A . n A 1 152 GLU 152 416 416 GLU GLU A . n A 1 153 ILE 153 417 417 ILE ILE A . n A 1 154 ALA 154 418 418 ALA ALA A . n A 1 155 LEU 155 419 419 LEU LEU A . n A 1 156 TYR 156 420 420 TYR TYR A . n A 1 157 THR 157 421 421 THR THR A . n A 1 158 ALA 158 422 422 ALA ALA A . n A 1 159 LEU 159 423 423 LEU LEU A . n A 1 160 VAL 160 424 424 VAL VAL A . n A 1 161 LEU 161 425 425 LEU LEU A . n A 1 162 ILE 162 426 426 ILE ILE A . n A 1 163 ASN 163 427 427 ASN ASN A . n A 1 164 ALA 164 428 428 ALA ALA A . n A 1 165 HIS 165 429 429 HIS HIS A . n A 1 166 ARG 166 430 430 ARG ARG A . n A 1 167 PRO 167 431 431 PRO PRO A . n A 1 168 GLY 168 432 432 GLY GLY A . n A 1 169 LEU 169 433 433 LEU LEU A . n A 1 170 GLN 170 434 434 GLN GLN A . n A 1 171 GLU 171 435 435 GLU GLU A . n A 1 172 LYS 172 436 436 LYS LYS A . n A 1 173 ARG 173 437 437 ARG ARG A . n A 1 174 LYS 174 438 438 LYS LYS A . n A 1 175 VAL 175 439 439 VAL VAL A . n A 1 176 GLU 176 440 440 GLU GLU A . n A 1 177 GLN 177 441 441 GLN GLN A . n A 1 178 LEU 178 442 442 LEU LEU A . n A 1 179 GLN 179 443 443 GLN GLN A . n A 1 180 TYR 180 444 444 TYR TYR A . n A 1 181 ASN 181 445 445 ASN ASN A . n A 1 182 LEU 182 446 446 LEU LEU A . n A 1 183 GLU 183 447 447 GLU GLU A . n A 1 184 LEU 184 448 448 LEU LEU A . n A 1 185 ALA 185 449 449 ALA ALA A . n A 1 186 PHE 186 450 450 PHE PHE A . n A 1 187 HIS 187 451 451 HIS HIS A . n A 1 188 HIS 188 452 452 HIS HIS A . n A 1 189 HIS 189 453 453 HIS HIS A . n A 1 190 LEU 190 454 454 LEU LEU A . n A 1 191 CYS 191 455 455 CYS CYS A . n A 1 192 LYS 192 456 456 LYS LYS A . n A 1 193 THR 193 457 457 THR THR A . n A 1 194 HIS 194 458 458 HIS HIS A . n A 1 195 ARG 195 459 459 ARG ARG A . n A 1 196 GLN 196 460 460 GLN GLN A . n A 1 197 SER 197 461 461 SER SER A . n A 1 198 ILE 198 462 462 ILE ILE A . n A 1 199 LEU 199 463 463 LEU LEU A . n A 1 200 ALA 200 464 464 ALA ALA A . n A 1 201 LYS 201 465 465 LYS LYS A . n A 1 202 LEU 202 466 466 LEU LEU A . n A 1 203 PRO 203 467 467 PRO PRO A . n A 1 204 PRO 204 468 468 PRO PRO A . n A 1 205 LYS 205 469 469 LYS LYS A . n A 1 206 GLY 206 470 470 GLY GLY A . n A 1 207 LYS 207 471 471 LYS LYS A . n A 1 208 LEU 208 472 472 LEU LEU A . n A 1 209 ARG 209 473 473 ARG ARG A . n A 1 210 SER 210 474 474 SER SER A . n A 1 211 LEU 211 475 475 LEU LEU A . n A 1 212 CYS 212 476 476 CYS CYS A . n A 1 213 SER 213 477 477 SER SER A . n A 1 214 GLN 214 478 478 GLN GLN A . n A 1 215 HIS 215 479 479 HIS HIS A . n A 1 216 VAL 216 480 480 VAL VAL A . n A 1 217 GLU 217 481 481 GLU GLU A . n A 1 218 ARG 218 482 482 ARG ARG A . n A 1 219 LEU 219 483 483 LEU LEU A . n A 1 220 GLN 220 484 484 GLN GLN A . n A 1 221 ILE 221 485 485 ILE ILE A . n A 1 222 PHE 222 486 486 PHE PHE A . n A 1 223 GLN 223 487 487 GLN GLN A . n A 1 224 HIS 224 488 488 HIS HIS A . n A 1 225 LEU 225 489 489 LEU LEU A . n A 1 226 PRO 226 490 490 PRO PRO A . n A 1 227 ALA 227 491 491 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FJG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 501 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id FJG _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-25 2 'Structure model' 1 1 2018-05-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 35.9974 -23.3079 -0.0402 1.0909 0.5872 0.8087 0.2584 0.0138 -0.0888 3.6846 2.7593 1.2231 -1.2439 -0.8222 -0.2798 0.2832 -0.3179 0.0208 1.0563 0.1541 0.1297 -0.2394 -1.0551 -0.0465 'X-RAY DIFFRACTION' 2 ? refined 5.3447 -19.7886 -7.6702 1.1644 0.8186 0.8070 0.2162 0.0715 0.0217 2.8339 1.8158 3.0571 -0.7411 0.8461 0.7891 0.1113 -0.2018 0.1711 -0.7509 0.9224 0.4022 0.7409 -1.0394 -0.2947 'X-RAY DIFFRACTION' 3 ? refined 15.4934 -28.3729 -16.5401 0.9929 0.4861 0.8022 -0.0472 0.0711 0.2099 4.5198 0.2102 2.7613 0.0895 2.4105 0.5758 -0.1484 0.2378 -0.0491 0.5799 0.7584 0.2432 -0.8663 -0.1468 -0.1689 'X-RAY DIFFRACTION' 4 ? refined 27.6197 -33.5783 -10.4648 0.8677 0.7593 0.5616 -0.0835 -0.0887 0.0665 7.1508 3.1979 2.9739 -0.2217 -1.4927 0.9269 1.0832 -0.5835 -0.4700 -0.3065 -0.0852 -0.0718 0.0021 0.1417 0.0361 'X-RAY DIFFRACTION' 5 ? refined 3.3893 -26.5879 -5.4945 1.1079 0.6522 0.7493 -0.0515 0.0162 0.1108 2.3000 1.3522 6.6664 -0.4132 3.1864 1.0001 -0.4836 -0.3229 0.8990 0.0170 0.3066 0.6516 0.9805 0.0533 0.3530 'X-RAY DIFFRACTION' 6 ? refined 16.6921 -31.6097 0.5740 0.6950 0.7686 1.0178 0.1172 0.0141 0.1419 2.7162 2.3989 3.5592 1.1570 -0.3780 2.0359 0.3024 -0.5085 0.1468 -0.2337 -0.2036 0.3809 0.9388 1.0406 -0.5956 'X-RAY DIFFRACTION' 7 ? refined 32.0768 -36.4036 1.9436 0.8719 0.9979 0.7042 0.1050 -0.1004 -0.0100 1.3950 3.2768 4.0599 -1.1586 -0.7484 2.5016 -0.1386 0.0593 -0.1138 -0.1862 -0.3236 0.2932 0.8497 1.0849 -0.6209 'X-RAY DIFFRACTION' 8 ? refined 12.9921 -42.0866 -13.7250 1.2216 0.9356 0.7595 -0.0963 -0.0732 -0.0873 6.2943 3.3636 4.9640 0.7508 2.8680 1.5450 0.6959 0.4578 -1.2576 0.8047 -1.3161 -0.0265 0.5790 1.0731 0.7223 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 265 A 283 ;chain 'A' and (resid 265 through 283 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 284 A 312 ;chain 'A' and (resid 284 through 312 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 313 A 337 ;chain 'A' and (resid 313 through 337 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 338 A 368 ;chain 'A' and (resid 338 through 368 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 369 A 393 ;chain 'A' and (resid 369 through 393 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 394 A 425 ;chain 'A' and (resid 394 through 425 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 426 A 470 ;chain 'A' and (resid 426 through 470 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 471 A 491 ;chain 'A' and (resid 471 through 491 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 283 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 337 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 286 ? ? 64.14 -82.74 2 1 ARG A 296 ? ? -64.56 1.44 3 1 GLU A 379 ? ? 75.27 66.01 4 1 LYS A 381 ? ? -179.09 144.61 5 1 ASN A 427 ? ? -175.17 87.88 6 1 PRO A 431 ? ? -38.46 -87.22 7 1 GLN A 434 ? ? -85.99 -89.33 8 1 LYS A 469 ? ? 87.46 -87.47 9 1 HIS A 488 ? ? -150.83 -12.15 10 1 LEU A 489 ? ? -64.35 -161.97 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FJG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FJG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;trans-3-({4-(cyclohexylmethyl)-5-[3-(1-methylcyclopropyl)-5-{[(2R)-1,1,1-trifluoropropan-2-yl]carbamoyl}phenyl]-1,3-thiazole-2-carbonyl}amino)cyclobutane-1-carboxylic acid ; _pdbx_entity_nonpoly.comp_id FJG # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #