data_6CY6 # _entry.id 6CY6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6CY6 WWPDB D_1000233690 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CY6 _pdbx_database_status.recvd_initial_deposition_date 2018-04-04 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Filippova, E.V.' 1 ? 'Minasov, G.' 2 ? 'Kiryukhina, O.' 3 ? 'Anderson, W.F.' 4 ? 'Satchell, K.J.F.' 5 ? 'Joachimiak, A.' 6 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 545 _citation.page_last 553 _citation.title 'Analysis of crystalline and solution states of ligand-free spermidine N-acetyltransferase (SpeG) from Escherichia coli.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798319006545 _citation.pdbx_database_id_PubMed 31205017 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Filippova, E.V.' 1 ? primary 'Weigand, S.' 2 ? primary 'Kiryukhina, O.' 3 ? primary 'Wolfe, A.J.' 4 ? primary 'Anderson, W.F.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6CY6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.499 _cell.length_a_esd ? _cell.length_b 107.499 _cell.length_b_esd ? _cell.length_c 65.021 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CY6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 177 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Spermidine N(1)-acetyltransferase' 21920.035 1 2.3.1.57 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 8 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 5 non-polymer syn '(4R)-2-METHYLPENTANE-2,4-DIOL' 118.174 2 ? ? ? ? 6 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 4 ? ? ? ? 7 water nat water 18.015 105 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SAT,Spermidine/spermine N(1)-acetyltransferase,SSAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHV HRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAI RMCIFQHQYLAEHKTPGQTLLKPTAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHV HRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAI RMCIFQHQYLAEHKTPGQTLLKPTAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 ALA n 1 5 HIS n 1 6 SER n 1 7 VAL n 1 8 LYS n 1 9 LEU n 1 10 ARG n 1 11 PRO n 1 12 LEU n 1 13 GLU n 1 14 ARG n 1 15 GLU n 1 16 ASP n 1 17 LEU n 1 18 ARG n 1 19 TYR n 1 20 VAL n 1 21 HIS n 1 22 GLN n 1 23 LEU n 1 24 ASP n 1 25 ASN n 1 26 ASN n 1 27 ALA n 1 28 SER n 1 29 VAL n 1 30 MET n 1 31 ARG n 1 32 TYR n 1 33 TRP n 1 34 PHE n 1 35 GLU n 1 36 GLU n 1 37 PRO n 1 38 TYR n 1 39 GLU n 1 40 ALA n 1 41 PHE n 1 42 VAL n 1 43 GLU n 1 44 LEU n 1 45 SER n 1 46 ASP n 1 47 LEU n 1 48 TYR n 1 49 ASP n 1 50 LYS n 1 51 HIS n 1 52 ILE n 1 53 HIS n 1 54 ASP n 1 55 GLN n 1 56 SER n 1 57 GLU n 1 58 ARG n 1 59 ARG n 1 60 PHE n 1 61 VAL n 1 62 VAL n 1 63 GLU n 1 64 CYS n 1 65 ASP n 1 66 GLY n 1 67 GLU n 1 68 LYS n 1 69 ALA n 1 70 GLY n 1 71 LEU n 1 72 VAL n 1 73 GLU n 1 74 LEU n 1 75 VAL n 1 76 GLU n 1 77 ILE n 1 78 ASN n 1 79 HIS n 1 80 VAL n 1 81 HIS n 1 82 ARG n 1 83 ARG n 1 84 ALA n 1 85 GLU n 1 86 PHE n 1 87 GLN n 1 88 ILE n 1 89 ILE n 1 90 ILE n 1 91 SER n 1 92 PRO n 1 93 GLU n 1 94 TYR n 1 95 GLN n 1 96 GLY n 1 97 LYS n 1 98 GLY n 1 99 LEU n 1 100 ALA n 1 101 THR n 1 102 ARG n 1 103 ALA n 1 104 ALA n 1 105 LYS n 1 106 LEU n 1 107 ALA n 1 108 MET n 1 109 ASP n 1 110 TYR n 1 111 GLY n 1 112 PHE n 1 113 THR n 1 114 VAL n 1 115 LEU n 1 116 ASN n 1 117 LEU n 1 118 TYR n 1 119 LYS n 1 120 LEU n 1 121 TYR n 1 122 LEU n 1 123 ILE n 1 124 VAL n 1 125 ASP n 1 126 LYS n 1 127 GLU n 1 128 ASN n 1 129 GLU n 1 130 LYS n 1 131 ALA n 1 132 ILE n 1 133 HIS n 1 134 ILE n 1 135 TYR n 1 136 ARG n 1 137 LYS n 1 138 LEU n 1 139 GLY n 1 140 PHE n 1 141 SER n 1 142 VAL n 1 143 GLU n 1 144 GLY n 1 145 GLU n 1 146 LEU n 1 147 MET n 1 148 HIS n 1 149 GLU n 1 150 PHE n 1 151 PHE n 1 152 ILE n 1 153 ASN n 1 154 GLY n 1 155 GLN n 1 156 TYR n 1 157 ARG n 1 158 ASN n 1 159 ALA n 1 160 ILE n 1 161 ARG n 1 162 MET n 1 163 CYS n 1 164 ILE n 1 165 PHE n 1 166 GLN n 1 167 HIS n 1 168 GLN n 1 169 TYR n 1 170 LEU n 1 171 ALA n 1 172 GLU n 1 173 HIS n 1 174 LYS n 1 175 THR n 1 176 PRO n 1 177 GLY n 1 178 GLN n 1 179 THR n 1 180 LEU n 1 181 LEU n 1 182 LYS n 1 183 PRO n 1 184 THR n 1 185 ALA n 1 186 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 186 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'speG, b1584, JW1576' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pMCSG7 ' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATDA_ECOLI _struct_ref.pdbx_db_accession P0A951 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHV HRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAI RMCIFQHQYLAEHKTPGQTLLKPTAQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CY6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A951 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 186 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 186 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 MRD non-polymer . '(4R)-2-METHYLPENTANE-2,4-DIOL' ? 'C6 H14 O2' 118.174 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CY6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium phosphate monobasic, 0.1 M Tris, 50% v/v MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Beryllium Lenses' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'C(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CY6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22903 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 51.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.048 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1109 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.65 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.32 _refine.aniso_B[1][2] -0.16 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.32 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.02 _refine.B_iso_max ? _refine.B_iso_mean 31.440 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CY6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 93.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21759 _refine.ls_number_reflns_R_free 1144 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.15587 _refine.ls_R_factor_R_free 0.20067 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.15352 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4R9M _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.091 _refine.pdbx_overall_ESU_R_Free 0.099 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.547 _refine.overall_SU_ML 0.057 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1422 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 1592 _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 93.10 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.021 0.019 1573 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1469 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.098 1.977 2133 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.005 3.000 3381 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.025 5.000 182 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.246 23.448 87 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.266 15.000 274 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.060 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.132 0.200 224 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.025 0.020 1736 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.019 0.020 345 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.237 2.035 711 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.225 2.026 709 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.148 3.028 898 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.146 3.034 899 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.317 2.737 862 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.280 2.724 859 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.204 3.909 1230 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.607 25.402 1715 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.526 25.120 1702 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.749 _refine_ls_shell.d_res_low 1.794 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 88 _refine_ls_shell.number_reflns_R_work 1576 _refine_ls_shell.percent_reflns_obs 99.46 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.249 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.190 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6CY6 _struct.title ;Crystal structure of spermidine/spermine N-acetyltransferase SpeG from Escherichia coli in complex with tris(hydroxymethyl)aminomethane. ; _struct.pdbx_descriptor 'Ornithine aminotransferase, mitochondrial (E.C.2.6.1.13)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CY6 _struct_keywords.text ;SpeG, spermidine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 3 ? K N N 4 ? L N N 5 ? M N N 6 ? N N N 5 ? O N N 6 ? P N N 6 ? Q N N 6 ? R N N 7 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 13 ? GLU A 15 ? GLU A 13 GLU A 15 5 ? 3 HELX_P HELX_P2 AA2 ASP A 16 ? LEU A 23 ? ASP A 16 LEU A 23 1 ? 8 HELX_P HELX_P3 AA3 ASN A 25 ? MET A 30 ? ASN A 25 MET A 30 5 ? 6 HELX_P HELX_P4 AA4 ALA A 40 ? HIS A 51 ? ALA A 40 HIS A 51 1 ? 12 HELX_P HELX_P5 AA5 PRO A 92 ? GLN A 95 ? PRO A 92 GLN A 95 5 ? 4 HELX_P HELX_P6 AA6 GLY A 98 ? VAL A 114 ? GLY A 98 VAL A 114 1 ? 17 HELX_P HELX_P7 AA7 ASN A 128 ? LEU A 138 ? ASN A 128 LEU A 138 1 ? 11 HELX_P HELX_P8 AA8 GLN A 166 ? HIS A 173 ? GLN A 166 HIS A 173 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 54 O ? ? ? 1_555 J NA . NA ? ? A ASP 54 A NA 209 1_555 ? ? ? ? ? ? ? 2.328 ? metalc2 metalc ? ? A GLU 57 O ? ? ? 1_555 J NA . NA ? ? A GLU 57 A NA 209 1_555 ? ? ? ? ? ? ? 2.278 ? metalc3 metalc ? ? J NA . NA ? ? ? 1_555 R HOH . O ? ? A NA 209 A HOH 365 1_555 ? ? ? ? ? ? ? 2.342 ? metalc4 metalc ? ? A GLU 36 OE1 ? ? ? 1_555 J NA . NA ? ? A GLU 36 A NA 209 5_565 ? ? ? ? ? ? ? 2.740 ? metalc5 metalc ? ? J NA . NA ? ? ? 1_555 R HOH . O ? ? A NA 209 A HOH 321 6_655 ? ? ? ? ? ? ? 2.370 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 7 ? PRO A 11 ? VAL A 7 PRO A 11 AA1 2 ARG A 58 ? CYS A 64 ? ARG A 58 CYS A 64 AA1 3 GLU A 67 ? ASN A 78 ? GLU A 67 ASN A 78 AA1 4 ARG A 83 ? ILE A 90 ? ARG A 83 ILE A 90 AA1 5 LYS A 119 ? ASP A 125 ? LYS A 119 ASP A 125 AA1 6 GLN A 155 ? PHE A 165 ? GLN A 155 PHE A 165 AA1 7 SER A 141 ? ILE A 152 ? SER A 141 ILE A 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 8 ? N LYS A 8 O GLU A 63 ? O GLU A 63 AA1 2 3 N VAL A 62 ? N VAL A 62 O ALA A 69 ? O ALA A 69 AA1 3 4 N VAL A 75 ? N VAL A 75 O GLU A 85 ? O GLU A 85 AA1 4 5 N PHE A 86 ? N PHE A 86 O TYR A 121 ? O TYR A 121 AA1 5 6 N VAL A 124 ? N VAL A 124 O ILE A 160 ? O ILE A 160 AA1 6 7 O ALA A 159 ? O ALA A 159 N LEU A 146 ? N LEU A 146 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 201 ? 4 'binding site for residue CL A 201' AC2 Software A CL 202 ? 5 'binding site for residue CL A 202' AC3 Software A CL 203 ? 2 'binding site for residue CL A 203' AC4 Software A CL 204 ? 2 'binding site for residue CL A 204' AC5 Software A CL 205 ? 2 'binding site for residue CL A 205' AC6 Software A CL 206 ? 3 'binding site for residue CL A 206' AC7 Software A CL 207 ? 1 'binding site for residue CL A 207' AC8 Software A CL 208 ? 2 'binding site for residue CL A 208' AC9 Software A NA 209 ? 6 'binding site for residue NA A 209' AD1 Software A TRS 210 ? 7 'binding site for residue TRS A 210' AD2 Software A MRD 211 ? 6 'binding site for residue MRD A 211' AD3 Software A MPD 212 ? 1 'binding site for residue MPD A 212' AD4 Software A MRD 213 ? 1 'binding site for residue MRD A 213' AD5 Software A MPD 214 ? 4 'binding site for residue MPD A 214' AD6 Software A MPD 215 ? 4 'binding site for residue MPD A 215' AD7 Software A MPD 216 ? 4 'binding site for residue MPD A 216' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 15 ? GLU A 15 . ? 1_555 ? 2 AC1 4 ARG A 18 ? ARG A 18 . ? 6_655 ? 3 AC1 4 HOH R . ? HOH A 332 . ? 1_555 ? 4 AC1 4 HOH R . ? HOH A 404 . ? 1_555 ? 5 AC2 5 MET A 30 ? MET A 30 . ? 1_555 ? 6 AC2 5 ARG A 31 ? ARG A 31 . ? 1_555 ? 7 AC2 5 TYR A 32 ? TYR A 32 . ? 1_555 ? 8 AC2 5 ARG A 59 ? ARG A 59 . ? 1_555 ? 9 AC2 5 HOH R . ? HOH A 333 . ? 1_555 ? 10 AC3 2 ASP A 125 ? ASP A 125 . ? 1_555 ? 11 AC3 2 ASN A 128 ? ASN A 128 . ? 1_555 ? 12 AC4 2 ARG A 31 ? ARG A 31 . ? 1_555 ? 13 AC4 2 MPD M . ? MPD A 212 . ? 1_555 ? 14 AC5 2 ARG A 14 ? ARG A 14 . ? 1_555 ? 15 AC5 2 SER A 45 ? SER A 45 . ? 1_555 ? 16 AC6 3 LYS A 126 ? LYS A 126 . ? 4_765 ? 17 AC6 3 ARG A 136 ? ARG A 136 . ? 1_555 ? 18 AC6 3 VAL A 142 ? VAL A 142 . ? 1_555 ? 19 AC7 1 TYR A 156 ? TYR A 156 . ? 1_555 ? 20 AC8 2 ARG A 14 ? ARG A 14 . ? 1_555 ? 21 AC8 2 HOH R . ? HOH A 404 . ? 1_555 ? 22 AC9 6 GLU A 36 ? GLU A 36 . ? 6_655 ? 23 AC9 6 ASP A 54 ? ASP A 54 . ? 1_555 ? 24 AC9 6 GLU A 57 ? GLU A 57 . ? 1_555 ? 25 AC9 6 ARG A 58 ? ARG A 58 . ? 1_555 ? 26 AC9 6 HOH R . ? HOH A 321 . ? 6_655 ? 27 AC9 6 HOH R . ? HOH A 365 . ? 1_555 ? 28 AD1 7 TYR A 32 ? TYR A 32 . ? 1_555 ? 29 AD1 7 TRP A 33 ? TRP A 33 . ? 1_555 ? 30 AD1 7 ASP A 54 ? ASP A 54 . ? 1_555 ? 31 AD1 7 SER A 56 ? SER A 56 . ? 1_555 ? 32 AD1 7 GLU A 57 ? GLU A 57 . ? 1_555 ? 33 AD1 7 GLU A 76 ? GLU A 76 . ? 1_555 ? 34 AD1 7 HOH R . ? HOH A 302 . ? 1_555 ? 35 AD2 6 LEU A 12 ? LEU A 12 . ? 1_555 ? 36 AD2 6 HIS A 51 ? HIS A 51 . ? 1_555 ? 37 AD2 6 GLU A 57 ? GLU A 57 . ? 1_555 ? 38 AD2 6 ARG A 58 ? ARG A 58 . ? 1_555 ? 39 AD2 6 ARG A 59 ? ARG A 59 . ? 1_555 ? 40 AD2 6 HOH R . ? HOH A 321 . ? 6_655 ? 41 AD3 1 CL E . ? CL A 204 . ? 1_555 ? 42 AD4 1 ASN A 128 ? ASN A 128 . ? 1_555 ? 43 AD5 4 TYR A 32 ? TYR A 32 . ? 1_555 ? 44 AD5 4 ILE A 123 ? ILE A 123 . ? 1_555 ? 45 AD5 4 LEU A 146 ? LEU A 146 . ? 1_555 ? 46 AD5 4 GLU A 149 ? GLU A 149 . ? 1_555 ? 47 AD6 4 LYS A 126 ? LYS A 126 . ? 1_555 ? 48 AD6 4 GLU A 143 ? GLU A 143 . ? 4_765 ? 49 AD6 4 GLU A 145 ? GLU A 145 . ? 1_555 ? 50 AD6 4 ILE A 160 ? ILE A 160 . ? 1_555 ? 51 AD7 4 ILE A 123 ? ILE A 123 . ? 1_555 ? 52 AD7 4 ASP A 125 ? ASP A 125 . ? 1_555 ? 53 AD7 4 PHE A 150 ? PHE A 150 . ? 1_555 ? 54 AD7 4 ILE A 152 ? ILE A 152 . ? 1_555 ? # _atom_sites.entry_id 6CY6 _atom_sites.fract_transf_matrix[1][1] 0.009302 _atom_sites.fract_transf_matrix[1][2] 0.005371 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010742 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015380 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 CYS 163 163 163 CYS CYS A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 PRO 176 176 ? ? ? A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 GLN 178 178 ? ? ? A . n A 1 179 THR 179 179 ? ? ? A . n A 1 180 LEU 180 180 ? ? ? A . n A 1 181 LEU 181 181 ? ? ? A . n A 1 182 LYS 182 182 ? ? ? A . n A 1 183 PRO 183 183 ? ? ? A . n A 1 184 THR 184 184 ? ? ? A . n A 1 185 ALA 185 185 ? ? ? A . n A 1 186 GLN 186 186 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 2 CL 1 202 2 CL CL A . D 2 CL 1 203 3 CL CL A . E 2 CL 1 204 4 CL CL A . F 2 CL 1 205 5 CL CL A . G 2 CL 1 206 6 CL CL A . H 2 CL 1 207 7 CL CL A . I 2 CL 1 208 8 CL CL A . J 3 NA 1 209 9 NA NA A . K 4 TRS 1 210 10 TRS TRS A . L 5 MRD 1 211 11 MRD MPD A . M 6 MPD 1 212 12 MPD MPD A . N 5 MRD 1 213 13 MRD MPD A . O 6 MPD 1 214 14 MPD MPD A . P 6 MPD 1 215 15 MPD MPD A . Q 6 MPD 1 216 16 MPD MPD A . R 7 HOH 1 301 5 HOH HOH A . R 7 HOH 2 302 60 HOH HOH A . R 7 HOH 3 303 25 HOH HOH A . R 7 HOH 4 304 73 HOH HOH A . R 7 HOH 5 305 100 HOH HOH A . R 7 HOH 6 306 57 HOH HOH A . R 7 HOH 7 307 36 HOH HOH A . R 7 HOH 8 308 51 HOH HOH A . R 7 HOH 9 309 83 HOH HOH A . R 7 HOH 10 310 80 HOH HOH A . R 7 HOH 11 311 78 HOH HOH A . R 7 HOH 12 312 106 HOH HOH A . R 7 HOH 13 313 70 HOH HOH A . R 7 HOH 14 314 81 HOH HOH A . R 7 HOH 15 315 84 HOH HOH A . R 7 HOH 16 316 76 HOH HOH A . R 7 HOH 17 317 39 HOH HOH A . R 7 HOH 18 318 43 HOH HOH A . R 7 HOH 19 319 88 HOH HOH A . R 7 HOH 20 320 18 HOH HOH A . R 7 HOH 21 321 31 HOH HOH A . R 7 HOH 22 322 104 HOH HOH A . R 7 HOH 23 323 32 HOH HOH A . R 7 HOH 24 324 101 HOH HOH A . R 7 HOH 25 325 11 HOH HOH A . R 7 HOH 26 326 6 HOH HOH A . R 7 HOH 27 327 105 HOH HOH A . R 7 HOH 28 328 96 HOH HOH A . R 7 HOH 29 329 27 HOH HOH A . R 7 HOH 30 330 2 HOH HOH A . R 7 HOH 31 331 33 HOH HOH A . R 7 HOH 32 332 8 HOH HOH A . R 7 HOH 33 333 28 HOH HOH A . R 7 HOH 34 334 30 HOH HOH A . R 7 HOH 35 335 13 HOH HOH A . R 7 HOH 36 336 97 HOH HOH A . R 7 HOH 37 337 20 HOH HOH A . R 7 HOH 38 338 59 HOH HOH A . R 7 HOH 39 339 53 HOH HOH A . R 7 HOH 40 340 4 HOH HOH A . R 7 HOH 41 341 42 HOH HOH A . R 7 HOH 42 342 40 HOH HOH A . R 7 HOH 43 343 9 HOH HOH A . R 7 HOH 44 344 23 HOH HOH A . R 7 HOH 45 345 44 HOH HOH A . R 7 HOH 46 346 21 HOH HOH A . R 7 HOH 47 347 95 HOH HOH A . R 7 HOH 48 348 19 HOH HOH A . R 7 HOH 49 349 85 HOH HOH A . R 7 HOH 50 350 48 HOH HOH A . R 7 HOH 51 351 24 HOH HOH A . R 7 HOH 52 352 63 HOH HOH A . R 7 HOH 53 353 3 HOH HOH A . R 7 HOH 54 354 47 HOH HOH A . R 7 HOH 55 355 37 HOH HOH A . R 7 HOH 56 356 45 HOH HOH A . R 7 HOH 57 357 92 HOH HOH A . R 7 HOH 58 358 75 HOH HOH A . R 7 HOH 59 359 17 HOH HOH A . R 7 HOH 60 360 66 HOH HOH A . R 7 HOH 61 361 26 HOH HOH A . R 7 HOH 62 362 61 HOH HOH A . R 7 HOH 63 363 34 HOH HOH A . R 7 HOH 64 364 7 HOH HOH A . R 7 HOH 65 365 54 HOH HOH A . R 7 HOH 66 366 46 HOH HOH A . R 7 HOH 67 367 1 HOH HOH A . R 7 HOH 68 368 14 HOH HOH A . R 7 HOH 69 369 16 HOH HOH A . R 7 HOH 70 370 35 HOH HOH A . R 7 HOH 71 371 22 HOH HOH A . R 7 HOH 72 372 12 HOH HOH A . R 7 HOH 73 373 15 HOH HOH A . R 7 HOH 74 374 10 HOH HOH A . R 7 HOH 75 375 52 HOH HOH A . R 7 HOH 76 376 62 HOH HOH A . R 7 HOH 77 377 79 HOH HOH A . R 7 HOH 78 378 49 HOH HOH A . R 7 HOH 79 379 107 HOH HOH A . R 7 HOH 80 380 86 HOH HOH A . R 7 HOH 81 381 38 HOH HOH A . R 7 HOH 82 382 65 HOH HOH A . R 7 HOH 83 383 98 HOH HOH A . R 7 HOH 84 384 68 HOH HOH A . R 7 HOH 85 385 103 HOH HOH A . R 7 HOH 86 386 93 HOH HOH A . R 7 HOH 87 387 50 HOH HOH A . R 7 HOH 88 388 29 HOH HOH A . R 7 HOH 89 389 67 HOH HOH A . R 7 HOH 90 390 91 HOH HOH A . R 7 HOH 91 391 71 HOH HOH A . R 7 HOH 92 392 108 HOH HOH A . R 7 HOH 93 393 89 HOH HOH A . R 7 HOH 94 394 90 HOH HOH A . R 7 HOH 95 395 77 HOH HOH A . R 7 HOH 96 396 74 HOH HOH A . R 7 HOH 97 397 72 HOH HOH A . R 7 HOH 98 398 99 HOH HOH A . R 7 HOH 99 399 41 HOH HOH A . R 7 HOH 100 400 69 HOH HOH A . R 7 HOH 101 401 55 HOH HOH A . R 7 HOH 102 402 102 HOH HOH A . R 7 HOH 103 403 82 HOH HOH A . R 7 HOH 104 404 58 HOH HOH A . R 7 HOH 105 405 64 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 75860 ? 1 MORE -1536 ? 1 'SSA (A^2)' 78120 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_765 -y+2,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 161.2485000000 0.8660254038 -0.5000000000 0.0000000000 93.0968648814 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_675 -x+y+1,-x+2,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 186.1937297628 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 107.4990000000 0.0000000000 -1.0000000000 0.0000000000 186.1937297628 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_565 y,-x+y+1,z 0.5000000000 0.8660254038 0.0000000000 -53.7495000000 -0.8660254038 0.5000000000 0.0000000000 93.0968648814 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_655 x-y+1,x,z 0.5000000000 -0.8660254038 0.0000000000 107.4990000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_558 y,x,-z+3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 8 'crystal symmetry operation' 8_678 x-y+1,-y+2,-z+3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 186.1937297628 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 9 'crystal symmetry operation' 9_768 -x+2,-x+y+1,-z+3 -0.5000000000 -0.8660254038 0.0000000000 161.2485000000 -0.8660254038 0.5000000000 0.0000000000 93.0968648814 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 10 'crystal symmetry operation' 10_778 -y+2,-x+2,-z+3 0.5000000000 -0.8660254038 0.0000000000 107.4990000000 -0.8660254038 -0.5000000000 0.0000000000 186.1937297628 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 11 'crystal symmetry operation' 11_658 -x+y+1,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 107.4990000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 12 'crystal symmetry operation' 12_568 x,x-y+1,-z+3 0.5000000000 0.8660254038 0.0000000000 -53.7495000000 0.8660254038 -0.5000000000 0.0000000000 93.0968648814 0.0000000000 0.0000000000 -1.0000000000 195.0630000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 54 ? A ASP 54 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? A GLU 57 ? A GLU 57 ? 1_555 90.5 ? 2 O ? A ASP 54 ? A ASP 54 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 365 ? 1_555 100.2 ? 3 O ? A GLU 57 ? A GLU 57 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 365 ? 1_555 168.0 ? 4 O ? A ASP 54 ? A ASP 54 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 59.7 ? 5 O ? A GLU 57 ? A GLU 57 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 61.5 ? 6 O ? R HOH . ? A HOH 365 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 128.8 ? 7 O ? A ASP 54 ? A ASP 54 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 321 ? 6_655 92.1 ? 8 O ? A GLU 57 ? A GLU 57 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 321 ? 6_655 99.2 ? 9 O ? R HOH . ? A HOH 365 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 321 ? 6_655 85.8 ? 10 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 NA ? J NA . ? A NA 209 ? 1_555 O ? R HOH . ? A HOH 321 ? 6_655 52.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-18 2 'Structure model' 1 1 2019-06-26 3 'Structure model' 1 2 2019-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.country' 10 3 'Structure model' '_citation.journal_abbrev' 11 3 'Structure model' '_citation.journal_id_ASTM' 12 3 'Structure model' '_citation.journal_id_ISSN' 13 3 'Structure model' '_citation.journal_volume' 14 3 'Structure model' '_citation.page_first' 15 3 'Structure model' '_citation.page_last' 16 3 'Structure model' '_citation.pdbx_database_id_PubMed' 17 3 'Structure model' '_citation.title' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 69.3442 73.6743 75.0326 0.0517 0.0377 0.0180 -0.0227 -0.0145 0.0019 4.4601 1.9214 1.2716 -1.1069 0.0244 0.4549 0.0003 0.2886 0.0823 -0.2386 -0.0184 0.1021 0.0522 -0.0716 0.0180 'X-RAY DIFFRACTION' 2 ? refined 62.3999 65.3273 86.5084 0.0535 0.0293 0.1147 0.0069 0.0008 0.0156 4.2768 0.8942 0.6119 -1.5448 1.0294 -0.0249 -0.0604 -0.0758 -0.3316 0.0137 0.0235 0.2149 -0.0197 -0.0247 0.0369 'X-RAY DIFFRACTION' 3 ? refined 75.0262 67.4651 83.4306 0.0745 0.0353 0.0233 -0.0002 -0.0156 -0.0209 1.1472 0.7625 0.4026 0.1225 0.1371 -0.2859 -0.0391 0.0892 -0.0342 -0.1102 0.0433 0.0084 0.0924 0.0317 -0.0043 'X-RAY DIFFRACTION' 4 ? refined 73.2337 52.7623 88.9859 0.0504 0.0234 0.0666 0.0296 -0.0115 -0.0201 3.8350 0.7564 0.5740 1.0702 -0.9019 -0.3548 -0.0824 0.0736 -0.4012 -0.0570 0.0119 -0.1421 -0.0190 -0.0626 0.0705 'X-RAY DIFFRACTION' 5 ? refined 91.4095 63.5089 88.0334 0.0727 0.1106 0.2937 0.0483 -0.0081 -0.0364 2.1502 3.8788 1.8917 -1.5897 0.7276 -2.1207 0.1538 0.2428 -0.1749 -0.1305 -0.2491 -0.5750 0.1072 0.2427 0.0953 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 5 ? ? A 24 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 25 ? ? A 38 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 39 ? ? A 134 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 135 ? ? A 162 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 163 ? ? A 173 ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? BLU-MAX ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 39 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 39 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.404 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.152 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 117.00 120.30 -3.30 0.50 N 2 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 124.80 120.30 4.50 0.50 N 3 1 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH2 A ARG 58 ? ? 124.00 120.30 3.70 0.50 N 4 1 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH2 A ARG 59 ? ? 123.69 120.30 3.39 0.50 N 5 1 NE A ARG 136 ? ? CZ A ARG 136 ? ? NH2 A ARG 136 ? ? 116.01 120.30 -4.29 0.50 N 6 1 NE A ARG 161 ? ? CZ A ARG 161 ? ? NH1 A ARG 161 ? ? 123.55 120.30 3.25 0.50 N 7 1 NE A ARG 161 ? ? CZ A ARG 161 ? ? NH2 A ARG 161 ? ? 115.04 120.30 -5.26 0.50 N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A LYS 174 ? A LYS 174 6 1 Y 1 A THR 175 ? A THR 175 7 1 Y 1 A PRO 176 ? A PRO 176 8 1 Y 1 A GLY 177 ? A GLY 177 9 1 Y 1 A GLN 178 ? A GLN 178 10 1 Y 1 A THR 179 ? A THR 179 11 1 Y 1 A LEU 180 ? A LEU 180 12 1 Y 1 A LEU 181 ? A LEU 181 13 1 Y 1 A LYS 182 ? A LYS 182 14 1 Y 1 A PRO 183 ? A PRO 183 15 1 Y 1 A THR 184 ? A THR 184 16 1 Y 1 A ALA 185 ? A ALA 185 17 1 Y 1 A GLN 186 ? A GLN 186 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'SODIUM ION' NA 4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 5 '(4R)-2-METHYLPENTANE-2,4-DIOL' MRD 6 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 7 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #