data_6CZ2 # _entry.id 6CZ2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CZ2 pdb_00006cz2 10.2210/pdb6cz2/pdb WWPDB D_1000233761 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CZ2 _pdbx_database_status.recvd_initial_deposition_date 2018-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gajiwala, K.S.' 1 ? 'Johnson, E.' 2 ? 'Cronin, C.N.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS ONE' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first e0198374 _citation.page_last e0198374 _citation.title 'Small molecule inhibitors reveal PTK6 kinase is not an oncogenic driver in breast cancers.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0198374 _citation.pdbx_database_id_PubMed 29879184 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qiu, L.' 1 ? primary 'Levine, K.' 2 ? primary 'Gajiwala, K.S.' 3 ? primary 'Cronin, C.N.' 4 ? primary 'Nagata, A.' 5 ? primary 'Johnson, E.' 6 ? primary 'Kraus, M.' 7 ? primary 'Tatlock, J.' 8 ? primary 'Kania, R.' 9 ? primary 'Foley, T.' 10 ? primary 'Sun, S.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6CZ2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 108.624 _cell.length_a_esd ? _cell.length_b 108.624 _cell.length_b_esd ? _cell.length_c 83.996 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CZ2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein-tyrosine kinase 6' 30328.881 1 2.7.10.2 ? ? ? 2 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Breast tumor kinase,Tyrosine-protein kinase BRK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSDDAERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDP VYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKE DV(PTR)LSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPS VHKLMLTCWCRDPEQRPCFKALRERLSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSDDAERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDP VYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKE DVYLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKL MLTCWCRDPEQRPCFKALRERLSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 ASP n 1 5 ALA n 1 6 GLU n 1 7 ARG n 1 8 PRO n 1 9 ARG n 1 10 GLU n 1 11 GLU n 1 12 PHE n 1 13 THR n 1 14 LEU n 1 15 CYS n 1 16 ARG n 1 17 LYS n 1 18 LEU n 1 19 GLY n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 PHE n 1 24 GLY n 1 25 GLU n 1 26 VAL n 1 27 PHE n 1 28 GLU n 1 29 GLY n 1 30 LEU n 1 31 TRP n 1 32 LYS n 1 33 ASP n 1 34 ARG n 1 35 VAL n 1 36 GLN n 1 37 VAL n 1 38 ALA n 1 39 ILE n 1 40 LYS n 1 41 VAL n 1 42 ILE n 1 43 SER n 1 44 ARG n 1 45 ASP n 1 46 ASN n 1 47 LEU n 1 48 LEU n 1 49 HIS n 1 50 GLN n 1 51 GLN n 1 52 MET n 1 53 LEU n 1 54 GLN n 1 55 SER n 1 56 GLU n 1 57 ILE n 1 58 GLN n 1 59 ALA n 1 60 MET n 1 61 LYS n 1 62 LYS n 1 63 LEU n 1 64 ARG n 1 65 HIS n 1 66 LYS n 1 67 HIS n 1 68 ILE n 1 69 LEU n 1 70 ALA n 1 71 LEU n 1 72 TYR n 1 73 ALA n 1 74 VAL n 1 75 VAL n 1 76 SER n 1 77 VAL n 1 78 GLY n 1 79 ASP n 1 80 PRO n 1 81 VAL n 1 82 TYR n 1 83 ILE n 1 84 ILE n 1 85 THR n 1 86 GLU n 1 87 LEU n 1 88 MET n 1 89 ALA n 1 90 LYS n 1 91 GLY n 1 92 SER n 1 93 LEU n 1 94 LEU n 1 95 GLU n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 ASP n 1 100 SER n 1 101 ASP n 1 102 GLU n 1 103 LYS n 1 104 VAL n 1 105 LEU n 1 106 PRO n 1 107 VAL n 1 108 SER n 1 109 GLU n 1 110 LEU n 1 111 LEU n 1 112 ASP n 1 113 ILE n 1 114 ALA n 1 115 TRP n 1 116 GLN n 1 117 VAL n 1 118 ALA n 1 119 GLU n 1 120 GLY n 1 121 MET n 1 122 CYS n 1 123 TYR n 1 124 LEU n 1 125 GLU n 1 126 SER n 1 127 GLN n 1 128 ASN n 1 129 TYR n 1 130 ILE n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 ALA n 1 136 ALA n 1 137 ARG n 1 138 ASN n 1 139 ILE n 1 140 LEU n 1 141 VAL n 1 142 GLY n 1 143 GLU n 1 144 ASN n 1 145 THR n 1 146 LEU n 1 147 CYS n 1 148 LYS n 1 149 VAL n 1 150 GLY n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 LEU n 1 155 ALA n 1 156 ARG n 1 157 LEU n 1 158 ILE n 1 159 LYS n 1 160 GLU n 1 161 ASP n 1 162 VAL n 1 163 PTR n 1 164 LEU n 1 165 SER n 1 166 HIS n 1 167 ASP n 1 168 HIS n 1 169 ASN n 1 170 ILE n 1 171 PRO n 1 172 TYR n 1 173 LYS n 1 174 TRP n 1 175 THR n 1 176 ALA n 1 177 PRO n 1 178 GLU n 1 179 ALA n 1 180 LEU n 1 181 SER n 1 182 ARG n 1 183 GLY n 1 184 HIS n 1 185 TYR n 1 186 SER n 1 187 THR n 1 188 LYS n 1 189 SER n 1 190 ASP n 1 191 VAL n 1 192 TRP n 1 193 SER n 1 194 PHE n 1 195 GLY n 1 196 ILE n 1 197 LEU n 1 198 LEU n 1 199 HIS n 1 200 GLU n 1 201 MET n 1 202 PHE n 1 203 SER n 1 204 ARG n 1 205 GLY n 1 206 GLN n 1 207 VAL n 1 208 PRO n 1 209 TYR n 1 210 PRO n 1 211 GLY n 1 212 MET n 1 213 SER n 1 214 ASN n 1 215 HIS n 1 216 GLU n 1 217 ALA n 1 218 PHE n 1 219 LEU n 1 220 ARG n 1 221 VAL n 1 222 ASP n 1 223 ALA n 1 224 GLY n 1 225 TYR n 1 226 ARG n 1 227 MET n 1 228 PRO n 1 229 CYS n 1 230 PRO n 1 231 LEU n 1 232 GLU n 1 233 CYS n 1 234 PRO n 1 235 PRO n 1 236 SER n 1 237 VAL n 1 238 HIS n 1 239 LYS n 1 240 LEU n 1 241 MET n 1 242 LEU n 1 243 THR n 1 244 CYS n 1 245 TRP n 1 246 CYS n 1 247 ARG n 1 248 ASP n 1 249 PRO n 1 250 GLU n 1 251 GLN n 1 252 ARG n 1 253 PRO n 1 254 CYS n 1 255 PHE n 1 256 LYS n 1 257 ALA n 1 258 LEU n 1 259 ARG n 1 260 GLU n 1 261 ARG n 1 262 LEU n 1 263 SER n 1 264 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 264 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTK6, BRK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTK6_HUMAN _struct_ref.pdbx_db_accession Q13882 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVY IITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDV YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLML TCWCRDPEQRPCFKALRERLSS ; _struct_ref.pdbx_align_begin 182 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CZ2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 264 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13882 _struct_ref_seq.db_align_beg 182 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 443 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 182 _struct_ref_seq.pdbx_auth_seq_align_end 443 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CZ2 GLY A 1 ? UNP Q13882 ? ? 'expression tag' 180 1 1 6CZ2 SER A 2 ? UNP Q13882 ? ? 'expression tag' 181 2 1 6CZ2 ALA A 5 ? UNP Q13882 TRP 184 conflict 184 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CZ2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.3 M Potassium acetate, 0.1 M bicine, pH 8, 13oC' _exptl_crystal_grow.pdbx_pH_range '7.5 - 8' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate 46.1 _reflns.entry_id 6CZ2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.42 _reflns.d_resolution_low 54.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13913 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.42 _reflns_shell.d_res_low 2.55 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2071 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.151 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.763 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 7.50 _refine.aniso_B[1][2] 11.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 7.50 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -14.99 _refine.B_iso_max ? _refine.B_iso_mean 52.0 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CZ2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 54.31 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12596 _refine.ls_number_reflns_R_free 637 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.206 _refine.ls_R_factor_R_free 0.246 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.203 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol 36.8786 _refine.solvent_model_param_ksol 0.365835 _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF 1827655.73 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1FMK _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6CZ2 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free 0.38 _refine_analyze.Luzzati_coordinate_error_obs 0.30 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_sigma_a_free 0.41 _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs 0.41 _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2127 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 2151 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 54.31 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? ? ? c_bond_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_prot ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 1.1 ? ? ? c_angle_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_prot ? ? 'X-RAY DIFFRACTION' ? 22.1 ? ? ? c_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 0.67 ? ? ? c_improper_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 1.31 1.50 ? ? c_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.21 2.00 ? ? c_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.99 2.00 ? ? c_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.97 2.50 ? ? c_scangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 108 _refine_ls_shell.number_reflns_R_work 2008 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.percent_reflns_R_free 5.1 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.317 _refine_ls_shell.R_factor_R_free_error 0.031 _refine_ls_shell.R_factor_R_work 0.293 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 6CZ2 _pdbx_refine.R_factor_all_no_cutoff 0.206 _pdbx_refine.R_factor_obs_no_cutoff 0.203 _pdbx_refine.free_R_factor_no_cutoff 0.246 _pdbx_refine.free_R_error_no_cutoff 0.010 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5.1 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 637 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 ACCELRYS_CNX:libraries/toppar/protein_rep.para ACCELRYS_CNX:libraries/toppar/protein.top 'X-RAY DIFFRACTION' 2 ACCELRYS_CNX:libraries/toppar/dna-rna_rep.para ACCELRYS_CNX:libraries/toppar/dna-rna.top 'X-RAY DIFFRACTION' 3 ACCELRYS_CNX:libraries/toppar/water_rep.param ACCELRYS_CNX:libraries/toppar/water.top 'X-RAY DIFFRACTION' 4 ACCELRYS_CNX:libraries/toppar/ion.param ACCELRYS_CNX:libraries/toppar/ion.top # _struct.entry_id 6CZ2 _struct.title 'Structure of the PTK6 kinase domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CZ2 _struct_keywords.text 'Protein kinase, PTK6, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 8 ? GLU A 10 ? PRO A 187 GLU A 189 5 ? 3 HELX_P HELX_P2 AA2 SER A 43 ? LEU A 47 ? SER A 222 LEU A 226 5 ? 5 HELX_P HELX_P3 AA3 HIS A 49 ? LYS A 62 ? HIS A 228 LYS A 241 1 ? 14 HELX_P HELX_P4 AA4 LEU A 93 ? SER A 100 ? LEU A 272 SER A 279 1 ? 8 HELX_P HELX_P5 AA5 PRO A 106 ? SER A 126 ? PRO A 285 SER A 305 1 ? 21 HELX_P HELX_P6 AA6 ALA A 135 ? ARG A 137 ? ALA A 314 ARG A 316 5 ? 3 HELX_P HELX_P7 AA7 GLU A 143 ? THR A 145 ? GLU A 322 THR A 324 5 ? 3 HELX_P HELX_P8 AA8 GLY A 153 ? LEU A 157 ? GLY A 332 LEU A 336 5 ? 5 HELX_P HELX_P9 AA9 ILE A 170 ? THR A 175 ? ILE A 349 THR A 354 5 ? 6 HELX_P HELX_P10 AB1 ALA A 176 ? GLY A 183 ? ALA A 355 GLY A 362 1 ? 8 HELX_P HELX_P11 AB2 SER A 186 ? SER A 203 ? SER A 365 SER A 382 1 ? 18 HELX_P HELX_P12 AB3 SER A 213 ? ALA A 223 ? SER A 392 ALA A 402 1 ? 11 HELX_P HELX_P13 AB4 PRO A 234 ? TRP A 245 ? PRO A 413 TRP A 424 1 ? 12 HELX_P HELX_P14 AB5 CYS A 254 ? LEU A 262 ? CYS A 433 LEU A 441 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 162 C ? ? ? 1_555 A PTR 163 N ? ? A VAL 341 A PTR 342 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale2 covale both ? A PTR 163 C ? ? ? 1_555 A LEU 164 N ? ? A PTR 342 A LEU 343 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 79 A . ? ASP 258 A PRO 80 A ? PRO 259 A 1 -3.81 2 SER 263 A . ? SER 442 A SER 264 A ? SER 443 A 1 -16.50 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 12 ? SER A 20 ? PHE A 191 SER A 199 AA1 2 GLU A 25 ? TRP A 31 ? GLU A 204 TRP A 210 AA1 3 VAL A 35 ? ILE A 42 ? VAL A 214 ILE A 221 AA1 4 VAL A 81 ? THR A 85 ? VAL A 260 THR A 264 AA1 5 LEU A 71 ? VAL A 75 ? LEU A 250 VAL A 254 AA2 1 GLY A 91 ? SER A 92 ? GLY A 270 SER A 271 AA2 2 ILE A 139 ? VAL A 141 ? ILE A 318 VAL A 320 AA2 3 CYS A 147 ? VAL A 149 ? CYS A 326 VAL A 328 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 18 ? N LEU A 197 O VAL A 26 ? O VAL A 205 AA1 2 3 N GLY A 29 ? N GLY A 208 O VAL A 37 ? O VAL A 216 AA1 3 4 N LYS A 40 ? N LYS A 219 O ILE A 83 ? O ILE A 262 AA1 4 5 O ILE A 84 ? O ILE A 263 N ALA A 73 ? N ALA A 252 AA2 1 2 N GLY A 91 ? N GLY A 270 O VAL A 141 ? O VAL A 320 AA2 2 3 N LEU A 140 ? N LEU A 319 O LYS A 148 ? O LYS A 327 # _database_PDB_matrix.entry_id 6CZ2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6CZ2 _atom_sites.fract_transf_matrix[1][1] 0.009206 _atom_sites.fract_transf_matrix[1][2] 0.005315 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010630 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011905 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 180 ? ? ? A . n A 1 2 SER 2 181 ? ? ? A . n A 1 3 ASP 3 182 182 ASP ASP A . n A 1 4 ASP 4 183 183 ASP ASP A . n A 1 5 ALA 5 184 184 ALA ALA A . n A 1 6 GLU 6 185 185 GLU GLU A . n A 1 7 ARG 7 186 186 ARG ARG A . n A 1 8 PRO 8 187 187 PRO PRO A . n A 1 9 ARG 9 188 188 ARG ARG A . n A 1 10 GLU 10 189 189 GLU GLU A . n A 1 11 GLU 11 190 190 GLU GLU A . n A 1 12 PHE 12 191 191 PHE PHE A . n A 1 13 THR 13 192 192 THR THR A . n A 1 14 LEU 14 193 193 LEU LEU A . n A 1 15 CYS 15 194 194 CYS CYS A . n A 1 16 ARG 16 195 195 ARG ARG A . n A 1 17 LYS 17 196 196 LYS LYS A . n A 1 18 LEU 18 197 197 LEU LEU A . n A 1 19 GLY 19 198 198 GLY GLY A . n A 1 20 SER 20 199 199 SER SER A . n A 1 21 GLY 21 200 200 GLY GLY A . n A 1 22 TYR 22 201 201 TYR TYR A . n A 1 23 PHE 23 202 202 PHE PHE A . n A 1 24 GLY 24 203 203 GLY GLY A . n A 1 25 GLU 25 204 204 GLU GLU A . n A 1 26 VAL 26 205 205 VAL VAL A . n A 1 27 PHE 27 206 206 PHE PHE A . n A 1 28 GLU 28 207 207 GLU GLU A . n A 1 29 GLY 29 208 208 GLY GLY A . n A 1 30 LEU 30 209 209 LEU LEU A . n A 1 31 TRP 31 210 210 TRP TRP A . n A 1 32 LYS 32 211 211 LYS LYS A . n A 1 33 ASP 33 212 212 ASP ASP A . n A 1 34 ARG 34 213 213 ARG ARG A . n A 1 35 VAL 35 214 214 VAL VAL A . n A 1 36 GLN 36 215 215 GLN GLN A . n A 1 37 VAL 37 216 216 VAL VAL A . n A 1 38 ALA 38 217 217 ALA ALA A . n A 1 39 ILE 39 218 218 ILE ILE A . n A 1 40 LYS 40 219 219 LYS LYS A . n A 1 41 VAL 41 220 220 VAL VAL A . n A 1 42 ILE 42 221 221 ILE ILE A . n A 1 43 SER 43 222 222 SER SER A . n A 1 44 ARG 44 223 223 ARG ARG A . n A 1 45 ASP 45 224 224 ASP ASP A . n A 1 46 ASN 46 225 225 ASN ASN A . n A 1 47 LEU 47 226 226 LEU LEU A . n A 1 48 LEU 48 227 227 LEU LEU A . n A 1 49 HIS 49 228 228 HIS HIS A . n A 1 50 GLN 50 229 229 GLN GLN A . n A 1 51 GLN 51 230 230 GLN GLN A . n A 1 52 MET 52 231 231 MET MET A . n A 1 53 LEU 53 232 232 LEU LEU A . n A 1 54 GLN 54 233 233 GLN GLN A . n A 1 55 SER 55 234 234 SER SER A . n A 1 56 GLU 56 235 235 GLU GLU A . n A 1 57 ILE 57 236 236 ILE ILE A . n A 1 58 GLN 58 237 237 GLN GLN A . n A 1 59 ALA 59 238 238 ALA ALA A . n A 1 60 MET 60 239 239 MET MET A . n A 1 61 LYS 61 240 240 LYS LYS A . n A 1 62 LYS 62 241 241 LYS LYS A . n A 1 63 LEU 63 242 242 LEU LEU A . n A 1 64 ARG 64 243 243 ARG ARG A . n A 1 65 HIS 65 244 244 HIS HIS A . n A 1 66 LYS 66 245 245 LYS LYS A . n A 1 67 HIS 67 246 246 HIS HIS A . n A 1 68 ILE 68 247 247 ILE ILE A . n A 1 69 LEU 69 248 248 LEU LEU A . n A 1 70 ALA 70 249 249 ALA ALA A . n A 1 71 LEU 71 250 250 LEU LEU A . n A 1 72 TYR 72 251 251 TYR TYR A . n A 1 73 ALA 73 252 252 ALA ALA A . n A 1 74 VAL 74 253 253 VAL VAL A . n A 1 75 VAL 75 254 254 VAL VAL A . n A 1 76 SER 76 255 255 SER SER A . n A 1 77 VAL 77 256 256 VAL VAL A . n A 1 78 GLY 78 257 257 GLY GLY A . n A 1 79 ASP 79 258 258 ASP ASP A . n A 1 80 PRO 80 259 259 PRO PRO A . n A 1 81 VAL 81 260 260 VAL VAL A . n A 1 82 TYR 82 261 261 TYR TYR A . n A 1 83 ILE 83 262 262 ILE ILE A . n A 1 84 ILE 84 263 263 ILE ILE A . n A 1 85 THR 85 264 264 THR THR A . n A 1 86 GLU 86 265 265 GLU GLU A . n A 1 87 LEU 87 266 266 LEU LEU A . n A 1 88 MET 88 267 267 MET MET A . n A 1 89 ALA 89 268 268 ALA ALA A . n A 1 90 LYS 90 269 269 LYS LYS A . n A 1 91 GLY 91 270 270 GLY GLY A . n A 1 92 SER 92 271 271 SER SER A . n A 1 93 LEU 93 272 272 LEU LEU A . n A 1 94 LEU 94 273 273 LEU LEU A . n A 1 95 GLU 95 274 274 GLU GLU A . n A 1 96 LEU 96 275 275 LEU LEU A . n A 1 97 LEU 97 276 276 LEU LEU A . n A 1 98 ARG 98 277 277 ARG ARG A . n A 1 99 ASP 99 278 278 ASP ASP A . n A 1 100 SER 100 279 279 SER SER A . n A 1 101 ASP 101 280 280 ASP ASP A . n A 1 102 GLU 102 281 281 GLU GLU A . n A 1 103 LYS 103 282 282 LYS LYS A . n A 1 104 VAL 104 283 283 VAL VAL A . n A 1 105 LEU 105 284 284 LEU LEU A . n A 1 106 PRO 106 285 285 PRO PRO A . n A 1 107 VAL 107 286 286 VAL VAL A . n A 1 108 SER 108 287 287 SER SER A . n A 1 109 GLU 109 288 288 GLU GLU A . n A 1 110 LEU 110 289 289 LEU LEU A . n A 1 111 LEU 111 290 290 LEU LEU A . n A 1 112 ASP 112 291 291 ASP ASP A . n A 1 113 ILE 113 292 292 ILE ILE A . n A 1 114 ALA 114 293 293 ALA ALA A . n A 1 115 TRP 115 294 294 TRP TRP A . n A 1 116 GLN 116 295 295 GLN GLN A . n A 1 117 VAL 117 296 296 VAL VAL A . n A 1 118 ALA 118 297 297 ALA ALA A . n A 1 119 GLU 119 298 298 GLU GLU A . n A 1 120 GLY 120 299 299 GLY GLY A . n A 1 121 MET 121 300 300 MET MET A . n A 1 122 CYS 122 301 301 CYS CYS A . n A 1 123 TYR 123 302 302 TYR TYR A . n A 1 124 LEU 124 303 303 LEU LEU A . n A 1 125 GLU 125 304 304 GLU GLU A . n A 1 126 SER 126 305 305 SER SER A . n A 1 127 GLN 127 306 306 GLN GLN A . n A 1 128 ASN 128 307 307 ASN ASN A . n A 1 129 TYR 129 308 308 TYR TYR A . n A 1 130 ILE 130 309 309 ILE ILE A . n A 1 131 HIS 131 310 310 HIS HIS A . n A 1 132 ARG 132 311 311 ARG ARG A . n A 1 133 ASP 133 312 312 ASP ASP A . n A 1 134 LEU 134 313 313 LEU LEU A . n A 1 135 ALA 135 314 314 ALA ALA A . n A 1 136 ALA 136 315 315 ALA ALA A . n A 1 137 ARG 137 316 316 ARG ARG A . n A 1 138 ASN 138 317 317 ASN ASN A . n A 1 139 ILE 139 318 318 ILE ILE A . n A 1 140 LEU 140 319 319 LEU LEU A . n A 1 141 VAL 141 320 320 VAL VAL A . n A 1 142 GLY 142 321 321 GLY GLY A . n A 1 143 GLU 143 322 322 GLU GLU A . n A 1 144 ASN 144 323 323 ASN ASN A . n A 1 145 THR 145 324 324 THR THR A . n A 1 146 LEU 146 325 325 LEU LEU A . n A 1 147 CYS 147 326 326 CYS CYS A . n A 1 148 LYS 148 327 327 LYS LYS A . n A 1 149 VAL 149 328 328 VAL VAL A . n A 1 150 GLY 150 329 329 GLY GLY A . n A 1 151 ASP 151 330 330 ASP ASP A . n A 1 152 PHE 152 331 331 PHE PHE A . n A 1 153 GLY 153 332 332 GLY GLY A . n A 1 154 LEU 154 333 333 LEU LEU A . n A 1 155 ALA 155 334 334 ALA ALA A . n A 1 156 ARG 156 335 335 ARG ARG A . n A 1 157 LEU 157 336 336 LEU LEU A . n A 1 158 ILE 158 337 337 ILE ILE A . n A 1 159 LYS 159 338 338 LYS LYS A . n A 1 160 GLU 160 339 339 GLU GLU A . n A 1 161 ASP 161 340 340 ASP ASP A . n A 1 162 VAL 162 341 341 VAL VAL A . n A 1 163 PTR 163 342 342 PTR PTR A . n A 1 164 LEU 164 343 343 LEU LEU A . n A 1 165 SER 165 344 344 SER SER A . n A 1 166 HIS 166 345 345 HIS HIS A . n A 1 167 ASP 167 346 346 ASP ASP A . n A 1 168 HIS 168 347 347 HIS HIS A . n A 1 169 ASN 169 348 348 ASN ASN A . n A 1 170 ILE 170 349 349 ILE ILE A . n A 1 171 PRO 171 350 350 PRO PRO A . n A 1 172 TYR 172 351 351 TYR TYR A . n A 1 173 LYS 173 352 352 LYS LYS A . n A 1 174 TRP 174 353 353 TRP TRP A . n A 1 175 THR 175 354 354 THR THR A . n A 1 176 ALA 176 355 355 ALA ALA A . n A 1 177 PRO 177 356 356 PRO PRO A . n A 1 178 GLU 178 357 357 GLU GLU A . n A 1 179 ALA 179 358 358 ALA ALA A . n A 1 180 LEU 180 359 359 LEU LEU A . n A 1 181 SER 181 360 360 SER SER A . n A 1 182 ARG 182 361 361 ARG ARG A . n A 1 183 GLY 183 362 362 GLY GLY A . n A 1 184 HIS 184 363 363 HIS HIS A . n A 1 185 TYR 185 364 364 TYR TYR A . n A 1 186 SER 186 365 365 SER SER A . n A 1 187 THR 187 366 366 THR THR A . n A 1 188 LYS 188 367 367 LYS LYS A . n A 1 189 SER 189 368 368 SER SER A . n A 1 190 ASP 190 369 369 ASP ASP A . n A 1 191 VAL 191 370 370 VAL VAL A . n A 1 192 TRP 192 371 371 TRP TRP A . n A 1 193 SER 193 372 372 SER SER A . n A 1 194 PHE 194 373 373 PHE PHE A . n A 1 195 GLY 195 374 374 GLY GLY A . n A 1 196 ILE 196 375 375 ILE ILE A . n A 1 197 LEU 197 376 376 LEU LEU A . n A 1 198 LEU 198 377 377 LEU LEU A . n A 1 199 HIS 199 378 378 HIS HIS A . n A 1 200 GLU 200 379 379 GLU GLU A . n A 1 201 MET 201 380 380 MET MET A . n A 1 202 PHE 202 381 381 PHE PHE A . n A 1 203 SER 203 382 382 SER SER A . n A 1 204 ARG 204 383 383 ARG ARG A . n A 1 205 GLY 205 384 384 GLY GLY A . n A 1 206 GLN 206 385 385 GLN GLN A . n A 1 207 VAL 207 386 386 VAL VAL A . n A 1 208 PRO 208 387 387 PRO PRO A . n A 1 209 TYR 209 388 388 TYR TYR A . n A 1 210 PRO 210 389 389 PRO PRO A . n A 1 211 GLY 211 390 390 GLY GLY A . n A 1 212 MET 212 391 391 MET MET A . n A 1 213 SER 213 392 392 SER SER A . n A 1 214 ASN 214 393 393 ASN ASN A . n A 1 215 HIS 215 394 394 HIS HIS A . n A 1 216 GLU 216 395 395 GLU GLU A . n A 1 217 ALA 217 396 396 ALA ALA A . n A 1 218 PHE 218 397 397 PHE PHE A . n A 1 219 LEU 219 398 398 LEU LEU A . n A 1 220 ARG 220 399 399 ARG ARG A . n A 1 221 VAL 221 400 400 VAL VAL A . n A 1 222 ASP 222 401 401 ASP ASP A . n A 1 223 ALA 223 402 402 ALA ALA A . n A 1 224 GLY 224 403 403 GLY GLY A . n A 1 225 TYR 225 404 404 TYR TYR A . n A 1 226 ARG 226 405 405 ARG ARG A . n A 1 227 MET 227 406 406 MET MET A . n A 1 228 PRO 228 407 407 PRO PRO A . n A 1 229 CYS 229 408 408 CYS CYS A . n A 1 230 PRO 230 409 409 PRO PRO A . n A 1 231 LEU 231 410 410 LEU LEU A . n A 1 232 GLU 232 411 411 GLU GLU A . n A 1 233 CYS 233 412 412 CYS CYS A . n A 1 234 PRO 234 413 413 PRO PRO A . n A 1 235 PRO 235 414 414 PRO PRO A . n A 1 236 SER 236 415 415 SER SER A . n A 1 237 VAL 237 416 416 VAL VAL A . n A 1 238 HIS 238 417 417 HIS HIS A . n A 1 239 LYS 239 418 418 LYS LYS A . n A 1 240 LEU 240 419 419 LEU LEU A . n A 1 241 MET 241 420 420 MET MET A . n A 1 242 LEU 242 421 421 LEU LEU A . n A 1 243 THR 243 422 422 THR THR A . n A 1 244 CYS 244 423 423 CYS CYS A . n A 1 245 TRP 245 424 424 TRP TRP A . n A 1 246 CYS 246 425 425 CYS CYS A . n A 1 247 ARG 247 426 426 ARG ARG A . n A 1 248 ASP 248 427 427 ASP ASP A . n A 1 249 PRO 249 428 428 PRO PRO A . n A 1 250 GLU 250 429 429 GLU GLU A . n A 1 251 GLN 251 430 430 GLN GLN A . n A 1 252 ARG 252 431 431 ARG ARG A . n A 1 253 PRO 253 432 432 PRO PRO A . n A 1 254 CYS 254 433 433 CYS CYS A . n A 1 255 PHE 255 434 434 PHE PHE A . n A 1 256 LYS 256 435 435 LYS LYS A . n A 1 257 ALA 257 436 436 ALA ALA A . n A 1 258 LEU 258 437 437 LEU LEU A . n A 1 259 ARG 259 438 438 ARG ARG A . n A 1 260 GLU 260 439 439 GLU GLU A . n A 1 261 ARG 261 440 440 ARG ARG A . n A 1 262 LEU 262 441 441 LEU LEU A . n A 1 263 SER 263 442 442 SER SER A . n A 1 264 SER 264 443 443 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 501 13 HOH WAT A . B 2 HOH 2 502 19 HOH WAT A . B 2 HOH 3 503 24 HOH WAT A . B 2 HOH 4 504 16 HOH WAT A . B 2 HOH 5 505 8 HOH WAT A . B 2 HOH 6 506 21 HOH WAT A . B 2 HOH 7 507 20 HOH WAT A . B 2 HOH 8 508 11 HOH WAT A . B 2 HOH 9 509 6 HOH WAT A . B 2 HOH 10 510 15 HOH WAT A . B 2 HOH 11 511 9 HOH WAT A . B 2 HOH 12 512 12 HOH WAT A . B 2 HOH 13 513 1 HOH WAT A . B 2 HOH 14 514 3 HOH WAT A . B 2 HOH 15 515 18 HOH WAT A . B 2 HOH 16 516 17 HOH WAT A . B 2 HOH 17 517 5 HOH WAT A . B 2 HOH 18 518 4 HOH WAT A . B 2 HOH 19 519 14 HOH WAT A . B 2 HOH 20 520 2 HOH WAT A . B 2 HOH 21 521 22 HOH WAT A . B 2 HOH 22 522 10 HOH WAT A . B 2 HOH 23 523 7 HOH WAT A . B 2 HOH 24 524 23 HOH WAT A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 163 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 342 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-27 2 'Structure model' 1 1 2023-10-04 3 'Structure model' 1 2 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_chem_comp_atom.atom_id' 4 3 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? CNX ? ? ? 2005 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? CNX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 195 ? ? 179.46 142.48 2 1 ARG A 213 ? ? -142.05 -40.09 3 1 SER A 279 ? ? -54.16 109.95 4 1 ASP A 280 ? ? -109.48 78.44 5 1 PRO A 285 ? ? -68.97 60.25 6 1 ARG A 311 ? ? 88.03 -15.86 7 1 ASP A 312 ? ? -147.19 57.81 8 1 ALA A 402 ? ? -77.43 20.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 180 ? A GLY 1 2 1 Y 1 A SER 181 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 PTR N N N N 290 PTR CA C N S 291 PTR C C N N 292 PTR O O N N 293 PTR OXT O N N 294 PTR CB C N N 295 PTR CG C Y N 296 PTR CD1 C Y N 297 PTR CD2 C Y N 298 PTR CE1 C Y N 299 PTR CE2 C Y N 300 PTR CZ C Y N 301 PTR OH O N N 302 PTR P P N N 303 PTR O1P O N N 304 PTR O2P O N N 305 PTR O3P O N N 306 PTR H H N N 307 PTR H2 H N N 308 PTR HA H N N 309 PTR HXT H N N 310 PTR HB2 H N N 311 PTR HB3 H N N 312 PTR HD1 H N N 313 PTR HD2 H N N 314 PTR HE1 H N N 315 PTR HE2 H N N 316 PTR HO2P H N N 317 PTR HO3P H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PTR N CA sing N N 277 PTR N H sing N N 278 PTR N H2 sing N N 279 PTR CA C sing N N 280 PTR CA CB sing N N 281 PTR CA HA sing N N 282 PTR C O doub N N 283 PTR C OXT sing N N 284 PTR OXT HXT sing N N 285 PTR CB CG sing N N 286 PTR CB HB2 sing N N 287 PTR CB HB3 sing N N 288 PTR CG CD1 doub Y N 289 PTR CG CD2 sing Y N 290 PTR CD1 CE1 sing Y N 291 PTR CD1 HD1 sing N N 292 PTR CD2 CE2 doub Y N 293 PTR CD2 HD2 sing N N 294 PTR CE1 CZ doub Y N 295 PTR CE1 HE1 sing N N 296 PTR CE2 CZ sing Y N 297 PTR CE2 HE2 sing N N 298 PTR CZ OH sing N N 299 PTR OH P sing N N 300 PTR P O1P doub N N 301 PTR P O2P sing N N 302 PTR P O3P sing N N 303 PTR O2P HO2P sing N N 304 PTR O3P HO3P sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FMK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #