data_6D3N # _entry.id 6D3N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6D3N pdb_00006d3n 10.2210/pdb6d3n/pdb WWPDB D_1000233946 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6D3N _pdbx_database_status.recvd_initial_deposition_date 2018-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Aruna, B.' 1 ? 'Zajonc, D.M.' 2 ? 'Doukov, T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 9958 _citation.page_last 9969 _citation.title ;Crystal structures of the human 4-1BB receptor bound to its ligand 4-1BBL reveal covalent receptor dimerization as a potential signaling amplifier. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.003176 _citation.pdbx_database_id_PubMed 29720398 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bitra, A.' 1 ? primary 'Doukov, T.' 2 ? primary 'Croft, M.' 3 ? primary 'Zajonc, D.M.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6D3N _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.167 _cell.length_a_esd ? _cell.length_b 73.167 _cell.length_b_esd ? _cell.length_c 162.814 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6D3N _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tumor necrosis factor ligand superfamily member 9' 18317.826 1 ? ? 'residues 80-244' ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '4-1BB ligand,4-1BBL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR VTPEIHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR VTPEIHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 PRO n 1 3 ALA n 1 4 GLY n 1 5 LEU n 1 6 LEU n 1 7 ASP n 1 8 LEU n 1 9 ARG n 1 10 GLN n 1 11 GLY n 1 12 MET n 1 13 PHE n 1 14 ALA n 1 15 GLN n 1 16 LEU n 1 17 VAL n 1 18 ALA n 1 19 GLN n 1 20 ASN n 1 21 VAL n 1 22 LEU n 1 23 LEU n 1 24 ILE n 1 25 ASP n 1 26 GLY n 1 27 PRO n 1 28 LEU n 1 29 SER n 1 30 TRP n 1 31 TYR n 1 32 SER n 1 33 ASP n 1 34 PRO n 1 35 GLY n 1 36 LEU n 1 37 ALA n 1 38 GLY n 1 39 VAL n 1 40 SER n 1 41 LEU n 1 42 THR n 1 43 GLY n 1 44 GLY n 1 45 LEU n 1 46 SER n 1 47 TYR n 1 48 LYS n 1 49 GLU n 1 50 ASP n 1 51 THR n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 VAL n 1 56 VAL n 1 57 ALA n 1 58 LYS n 1 59 ALA n 1 60 GLY n 1 61 VAL n 1 62 TYR n 1 63 TYR n 1 64 VAL n 1 65 PHE n 1 66 PHE n 1 67 GLN n 1 68 LEU n 1 69 GLU n 1 70 LEU n 1 71 ARG n 1 72 ARG n 1 73 VAL n 1 74 VAL n 1 75 ALA n 1 76 GLY n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLY n 1 81 SER n 1 82 VAL n 1 83 SER n 1 84 LEU n 1 85 ALA n 1 86 LEU n 1 87 HIS n 1 88 LEU n 1 89 GLN n 1 90 PRO n 1 91 LEU n 1 92 ARG n 1 93 SER n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 ALA n 1 98 ALA n 1 99 ALA n 1 100 LEU n 1 101 ALA n 1 102 LEU n 1 103 THR n 1 104 VAL n 1 105 ASP n 1 106 LEU n 1 107 PRO n 1 108 PRO n 1 109 ALA n 1 110 SER n 1 111 SER n 1 112 GLU n 1 113 ALA n 1 114 ARG n 1 115 ASN n 1 116 SER n 1 117 ALA n 1 118 PHE n 1 119 GLY n 1 120 PHE n 1 121 GLN n 1 122 GLY n 1 123 ARG n 1 124 LEU n 1 125 LEU n 1 126 HIS n 1 127 LEU n 1 128 SER n 1 129 ALA n 1 130 GLY n 1 131 GLN n 1 132 ARG n 1 133 LEU n 1 134 GLY n 1 135 VAL n 1 136 HIS n 1 137 LEU n 1 138 HIS n 1 139 THR n 1 140 GLU n 1 141 ALA n 1 142 ARG n 1 143 ALA n 1 144 ARG n 1 145 HIS n 1 146 ALA n 1 147 TRP n 1 148 GLN n 1 149 LEU n 1 150 THR n 1 151 GLN n 1 152 GLY n 1 153 ALA n 1 154 THR n 1 155 VAL n 1 156 LEU n 1 157 GLY n 1 158 LEU n 1 159 PHE n 1 160 ARG n 1 161 VAL n 1 162 THR n 1 163 PRO n 1 164 GLU n 1 165 ILE n 1 166 HIS n 1 167 HIS n 1 168 HIS n 1 169 HIS n 1 170 HIS n 1 171 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TNFSF9 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Insect cell expression vector pTIE1' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 266783 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNFL9_HUMAN _struct_ref.pdbx_db_accession P41273 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR VTPEI ; _struct_ref.pdbx_align_begin 80 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6D3N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41273 _struct_ref_seq.db_align_beg 80 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 244 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 80 _struct_ref_seq.pdbx_auth_seq_align_end 244 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6D3N HIS A 166 ? UNP P41273 ? ? 'expression tag' 245 1 1 6D3N HIS A 167 ? UNP P41273 ? ? 'expression tag' 246 2 1 6D3N HIS A 168 ? UNP P41273 ? ? 'expression tag' 247 3 1 6D3N HIS A 169 ? UNP P41273 ? ? 'expression tag' 248 4 1 6D3N HIS A 170 ? UNP P41273 ? ? 'expression tag' 249 5 1 6D3N HIS A 171 ? UNP P41273 ? ? 'expression tag' 250 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6D3N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.085M tri- Na citrate, pH 5.6, 25.5% PEG 4000 0.17M Amm acetate 15% glycerol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6D3N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 59.050 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4818 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.200 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 117 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.101 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 44504 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.830 ? ? ? ? ? ? 630 99.400 ? ? ? ? 0.859 ? ? ? ? ? ? ? ? 8.400 ? ? ? ? 0.913 0.303 ? 1 1 0.927 ? 8.960 59.050 ? ? ? ? ? ? 157 98.500 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 7.900 ? ? ? ? 0.078 0.028 ? 2 1 0.993 ? # _refine.aniso_B[1][1] 0.0800 _refine.aniso_B[1][2] 0.0400 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.2600 _refine.B_iso_max 169.630 _refine.B_iso_mean 77.1540 _refine.B_iso_min 46.240 _refine.correlation_coeff_Fo_to_Fc 0.9470 _refine.correlation_coeff_Fo_to_Fc_free 0.9070 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6D3N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 59.0500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4340 _refine.ls_number_reflns_R_free 475 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3400 _refine.ls_percent_reflns_R_free 9.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2119 _refine.ls_R_factor_R_free 0.2523 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2076 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6CPR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.1240 _refine.pdbx_overall_ESU_R_Free 0.3420 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.7550 _refine.overall_SU_ML 0.2710 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 59.0500 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1017 _refine_hist.pdbx_number_residues_total 137 _refine_hist.pdbx_B_iso_mean_ligand 118.37 _refine_hist.pdbx_B_iso_mean_solvent 86.74 _refine_hist.pdbx_number_atoms_protein 1001 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 1024 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 963 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.267 1.966 1393 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.853 3.000 2196 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.590 5.000 133 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.999 22.973 37 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.486 15.000 143 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.062 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 170 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1139 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 214 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7000 _refine_ls_shell.d_res_low 2.7700 _refine_ls_shell.number_reflns_all 349 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_R_work 318 _refine_ls_shell.percent_reflns_obs 99.1500 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3370 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3210 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6D3N _struct.title 'Crystal structure of h4-1BB ligand' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6D3N _struct_keywords.text 'TNF, bell shape fold, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 30 ? SER A 32 ? TRP A 109 SER A 111 AA1 2 PHE A 13 ? ALA A 18 ? PHE A 92 ALA A 97 AA1 3 VAL A 155 ? ARG A 160 ? VAL A 234 ARG A 239 AA1 4 GLY A 60 ? ARG A 72 ? GLY A 139 ARG A 151 AA1 5 SER A 116 ? LEU A 127 ? SER A 195 LEU A 206 AA2 1 TRP A 30 ? SER A 32 ? TRP A 109 SER A 111 AA2 2 PHE A 13 ? ALA A 18 ? PHE A 92 ALA A 97 AA2 3 VAL A 155 ? ARG A 160 ? VAL A 234 ARG A 239 AA2 4 GLY A 60 ? ARG A 72 ? GLY A 139 ARG A 151 AA2 5 TRP A 147 ? LEU A 149 ? TRP A 226 LEU A 228 AA3 1 GLY A 26 ? PRO A 27 ? GLY A 105 PRO A 106 AA3 2 ARG A 132 ? ALA A 141 ? ARG A 211 ALA A 220 AA3 3 GLU A 53 ? VAL A 55 ? GLU A 132 VAL A 134 AA3 4 SER A 46 ? LYS A 48 ? SER A 125 LYS A 127 AA4 1 GLY A 26 ? PRO A 27 ? GLY A 105 PRO A 106 AA4 2 ARG A 132 ? ALA A 141 ? ARG A 211 ALA A 220 AA4 3 GLY A 80 ? LEU A 88 ? GLY A 159 LEU A 167 AA4 4 LEU A 100 ? LEU A 106 ? LEU A 179 LEU A 185 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 31 ? O TYR A 110 N VAL A 17 ? N VAL A 96 AA1 2 3 N LEU A 16 ? N LEU A 95 O LEU A 156 ? O LEU A 235 AA1 3 4 O GLY A 157 ? O GLY A 236 N PHE A 65 ? N PHE A 144 AA1 4 5 N GLY A 60 ? N GLY A 139 O LEU A 127 ? O LEU A 206 AA2 1 2 O TYR A 31 ? O TYR A 110 N VAL A 17 ? N VAL A 96 AA2 2 3 N LEU A 16 ? N LEU A 95 O LEU A 156 ? O LEU A 235 AA2 3 4 O GLY A 157 ? O GLY A 236 N PHE A 65 ? N PHE A 144 AA2 4 5 N ARG A 71 ? N ARG A 150 O GLN A 148 ? O GLN A 227 AA3 1 2 N GLY A 26 ? N GLY A 105 O LEU A 137 ? O LEU A 216 AA3 2 3 O LEU A 133 ? O LEU A 212 N LEU A 54 ? N LEU A 133 AA3 3 4 O VAL A 55 ? O VAL A 134 N SER A 46 ? N SER A 125 AA4 1 2 N GLY A 26 ? N GLY A 105 O LEU A 137 ? O LEU A 216 AA4 2 3 O HIS A 138 ? O HIS A 217 N SER A 83 ? N SER A 162 AA4 3 4 N LEU A 86 ? N LEU A 165 O LEU A 100 ? O LEU A 179 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'binding site for residue GOL A 601' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id LEU _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 36 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id LEU _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 115 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _atom_sites.entry_id 6D3N _atom_sites.fract_transf_matrix[1][1] 0.013667 _atom_sites.fract_transf_matrix[1][2] 0.007891 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015782 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006142 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 80 ? ? ? A . n A 1 2 PRO 2 81 ? ? ? A . n A 1 3 ALA 3 82 ? ? ? A . n A 1 4 GLY 4 83 ? ? ? A . n A 1 5 LEU 5 84 ? ? ? A . n A 1 6 LEU 6 85 ? ? ? A . n A 1 7 ASP 7 86 ? ? ? A . n A 1 8 LEU 8 87 ? ? ? A . n A 1 9 ARG 9 88 ? ? ? A . n A 1 10 GLN 10 89 ? ? ? A . n A 1 11 GLY 11 90 ? ? ? A . n A 1 12 MET 12 91 91 MET MET A . n A 1 13 PHE 13 92 92 PHE PHE A . n A 1 14 ALA 14 93 93 ALA ALA A . n A 1 15 GLN 15 94 94 GLN GLN A . n A 1 16 LEU 16 95 95 LEU LEU A . n A 1 17 VAL 17 96 96 VAL VAL A . n A 1 18 ALA 18 97 97 ALA ALA A . n A 1 19 GLN 19 98 98 GLN GLN A . n A 1 20 ASN 20 99 99 ASN ASN A . n A 1 21 VAL 21 100 100 VAL VAL A . n A 1 22 LEU 22 101 101 LEU LEU A . n A 1 23 LEU 23 102 102 LEU LEU A . n A 1 24 ILE 24 103 103 ILE ILE A . n A 1 25 ASP 25 104 104 ASP ASP A . n A 1 26 GLY 26 105 105 GLY GLY A . n A 1 27 PRO 27 106 106 PRO PRO A . n A 1 28 LEU 28 107 107 LEU LEU A . n A 1 29 SER 29 108 108 SER SER A . n A 1 30 TRP 30 109 109 TRP TRP A . n A 1 31 TYR 31 110 110 TYR TYR A . n A 1 32 SER 32 111 111 SER SER A . n A 1 33 ASP 33 112 112 ASP ASP A . n A 1 34 PRO 34 113 113 PRO PRO A . n A 1 35 GLY 35 114 114 GLY GLY A . n A 1 36 LEU 36 115 115 LEU LEU A . n A 1 37 ALA 37 116 ? ? ? A . n A 1 38 GLY 38 117 ? ? ? A . n A 1 39 VAL 39 118 ? ? ? A . n A 1 40 SER 40 119 ? ? ? A . n A 1 41 LEU 41 120 ? ? ? A . n A 1 42 THR 42 121 ? ? ? A . n A 1 43 GLY 43 122 ? ? ? A . n A 1 44 GLY 44 123 ? ? ? A . n A 1 45 LEU 45 124 124 LEU LEU A . n A 1 46 SER 46 125 125 SER SER A . n A 1 47 TYR 47 126 126 TYR TYR A . n A 1 48 LYS 48 127 127 LYS LYS A . n A 1 49 GLU 49 128 128 GLU GLU A . n A 1 50 ASP 50 129 129 ASP ASP A . n A 1 51 THR 51 130 130 THR THR A . n A 1 52 LYS 52 131 131 LYS LYS A . n A 1 53 GLU 53 132 132 GLU GLU A . n A 1 54 LEU 54 133 133 LEU LEU A . n A 1 55 VAL 55 134 134 VAL VAL A . n A 1 56 VAL 56 135 135 VAL VAL A . n A 1 57 ALA 57 136 136 ALA ALA A . n A 1 58 LYS 58 137 137 LYS LYS A . n A 1 59 ALA 59 138 138 ALA ALA A . n A 1 60 GLY 60 139 139 GLY GLY A . n A 1 61 VAL 61 140 140 VAL VAL A . n A 1 62 TYR 62 141 141 TYR TYR A . n A 1 63 TYR 63 142 142 TYR TYR A . n A 1 64 VAL 64 143 143 VAL VAL A . n A 1 65 PHE 65 144 144 PHE PHE A . n A 1 66 PHE 66 145 145 PHE PHE A . n A 1 67 GLN 67 146 146 GLN GLN A . n A 1 68 LEU 68 147 147 LEU LEU A . n A 1 69 GLU 69 148 148 GLU GLU A . n A 1 70 LEU 70 149 149 LEU LEU A . n A 1 71 ARG 71 150 150 ARG ARG A . n A 1 72 ARG 72 151 151 ARG ARG A . n A 1 73 VAL 73 152 152 VAL VAL A . n A 1 74 VAL 74 153 153 VAL VAL A . n A 1 75 ALA 75 154 ? ? ? A . n A 1 76 GLY 76 155 ? ? ? A . n A 1 77 GLU 77 156 156 GLU GLU A . n A 1 78 GLY 78 157 157 GLY GLY A . n A 1 79 SER 79 158 158 SER SER A . n A 1 80 GLY 80 159 159 GLY GLY A . n A 1 81 SER 81 160 160 SER SER A . n A 1 82 VAL 82 161 161 VAL VAL A . n A 1 83 SER 83 162 162 SER SER A . n A 1 84 LEU 84 163 163 LEU LEU A . n A 1 85 ALA 85 164 164 ALA ALA A . n A 1 86 LEU 86 165 165 LEU LEU A . n A 1 87 HIS 87 166 166 HIS HIS A . n A 1 88 LEU 88 167 167 LEU LEU A . n A 1 89 GLN 89 168 168 GLN GLN A . n A 1 90 PRO 90 169 169 PRO PRO A . n A 1 91 LEU 91 170 170 LEU LEU A . n A 1 92 ARG 92 171 171 ARG ARG A . n A 1 93 SER 93 172 172 SER SER A . n A 1 94 ALA 94 173 173 ALA ALA A . n A 1 95 ALA 95 174 174 ALA ALA A . n A 1 96 GLY 96 175 175 GLY GLY A . n A 1 97 ALA 97 176 176 ALA ALA A . n A 1 98 ALA 98 177 177 ALA ALA A . n A 1 99 ALA 99 178 178 ALA ALA A . n A 1 100 LEU 100 179 179 LEU LEU A . n A 1 101 ALA 101 180 180 ALA ALA A . n A 1 102 LEU 102 181 181 LEU LEU A . n A 1 103 THR 103 182 182 THR THR A . n A 1 104 VAL 104 183 183 VAL VAL A . n A 1 105 ASP 105 184 184 ASP ASP A . n A 1 106 LEU 106 185 185 LEU LEU A . n A 1 107 PRO 107 186 186 PRO PRO A . n A 1 108 PRO 108 187 187 PRO PRO A . n A 1 109 ALA 109 188 188 ALA ALA A . n A 1 110 SER 110 189 ? ? ? A . n A 1 111 SER 111 190 ? ? ? A . n A 1 112 GLU 112 191 ? ? ? A . n A 1 113 ALA 113 192 ? ? ? A . n A 1 114 ARG 114 193 193 ARG ARG A . n A 1 115 ASN 115 194 194 ASN ASN A . n A 1 116 SER 116 195 195 SER SER A . n A 1 117 ALA 117 196 196 ALA ALA A . n A 1 118 PHE 118 197 197 PHE PHE A . n A 1 119 GLY 119 198 198 GLY GLY A . n A 1 120 PHE 120 199 199 PHE PHE A . n A 1 121 GLN 121 200 200 GLN GLN A . n A 1 122 GLY 122 201 201 GLY GLY A . n A 1 123 ARG 123 202 202 ARG ARG A . n A 1 124 LEU 124 203 203 LEU LEU A . n A 1 125 LEU 125 204 204 LEU LEU A . n A 1 126 HIS 126 205 205 HIS HIS A . n A 1 127 LEU 127 206 206 LEU LEU A . n A 1 128 SER 128 207 207 SER SER A . n A 1 129 ALA 129 208 208 ALA ALA A . n A 1 130 GLY 130 209 209 GLY GLY A . n A 1 131 GLN 131 210 210 GLN GLN A . n A 1 132 ARG 132 211 211 ARG ARG A . n A 1 133 LEU 133 212 212 LEU LEU A . n A 1 134 GLY 134 213 213 GLY GLY A . n A 1 135 VAL 135 214 214 VAL VAL A . n A 1 136 HIS 136 215 215 HIS HIS A . n A 1 137 LEU 137 216 216 LEU LEU A . n A 1 138 HIS 138 217 217 HIS HIS A . n A 1 139 THR 139 218 218 THR THR A . n A 1 140 GLU 140 219 219 GLU GLU A . n A 1 141 ALA 141 220 220 ALA ALA A . n A 1 142 ARG 142 221 221 ARG ARG A . n A 1 143 ALA 143 222 222 ALA ALA A . n A 1 144 ARG 144 223 223 ARG ARG A . n A 1 145 HIS 145 224 224 HIS HIS A . n A 1 146 ALA 146 225 225 ALA ALA A . n A 1 147 TRP 147 226 226 TRP TRP A . n A 1 148 GLN 148 227 227 GLN GLN A . n A 1 149 LEU 149 228 228 LEU LEU A . n A 1 150 THR 150 229 229 THR THR A . n A 1 151 GLN 151 230 230 GLN GLN A . n A 1 152 GLY 152 231 231 GLY GLY A . n A 1 153 ALA 153 232 232 ALA ALA A . n A 1 154 THR 154 233 233 THR THR A . n A 1 155 VAL 155 234 234 VAL VAL A . n A 1 156 LEU 156 235 235 LEU LEU A . n A 1 157 GLY 157 236 236 GLY GLY A . n A 1 158 LEU 158 237 237 LEU LEU A . n A 1 159 PHE 159 238 238 PHE PHE A . n A 1 160 ARG 160 239 239 ARG ARG A . n A 1 161 VAL 161 240 240 VAL VAL A . n A 1 162 THR 162 241 241 THR THR A . n A 1 163 PRO 163 242 ? ? ? A . n A 1 164 GLU 164 243 ? ? ? A . n A 1 165 ILE 165 244 ? ? ? A . n A 1 166 HIS 166 245 ? ? ? A . n A 1 167 HIS 167 246 ? ? ? A . n A 1 168 HIS 168 247 ? ? ? A . n A 1 169 HIS 169 248 ? ? ? A . n A 1 170 HIS 170 249 ? ? ? A . n A 1 171 HIS 171 250 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 601 601 GOL GOL A . C 3 HOH 1 701 17 HOH HOH A . C 3 HOH 2 702 5 HOH HOH A . C 3 HOH 3 703 3 HOH HOH A . C 3 HOH 4 704 9 HOH HOH A . C 3 HOH 5 705 6 HOH HOH A . C 3 HOH 6 706 10 HOH HOH A . C 3 HOH 7 707 18 HOH HOH A . C 3 HOH 8 708 16 HOH HOH A . C 3 HOH 9 709 13 HOH HOH A . C 3 HOH 10 710 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4140 ? 1 MORE -22 ? 1 'SSA (A^2)' 17600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_445 -y-1,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 -36.5835000000 0.8660254038 -0.5000000000 0.0000000000 -63.3644807187 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_545 -x+y,-x-1,z -0.5000000000 0.8660254038 0.0000000000 36.5835000000 -0.8660254038 -0.5000000000 0.0000000000 -63.3644807187 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 702 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-09 2 'Structure model' 1 1 2018-07-11 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 0.6.3 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0189 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 168 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 45.41 _pdbx_validate_torsion.psi -132.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 91 ? CG ? A MET 12 CG 2 1 Y 1 A MET 91 ? SD ? A MET 12 SD 3 1 Y 1 A MET 91 ? CE ? A MET 12 CE 4 1 Y 1 A GLU 128 ? CG ? A GLU 49 CG 5 1 Y 1 A GLU 128 ? CD ? A GLU 49 CD 6 1 Y 1 A GLU 128 ? OE1 ? A GLU 49 OE1 7 1 Y 1 A GLU 128 ? OE2 ? A GLU 49 OE2 8 1 Y 1 A LYS 137 ? CG ? A LYS 58 CG 9 1 Y 1 A LYS 137 ? CD ? A LYS 58 CD 10 1 Y 1 A LYS 137 ? CE ? A LYS 58 CE 11 1 Y 1 A LYS 137 ? NZ ? A LYS 58 NZ 12 1 Y 1 A GLU 156 ? CG ? A GLU 77 CG 13 1 Y 1 A GLU 156 ? CD ? A GLU 77 CD 14 1 Y 1 A GLU 156 ? OE1 ? A GLU 77 OE1 15 1 Y 1 A GLU 156 ? OE2 ? A GLU 77 OE2 16 1 Y 1 A GLN 168 ? CG ? A GLN 89 CG 17 1 Y 1 A GLN 168 ? CD ? A GLN 89 CD 18 1 Y 1 A GLN 168 ? OE1 ? A GLN 89 OE1 19 1 Y 1 A GLN 168 ? NE2 ? A GLN 89 NE2 20 1 Y 1 A PRO 169 ? CG ? A PRO 90 CG 21 1 Y 1 A PRO 169 ? CD ? A PRO 90 CD 22 1 Y 1 A ARG 171 ? CG ? A ARG 92 CG 23 1 Y 1 A ARG 171 ? CD ? A ARG 92 CD 24 1 Y 1 A ARG 171 ? NE ? A ARG 92 NE 25 1 Y 1 A ARG 171 ? CZ ? A ARG 92 CZ 26 1 Y 1 A ARG 171 ? NH1 ? A ARG 92 NH1 27 1 Y 1 A ARG 171 ? NH2 ? A ARG 92 NH2 28 1 Y 1 A ARG 193 ? CG ? A ARG 114 CG 29 1 Y 1 A ARG 193 ? CD ? A ARG 114 CD 30 1 Y 1 A ARG 193 ? NE ? A ARG 114 NE 31 1 Y 1 A ARG 193 ? CZ ? A ARG 114 CZ 32 1 Y 1 A ARG 193 ? NH1 ? A ARG 114 NH1 33 1 Y 1 A ARG 193 ? NH2 ? A ARG 114 NH2 34 1 Y 1 A ARG 221 ? CG ? A ARG 142 CG 35 1 Y 1 A ARG 221 ? CD ? A ARG 142 CD 36 1 Y 1 A ARG 221 ? NE ? A ARG 142 NE 37 1 Y 1 A ARG 221 ? CZ ? A ARG 142 CZ 38 1 Y 1 A ARG 221 ? NH1 ? A ARG 142 NH1 39 1 Y 1 A ARG 221 ? NH2 ? A ARG 142 NH2 40 1 Y 1 A ARG 223 ? CG ? A ARG 144 CG 41 1 Y 1 A ARG 223 ? CD ? A ARG 144 CD 42 1 Y 1 A ARG 223 ? NE ? A ARG 144 NE 43 1 Y 1 A ARG 223 ? CZ ? A ARG 144 CZ 44 1 Y 1 A ARG 223 ? NH1 ? A ARG 144 NH1 45 1 Y 1 A ARG 223 ? NH2 ? A ARG 144 NH2 46 1 Y 1 A HIS 224 ? CG ? A HIS 145 CG 47 1 Y 1 A HIS 224 ? ND1 ? A HIS 145 ND1 48 1 Y 1 A HIS 224 ? CD2 ? A HIS 145 CD2 49 1 Y 1 A HIS 224 ? CE1 ? A HIS 145 CE1 50 1 Y 1 A HIS 224 ? NE2 ? A HIS 145 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 80 ? A ASP 1 2 1 Y 1 A PRO 81 ? A PRO 2 3 1 Y 1 A ALA 82 ? A ALA 3 4 1 Y 1 A GLY 83 ? A GLY 4 5 1 Y 1 A LEU 84 ? A LEU 5 6 1 Y 1 A LEU 85 ? A LEU 6 7 1 Y 1 A ASP 86 ? A ASP 7 8 1 Y 1 A LEU 87 ? A LEU 8 9 1 Y 1 A ARG 88 ? A ARG 9 10 1 Y 1 A GLN 89 ? A GLN 10 11 1 Y 1 A GLY 90 ? A GLY 11 12 1 Y 1 A ALA 116 ? A ALA 37 13 1 Y 1 A GLY 117 ? A GLY 38 14 1 Y 1 A VAL 118 ? A VAL 39 15 1 Y 1 A SER 119 ? A SER 40 16 1 Y 1 A LEU 120 ? A LEU 41 17 1 Y 1 A THR 121 ? A THR 42 18 1 Y 1 A GLY 122 ? A GLY 43 19 1 Y 1 A GLY 123 ? A GLY 44 20 1 Y 1 A ALA 154 ? A ALA 75 21 1 Y 1 A GLY 155 ? A GLY 76 22 1 Y 1 A SER 189 ? A SER 110 23 1 Y 1 A SER 190 ? A SER 111 24 1 Y 1 A GLU 191 ? A GLU 112 25 1 Y 1 A ALA 192 ? A ALA 113 26 1 Y 1 A PRO 242 ? A PRO 163 27 1 Y 1 A GLU 243 ? A GLU 164 28 1 Y 1 A ILE 244 ? A ILE 165 29 1 Y 1 A HIS 245 ? A HIS 166 30 1 Y 1 A HIS 246 ? A HIS 167 31 1 Y 1 A HIS 247 ? A HIS 168 32 1 Y 1 A HIS 248 ? A HIS 169 33 1 Y 1 A HIS 249 ? A HIS 170 34 1 Y 1 A HIS 250 ? A HIS 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6CPR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #