data_6D93 # _entry.id 6D93 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6D93 pdb_00006d93 10.2210/pdb6d93/pdb WWPDB D_1000234206 ? ? BMRB 30466 ? 10.13018/BMR30466 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6D93 _pdbx_database_status.recvd_initial_deposition_date 2018-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of tamapin, mutant Y31A' _pdbx_database_related.db_id 30466 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'del Rio Portilla, F.' 1 0000-0001-8672-0567 'Melchor Meneses, C.M.' 2 ? 'Titaux Delgado, G.A.' 3 ? 'Mayorga Flores, M.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Novel Blocker of Onco SK3 Channels Derived from Scorpion Toxin Tamapin and Active against Migration of Cancer Cells' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.0c00300 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Flores, M.' 1 ? primary 'Chantome, A.' 2 ? primary 'Melchor-Meneses, C.M.' 3 ? primary 'Domingo, I.' 4 ? primary 'Titaux Delgado, G.A.' 5 ? primary 'Galindo-Murillo, R.' 6 ? primary 'Vandier, C.' 7 ? primary 'del Rio Portilla, F.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Potassium channel toxin alpha-KTx 5.4' _entity.formula_weight 3378.090 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation Y31A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Tamapin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AFCNLRRCELSCRSLGLLGKCIGEECKCVPA _entity_poly.pdbx_seq_one_letter_code_can AFCNLRRCELSCRSLGLLGKCIGEECKCVPA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PHE n 1 3 CYS n 1 4 ASN n 1 5 LEU n 1 6 ARG n 1 7 ARG n 1 8 CYS n 1 9 GLU n 1 10 LEU n 1 11 SER n 1 12 CYS n 1 13 ARG n 1 14 SER n 1 15 LEU n 1 16 GLY n 1 17 LEU n 1 18 LEU n 1 19 GLY n 1 20 LYS n 1 21 CYS n 1 22 ILE n 1 23 GLY n 1 24 GLU n 1 25 GLU n 1 26 CYS n 1 27 LYS n 1 28 CYS n 1 29 VAL n 1 30 PRO n 1 31 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name 'Eastern Indian scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesobuthus tamulus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34647 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6D93 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6D93 _struct.title 'NMR solution structure of tamapin, mutant Y31A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6D93 _struct_keywords.text 'Tamapin mutant, Y31A, CSalpha/beta, SK channels, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KAX54_MESTA _struct_ref.pdbx_db_accession P59869 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AFCNLRRCELSCRSLGLLGKCIGEECKCVPY _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6D93 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P59869 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6D93 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 31 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P59869 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 31 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 31 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 16 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 16 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 8 A CYS 26 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 12 A CYS 28 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 21 ? CYS A 3 ? 1_555 CYS A 21 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 26 ? CYS A 8 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 12 ? CYS A 28 ? CYS A 12 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 18 ? CYS A 21 ? LEU A 18 CYS A 21 AA1 2 CYS A 26 ? VAL A 29 ? CYS A 26 VAL A 29 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 27 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 27 # _pdbx_entry_details.entry_id 6D93 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.99 120.30 3.69 0.50 N 2 2 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.36 120.30 4.06 0.50 N 3 2 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.75 120.30 3.45 0.50 N 4 3 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.61 120.30 3.31 0.50 N 5 4 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH2 A ARG 6 ? ? 123.85 120.30 3.55 0.50 N 6 4 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.57 120.30 3.27 0.50 N 7 4 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.64 120.30 3.34 0.50 N 8 5 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.83 120.30 3.53 0.50 N 9 5 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.42 120.30 3.12 0.50 N 10 5 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 124.81 120.30 4.51 0.50 N 11 6 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.45 120.30 3.15 0.50 N 12 6 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.87 120.30 3.57 0.50 N 13 7 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.71 120.30 3.41 0.50 N 14 7 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.82 120.30 3.52 0.50 N 15 7 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.85 120.30 3.55 0.50 N 16 8 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.84 120.30 3.54 0.50 N 17 9 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 124.13 120.30 3.83 0.50 N 18 10 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.65 120.30 3.35 0.50 N 19 10 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.59 120.30 3.29 0.50 N 20 10 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 124.88 120.30 4.58 0.50 N 21 11 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 124.21 120.30 3.91 0.50 N 22 11 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 124.37 120.30 4.07 0.50 N 23 12 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.94 120.30 3.64 0.50 N 24 14 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.15 120.30 3.85 0.50 N 25 14 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.58 120.30 3.28 0.50 N 26 14 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 124.37 120.30 4.07 0.50 N 27 15 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.55 120.30 3.25 0.50 N 28 17 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.32 120.30 3.02 0.50 N 29 17 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.44 120.30 3.14 0.50 N 30 18 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH1 A ARG 7 ? ? 123.69 120.30 3.39 0.50 N 31 19 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 125.08 120.30 4.78 0.50 N 32 20 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.80 120.30 4.50 0.50 N 33 20 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH2 A ARG 6 ? ? 116.68 120.30 -3.62 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 PHE A 2 ? ? -103.18 46.63 2 2 CYS A 3 ? ? 53.96 19.40 3 3 ILE A 22 ? ? -110.51 78.68 4 5 ASN A 4 ? ? -78.49 40.42 5 6 ASN A 4 ? ? -71.58 34.75 6 7 GLU A 24 ? ? -74.83 21.74 7 8 ASN A 4 ? ? -81.28 49.76 8 9 ASN A 4 ? ? -79.10 49.85 9 11 ASN A 4 ? ? -79.42 45.53 10 12 ASN A 4 ? ? -111.65 66.50 11 13 ASN A 4 ? ? -84.93 44.20 12 13 CYS A 21 ? ? -110.05 55.40 13 13 GLU A 24 ? ? 64.21 -33.40 14 14 ASN A 4 ? ? -81.41 36.62 15 14 GLU A 24 ? ? 61.99 -35.74 16 16 PHE A 2 ? ? -146.79 34.54 17 16 ASN A 4 ? ? -85.27 39.56 18 17 CYS A 3 ? ? -76.18 21.61 19 18 ASN A 4 ? ? -74.93 32.66 20 18 LYS A 27 ? ? -150.12 84.08 21 19 CYS A 3 ? ? -156.11 23.33 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 14 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 13 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.085 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6D93 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6D93 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM Potassium channel toxin alpha-KTx 5.4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1H_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Potassium channel toxin alpha-KTx 5.4' _pdbx_nmr_exptl_sample.concentration 1.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 6D93 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'used also for simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber 16 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 1.8 'Keller and Wuthrich' 4 'peak picking' CARA 1.8 'Keller and Wuthrich' 5 processing NMRPipe 2014 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLU N N N N 72 GLU CA C N S 73 GLU C C N N 74 GLU O O N N 75 GLU CB C N N 76 GLU CG C N N 77 GLU CD C N N 78 GLU OE1 O N N 79 GLU OE2 O N N 80 GLU OXT O N N 81 GLU H H N N 82 GLU H2 H N N 83 GLU HA H N N 84 GLU HB2 H N N 85 GLU HB3 H N N 86 GLU HG2 H N N 87 GLU HG3 H N N 88 GLU HE2 H N N 89 GLU HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 ILE N N N N 101 ILE CA C N S 102 ILE C C N N 103 ILE O O N N 104 ILE CB C N S 105 ILE CG1 C N N 106 ILE CG2 C N N 107 ILE CD1 C N N 108 ILE OXT O N N 109 ILE H H N N 110 ILE H2 H N N 111 ILE HA H N N 112 ILE HB H N N 113 ILE HG12 H N N 114 ILE HG13 H N N 115 ILE HG21 H N N 116 ILE HG22 H N N 117 ILE HG23 H N N 118 ILE HD11 H N N 119 ILE HD12 H N N 120 ILE HD13 H N N 121 ILE HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 PHE N N N N 170 PHE CA C N S 171 PHE C C N N 172 PHE O O N N 173 PHE CB C N N 174 PHE CG C Y N 175 PHE CD1 C Y N 176 PHE CD2 C Y N 177 PHE CE1 C Y N 178 PHE CE2 C Y N 179 PHE CZ C Y N 180 PHE OXT O N N 181 PHE H H N N 182 PHE H2 H N N 183 PHE HA H N N 184 PHE HB2 H N N 185 PHE HB3 H N N 186 PHE HD1 H N N 187 PHE HD2 H N N 188 PHE HE1 H N N 189 PHE HE2 H N N 190 PHE HZ H N N 191 PHE HXT H N N 192 PRO N N N N 193 PRO CA C N S 194 PRO C C N N 195 PRO O O N N 196 PRO CB C N N 197 PRO CG C N N 198 PRO CD C N N 199 PRO OXT O N N 200 PRO H H N N 201 PRO HA H N N 202 PRO HB2 H N N 203 PRO HB3 H N N 204 PRO HG2 H N N 205 PRO HG3 H N N 206 PRO HD2 H N N 207 PRO HD3 H N N 208 PRO HXT H N N 209 SER N N N N 210 SER CA C N S 211 SER C C N N 212 SER O O N N 213 SER CB C N N 214 SER OG O N N 215 SER OXT O N N 216 SER H H N N 217 SER H2 H N N 218 SER HA H N N 219 SER HB2 H N N 220 SER HB3 H N N 221 SER HG H N N 222 SER HXT H N N 223 TYR N N N N 224 TYR CA C N S 225 TYR C C N N 226 TYR O O N N 227 TYR CB C N N 228 TYR CG C Y N 229 TYR CD1 C Y N 230 TYR CD2 C Y N 231 TYR CE1 C Y N 232 TYR CE2 C Y N 233 TYR CZ C Y N 234 TYR OH O N N 235 TYR OXT O N N 236 TYR H H N N 237 TYR H2 H N N 238 TYR HA H N N 239 TYR HB2 H N N 240 TYR HB3 H N N 241 TYR HD1 H N N 242 TYR HD2 H N N 243 TYR HE1 H N N 244 TYR HE2 H N N 245 TYR HH H N N 246 TYR HXT H N N 247 VAL N N N N 248 VAL CA C N S 249 VAL C C N N 250 VAL O O N N 251 VAL CB C N N 252 VAL CG1 C N N 253 VAL CG2 C N N 254 VAL OXT O N N 255 VAL H H N N 256 VAL H2 H N N 257 VAL HA H N N 258 VAL HB H N N 259 VAL HG11 H N N 260 VAL HG12 H N N 261 VAL HG13 H N N 262 VAL HG21 H N N 263 VAL HG22 H N N 264 VAL HG23 H N N 265 VAL HXT H N N 266 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLU N CA sing N N 68 GLU N H sing N N 69 GLU N H2 sing N N 70 GLU CA C sing N N 71 GLU CA CB sing N N 72 GLU CA HA sing N N 73 GLU C O doub N N 74 GLU C OXT sing N N 75 GLU CB CG sing N N 76 GLU CB HB2 sing N N 77 GLU CB HB3 sing N N 78 GLU CG CD sing N N 79 GLU CG HG2 sing N N 80 GLU CG HG3 sing N N 81 GLU CD OE1 doub N N 82 GLU CD OE2 sing N N 83 GLU OE2 HE2 sing N N 84 GLU OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 ILE N CA sing N N 95 ILE N H sing N N 96 ILE N H2 sing N N 97 ILE CA C sing N N 98 ILE CA CB sing N N 99 ILE CA HA sing N N 100 ILE C O doub N N 101 ILE C OXT sing N N 102 ILE CB CG1 sing N N 103 ILE CB CG2 sing N N 104 ILE CB HB sing N N 105 ILE CG1 CD1 sing N N 106 ILE CG1 HG12 sing N N 107 ILE CG1 HG13 sing N N 108 ILE CG2 HG21 sing N N 109 ILE CG2 HG22 sing N N 110 ILE CG2 HG23 sing N N 111 ILE CD1 HD11 sing N N 112 ILE CD1 HD12 sing N N 113 ILE CD1 HD13 sing N N 114 ILE OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 PHE N CA sing N N 161 PHE N H sing N N 162 PHE N H2 sing N N 163 PHE CA C sing N N 164 PHE CA CB sing N N 165 PHE CA HA sing N N 166 PHE C O doub N N 167 PHE C OXT sing N N 168 PHE CB CG sing N N 169 PHE CB HB2 sing N N 170 PHE CB HB3 sing N N 171 PHE CG CD1 doub Y N 172 PHE CG CD2 sing Y N 173 PHE CD1 CE1 sing Y N 174 PHE CD1 HD1 sing N N 175 PHE CD2 CE2 doub Y N 176 PHE CD2 HD2 sing N N 177 PHE CE1 CZ doub Y N 178 PHE CE1 HE1 sing N N 179 PHE CE2 CZ sing Y N 180 PHE CE2 HE2 sing N N 181 PHE CZ HZ sing N N 182 PHE OXT HXT sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 TYR N CA sing N N 214 TYR N H sing N N 215 TYR N H2 sing N N 216 TYR CA C sing N N 217 TYR CA CB sing N N 218 TYR CA HA sing N N 219 TYR C O doub N N 220 TYR C OXT sing N N 221 TYR CB CG sing N N 222 TYR CB HB2 sing N N 223 TYR CB HB3 sing N N 224 TYR CG CD1 doub Y N 225 TYR CG CD2 sing Y N 226 TYR CD1 CE1 sing Y N 227 TYR CD1 HD1 sing N N 228 TYR CD2 CE2 doub Y N 229 TYR CD2 HD2 sing N N 230 TYR CE1 CZ doub Y N 231 TYR CE1 HE1 sing N N 232 TYR CE2 CZ sing Y N 233 TYR CE2 HE2 sing N N 234 TYR CZ OH sing N N 235 TYR OH HH sing N N 236 TYR OXT HXT sing N N 237 VAL N CA sing N N 238 VAL N H sing N N 239 VAL N H2 sing N N 240 VAL CA C sing N N 241 VAL CA CB sing N N 242 VAL CA HA sing N N 243 VAL C O doub N N 244 VAL C OXT sing N N 245 VAL CB CG1 sing N N 246 VAL CB CG2 sing N N 247 VAL CB HB sing N N 248 VAL CG1 HG11 sing N N 249 VAL CG1 HG12 sing N N 250 VAL CG1 HG13 sing N N 251 VAL CG2 HG21 sing N N 252 VAL CG2 HG22 sing N N 253 VAL CG2 HG23 sing N N 254 VAL OXT HXT sing N N 255 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6D93 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #