data_6DGJ # _entry.id 6DGJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DGJ pdb_00006dgj 10.2210/pdb6dgj/pdb WWPDB D_1000234577 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-02 2 'Structure model' 1 1 2019-03-27 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 3 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_audit_support 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 2 'Structure model' '_pdbx_audit_support.funding_organization' 15 3 'Structure model' '_pdbx_audit_support.funding_organization' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DGJ _pdbx_database_status.recvd_initial_deposition_date 2018-05-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Waldron, E.J.' 1 ? 'Neiditch, M.B.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-7885 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first e3000123 _citation.page_last e3000123 _citation.title 'Structural basis of DSF recognition by its receptor RpfR and its regulatory interaction with the DSF synthase RpfF.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pbio.3000123 _citation.pdbx_database_id_PubMed 30716063 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Waldron, E.J.' 1 ? primary 'Snyder, D.' 2 ? primary 'Fernandez, N.L.' 3 ? primary 'Sileo, E.' 4 0000-0003-3032-7373 primary 'Inoyama, D.' 5 ? primary 'Freundlich, J.S.' 6 ? primary 'Waters, C.M.' 7 ? primary 'Cooper, V.S.' 8 0000-0001-7726-0765 primary 'Neiditch, M.B.' 9 0000-0002-7039-4469 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man RpfR 12606.202 1 ? ? ? ? 2 non-polymer syn '(2Z)-dodec-2-enoic acid' 198.302 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein gmr' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QVVSEANSVIVILDRHGNIQRFNRLSEEYTGLKEQEVIGQNVFTLFMSPAEASASRRNVTGFFRNGSSYEVERWIKTRKG QRLFLFRNKFVHSGSGRNEIFLICSGTDIT ; _entity_poly.pdbx_seq_one_letter_code_can ;QVVSEANSVIVILDRHGNIQRFNRLSEEYTGLKEQEVIGQNVFTLFMSPAEASASRRNVTGFFRNGSSYEVERWIKTRKG QRLFLFRNKFVHSGSGRNEIFLICSGTDIT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2Z)-dodec-2-enoic acid' GEY 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 VAL n 1 3 VAL n 1 4 SER n 1 5 GLU n 1 6 ALA n 1 7 ASN n 1 8 SER n 1 9 VAL n 1 10 ILE n 1 11 VAL n 1 12 ILE n 1 13 LEU n 1 14 ASP n 1 15 ARG n 1 16 HIS n 1 17 GLY n 1 18 ASN n 1 19 ILE n 1 20 GLN n 1 21 ARG n 1 22 PHE n 1 23 ASN n 1 24 ARG n 1 25 LEU n 1 26 SER n 1 27 GLU n 1 28 GLU n 1 29 TYR n 1 30 THR n 1 31 GLY n 1 32 LEU n 1 33 LYS n 1 34 GLU n 1 35 GLN n 1 36 GLU n 1 37 VAL n 1 38 ILE n 1 39 GLY n 1 40 GLN n 1 41 ASN n 1 42 VAL n 1 43 PHE n 1 44 THR n 1 45 LEU n 1 46 PHE n 1 47 MET n 1 48 SER n 1 49 PRO n 1 50 ALA n 1 51 GLU n 1 52 ALA n 1 53 SER n 1 54 ALA n 1 55 SER n 1 56 ARG n 1 57 ARG n 1 58 ASN n 1 59 VAL n 1 60 THR n 1 61 GLY n 1 62 PHE n 1 63 PHE n 1 64 ARG n 1 65 ASN n 1 66 GLY n 1 67 SER n 1 68 SER n 1 69 TYR n 1 70 GLU n 1 71 VAL n 1 72 GLU n 1 73 ARG n 1 74 TRP n 1 75 ILE n 1 76 LYS n 1 77 THR n 1 78 ARG n 1 79 LYS n 1 80 GLY n 1 81 GLN n 1 82 ARG n 1 83 LEU n 1 84 PHE n 1 85 LEU n 1 86 PHE n 1 87 ARG n 1 88 ASN n 1 89 LYS n 1 90 PHE n 1 91 VAL n 1 92 HIS n 1 93 SER n 1 94 GLY n 1 95 SER n 1 96 GLY n 1 97 ARG n 1 98 ASN n 1 99 GLU n 1 100 ILE n 1 101 PHE n 1 102 LEU n 1 103 ILE n 1 104 CYS n 1 105 SER n 1 106 GLY n 1 107 THR n 1 108 ASP n 1 109 ILE n 1 110 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 110 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gmr, Ctu_23300' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 18703 / LMG 23827 / z3032' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 693216 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GEY non-polymer . '(2Z)-dodec-2-enoic acid' ? 'C12 H22 O2' 198.302 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 115 ? ? ? A . n A 1 2 VAL 2 116 116 VAL VAL A . n A 1 3 VAL 3 117 117 VAL VAL A . n A 1 4 SER 4 118 118 SER SER A . n A 1 5 GLU 5 119 119 GLU GLU A . n A 1 6 ALA 6 120 120 ALA ALA A . n A 1 7 ASN 7 121 121 ASN ASN A . n A 1 8 SER 8 122 122 SER SER A . n A 1 9 VAL 9 123 123 VAL VAL A . n A 1 10 ILE 10 124 124 ILE ILE A . n A 1 11 VAL 11 125 125 VAL VAL A . n A 1 12 ILE 12 126 126 ILE ILE A . n A 1 13 LEU 13 127 127 LEU LEU A . n A 1 14 ASP 14 128 128 ASP ASP A . n A 1 15 ARG 15 129 129 ARG ARG A . n A 1 16 HIS 16 130 130 HIS HIS A . n A 1 17 GLY 17 131 131 GLY GLY A . n A 1 18 ASN 18 132 132 ASN ASN A . n A 1 19 ILE 19 133 133 ILE ILE A . n A 1 20 GLN 20 134 134 GLN GLN A . n A 1 21 ARG 21 135 135 ARG ARG A . n A 1 22 PHE 22 136 136 PHE PHE A . n A 1 23 ASN 23 137 137 ASN ASN A . n A 1 24 ARG 24 138 138 ARG ARG A . n A 1 25 LEU 25 139 139 LEU LEU A . n A 1 26 SER 26 140 140 SER SER A . n A 1 27 GLU 27 141 141 GLU GLU A . n A 1 28 GLU 28 142 142 GLU GLU A . n A 1 29 TYR 29 143 143 TYR TYR A . n A 1 30 THR 30 144 144 THR THR A . n A 1 31 GLY 31 145 145 GLY GLY A . n A 1 32 LEU 32 146 146 LEU LEU A . n A 1 33 LYS 33 147 147 LYS LYS A . n A 1 34 GLU 34 148 148 GLU GLU A . n A 1 35 GLN 35 149 149 GLN GLN A . n A 1 36 GLU 36 150 150 GLU GLU A . n A 1 37 VAL 37 151 151 VAL VAL A . n A 1 38 ILE 38 152 152 ILE ILE A . n A 1 39 GLY 39 153 153 GLY GLY A . n A 1 40 GLN 40 154 154 GLN GLN A . n A 1 41 ASN 41 155 155 ASN ASN A . n A 1 42 VAL 42 156 156 VAL VAL A . n A 1 43 PHE 43 157 157 PHE PHE A . n A 1 44 THR 44 158 158 THR THR A . n A 1 45 LEU 45 159 159 LEU LEU A . n A 1 46 PHE 46 160 160 PHE PHE A . n A 1 47 MET 47 161 161 MET MET A . n A 1 48 SER 48 162 162 SER SER A . n A 1 49 PRO 49 163 163 PRO PRO A . n A 1 50 ALA 50 164 164 ALA ALA A . n A 1 51 GLU 51 165 165 GLU GLU A . n A 1 52 ALA 52 166 166 ALA ALA A . n A 1 53 SER 53 167 167 SER SER A . n A 1 54 ALA 54 168 168 ALA ALA A . n A 1 55 SER 55 169 169 SER SER A . n A 1 56 ARG 56 170 170 ARG ARG A . n A 1 57 ARG 57 171 171 ARG ARG A . n A 1 58 ASN 58 172 172 ASN ASN A . n A 1 59 VAL 59 173 173 VAL VAL A . n A 1 60 THR 60 174 174 THR THR A . n A 1 61 GLY 61 175 175 GLY GLY A . n A 1 62 PHE 62 176 176 PHE PHE A . n A 1 63 PHE 63 177 177 PHE PHE A . n A 1 64 ARG 64 178 178 ARG ARG A . n A 1 65 ASN 65 179 179 ASN ASN A . n A 1 66 GLY 66 180 180 GLY GLY A . n A 1 67 SER 67 181 181 SER SER A . n A 1 68 SER 68 182 182 SER SER A . n A 1 69 TYR 69 183 183 TYR TYR A . n A 1 70 GLU 70 184 184 GLU GLU A . n A 1 71 VAL 71 185 185 VAL VAL A . n A 1 72 GLU 72 186 186 GLU GLU A . n A 1 73 ARG 73 187 187 ARG ARG A . n A 1 74 TRP 74 188 188 TRP TRP A . n A 1 75 ILE 75 189 189 ILE ILE A . n A 1 76 LYS 76 190 190 LYS LYS A . n A 1 77 THR 77 191 191 THR THR A . n A 1 78 ARG 78 192 192 ARG ARG A . n A 1 79 LYS 79 193 193 LYS LYS A . n A 1 80 GLY 80 194 194 GLY GLY A . n A 1 81 GLN 81 195 195 GLN GLN A . n A 1 82 ARG 82 196 196 ARG ARG A . n A 1 83 LEU 83 197 197 LEU LEU A . n A 1 84 PHE 84 198 198 PHE PHE A . n A 1 85 LEU 85 199 199 LEU LEU A . n A 1 86 PHE 86 200 200 PHE PHE A . n A 1 87 ARG 87 201 201 ARG ARG A . n A 1 88 ASN 88 202 202 ASN ASN A . n A 1 89 LYS 89 203 203 LYS LYS A . n A 1 90 PHE 90 204 204 PHE PHE A . n A 1 91 VAL 91 205 205 VAL VAL A . n A 1 92 HIS 92 206 ? ? ? A . n A 1 93 SER 93 207 ? ? ? A . n A 1 94 GLY 94 208 ? ? ? A . n A 1 95 SER 95 209 ? ? ? A . n A 1 96 GLY 96 210 ? ? ? A . n A 1 97 ARG 97 211 ? ? ? A . n A 1 98 ASN 98 212 ? ? ? A . n A 1 99 GLU 99 213 213 GLU GLU A . n A 1 100 ILE 100 214 214 ILE ILE A . n A 1 101 PHE 101 215 215 PHE PHE A . n A 1 102 LEU 102 216 216 LEU LEU A . n A 1 103 ILE 103 217 217 ILE ILE A . n A 1 104 CYS 104 218 218 CYS CYS A . n A 1 105 SER 105 219 219 SER SER A . n A 1 106 GLY 106 220 220 GLY GLY A . n A 1 107 THR 107 221 221 THR THR A . n A 1 108 ASP 108 222 222 ASP ASP A . n A 1 109 ILE 109 223 223 ILE ILE A . n A 1 110 THR 110 224 224 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GEY 1 301 1 GEY EJW A . C 3 HOH 1 401 21 HOH HOH A . C 3 HOH 2 402 5 HOH HOH A . C 3 HOH 3 403 7 HOH HOH A . C 3 HOH 4 404 8 HOH HOH A . C 3 HOH 5 405 24 HOH HOH A . C 3 HOH 6 406 1 HOH HOH A . C 3 HOH 7 407 23 HOH HOH A . C 3 HOH 8 408 19 HOH HOH A . C 3 HOH 9 409 33 HOH HOH A . C 3 HOH 10 410 11 HOH HOH A . C 3 HOH 11 411 13 HOH HOH A . C 3 HOH 12 412 2 HOH HOH A . C 3 HOH 13 413 22 HOH HOH A . C 3 HOH 14 414 6 HOH HOH A . C 3 HOH 15 415 4 HOH HOH A . C 3 HOH 16 416 3 HOH HOH A . C 3 HOH 17 417 9 HOH HOH A . C 3 HOH 18 418 29 HOH HOH A . C 3 HOH 19 419 32 HOH HOH A . C 3 HOH 20 420 16 HOH HOH A . C 3 HOH 21 421 17 HOH HOH A . C 3 HOH 22 422 14 HOH HOH A . C 3 HOH 23 423 20 HOH HOH A . C 3 HOH 24 424 10 HOH HOH A . C 3 HOH 25 425 31 HOH HOH A . C 3 HOH 26 426 12 HOH HOH A . C 3 HOH 27 427 34 HOH HOH A . C 3 HOH 28 428 35 HOH HOH A . C 3 HOH 29 429 15 HOH HOH A . C 3 HOH 30 430 38 HOH HOH A . C 3 HOH 31 431 27 HOH HOH A . C 3 HOH 32 432 25 HOH HOH A . C 3 HOH 33 433 26 HOH HOH A . C 3 HOH 34 434 18 HOH HOH A . C 3 HOH 35 435 36 HOH HOH A . C 3 HOH 36 436 28 HOH HOH A . C 3 HOH 37 437 37 HOH HOH A . C 3 HOH 38 438 30 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 115.490 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6DGJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.932 _cell.length_a_esd ? _cell.length_b 29.150 _cell.length_b_esd ? _cell.length_c 41.554 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DGJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DGJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '150 mM lithium citrate and 16% (vol/vol) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 18.500 _reflns.entry_id 6DGJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2940 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4004 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.900 _reflns.pdbx_Rmerge_I_obs 0.206 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.779 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.239 _reflns.pdbx_Rpim_I_all 0.120 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.682 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.2940 2.340 ? ? ? ? ? ? 187 100.000 ? ? ? ? 0.618 ? ? ? ? ? ? ? ? 3.800 ? 1.606 ? ? 0.719 0.363 ? 1 1 0.682 ? 2.340 2.380 ? ? ? ? ? ? 207 100.000 ? ? ? ? 0.667 ? ? ? ? ? ? ? ? 3.900 ? 1.602 ? ? 0.771 0.381 ? 2 1 0.640 ? 2.380 2.430 ? ? ? ? ? ? 211 100.000 ? ? ? ? 0.581 ? ? ? ? ? ? ? ? 3.800 ? 1.761 ? ? 0.675 0.339 ? 3 1 0.746 ? 2.430 2.480 ? ? ? ? ? ? 182 100.000 ? ? ? ? 0.481 ? ? ? ? ? ? ? ? 3.900 ? 1.659 ? ? 0.556 0.276 ? 4 1 0.815 ? 2.480 2.530 ? ? ? ? ? ? 193 100.000 ? ? ? ? 0.417 ? ? ? ? ? ? ? ? 3.900 ? 1.554 ? ? 0.485 0.246 ? 5 1 0.834 ? 2.530 2.590 ? ? ? ? ? ? 204 100.000 ? ? ? ? 0.456 ? ? ? ? ? ? ? ? 3.900 ? 1.624 ? ? 0.532 0.269 ? 6 1 0.745 ? 2.590 2.660 ? ? ? ? ? ? 201 100.000 ? ? ? ? 0.466 ? ? ? ? ? ? ? ? 3.900 ? 1.716 ? ? 0.542 0.272 ? 7 1 0.786 ? 2.660 2.730 ? ? ? ? ? ? 190 100.000 ? ? ? ? 0.432 ? ? ? ? ? ? ? ? 4.000 ? 1.511 ? ? 0.499 0.246 ? 8 1 0.833 ? 2.730 2.810 ? ? ? ? ? ? 194 100.000 ? ? ? ? 0.318 ? ? ? ? ? ? ? ? 3.900 ? 1.634 ? ? 0.368 0.184 ? 9 1 0.861 ? 2.810 2.900 ? ? ? ? ? ? 208 100.000 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 4.000 ? 1.632 ? ? 0.335 0.167 ? 10 1 0.868 ? 2.900 3.000 ? ? ? ? ? ? 191 100.000 ? ? ? ? 0.256 ? ? ? ? ? ? ? ? 3.900 ? 1.803 ? ? 0.298 0.149 ? 11 1 0.937 ? 3.000 3.120 ? ? ? ? ? ? 207 100.000 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? 3.900 ? 1.734 ? ? 0.272 0.135 ? 12 1 0.955 ? 3.120 3.260 ? ? ? ? ? ? 199 100.000 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 4.000 ? 1.844 ? ? 0.225 0.111 ? 13 1 0.972 ? 3.260 3.440 ? ? ? ? ? ? 194 100.000 ? ? ? ? 0.199 ? ? ? ? ? ? ? ? 3.900 ? 2.019 ? ? 0.231 0.116 ? 14 1 0.957 ? 3.440 3.650 ? ? ? ? ? ? 208 99.500 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 3.900 ? 2.028 ? ? 0.193 0.097 ? 15 1 0.970 ? 3.650 3.930 ? ? ? ? ? ? 192 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 3.900 ? 2.008 ? ? 0.153 0.077 ? 16 1 0.982 ? 3.930 4.330 ? ? ? ? ? ? 203 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 3.900 ? 1.912 ? ? 0.117 0.058 ? 17 1 0.990 ? 4.330 4.950 ? ? ? ? ? ? 209 99.500 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 3.800 ? 2.010 ? ? 0.105 0.054 ? 18 1 0.988 ? 4.950 6.240 ? ? ? ? ? ? 203 100.000 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 3.700 ? 1.907 ? ? 0.163 0.083 ? 19 1 0.982 ? 6.240 50.000 ? ? ? ? ? ? 221 99.500 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 3.500 ? 2.015 ? ? 0.098 0.052 ? 20 1 0.990 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 97.800 _refine.B_iso_mean 27.9001 _refine.B_iso_min 1.330 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DGJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2940 _refine.ls_d_res_low 37.5090 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3998 _refine.ls_number_reflns_R_free 398 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6300 _refine.ls_percent_reflns_R_free 9.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2334 _refine.ls_R_factor_R_free 0.2823 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2277 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.0500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2940 _refine_hist.d_res_low 37.5090 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 904 _refine_hist.pdbx_number_residues_total 102 _refine_hist.pdbx_B_iso_mean_ligand 27.62 _refine_hist.pdbx_B_iso_mean_solvent 23.12 _refine_hist.pdbx_number_atoms_protein 831 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 857 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.522 ? 1146 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 125 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 149 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.681 ? 512 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2936 2.6254 1304 . 126 1178 99.0000 . . . 0.3651 0.0000 0.2820 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.6254 3.3074 1328 . 134 1194 100.0000 . . . 0.2835 0.0000 0.2433 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.3074 37.5141 1366 . 138 1228 100.0000 . . . 0.2505 0.0000 0.1947 . . . . . . 3 . . . # _struct.entry_id 6DGJ _struct.title 'Cronobacter turicensis RpfR quorum-sensing receptor PAS domain in complex with BDSF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DGJ _struct_keywords.text 'quorum sensing, diffusible signal factor, diguanylate cyclase, phosphodiesterase, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C9XTL5_CROTZ _struct_ref.pdbx_db_accession C9XTL5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QVVSEANSVIVILDRHGNIQRFNRLSEEYTGLKEQEVIGQNVFTLFMSPAEASASRRNVTGFFRNGSSYEVERWIKTRKG QRLFLFRNKFVHSGSGRNEIFLICSGTDIT ; _struct_ref.pdbx_align_begin 135 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6DGJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C9XTL5 _struct_ref_seq.db_align_beg 135 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 244 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 115 _struct_ref_seq.pdbx_auth_seq_align_end 224 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 23 ? GLY A 31 ? ASN A 137 GLY A 145 1 ? 9 HELX_P HELX_P2 AA2 LYS A 33 ? ILE A 38 ? LYS A 147 ILE A 152 1 ? 6 HELX_P HELX_P3 AA3 ASN A 41 ? MET A 47 ? ASN A 155 MET A 161 1 ? 7 HELX_P HELX_P4 AA4 SER A 48 ? PHE A 63 ? SER A 162 PHE A 177 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 19 ? PHE A 22 ? ILE A 133 PHE A 136 AA1 2 VAL A 9 ? ASP A 14 ? VAL A 123 ASP A 128 AA1 3 PHE A 101 ? ASP A 108 ? PHE A 215 ASP A 222 AA1 4 GLY A 80 ? PHE A 90 ? GLY A 194 PHE A 204 AA1 5 TYR A 69 ? THR A 77 ? TYR A 183 THR A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 20 ? O GLN A 134 N ILE A 12 ? N ILE A 126 AA1 2 3 N LEU A 13 ? N LEU A 127 O LEU A 102 ? O LEU A 216 AA1 3 4 O SER A 105 ? O SER A 219 N ARG A 87 ? N ARG A 201 AA1 4 5 O ARG A 82 ? O ARG A 196 N ILE A 75 ? N ILE A 189 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GEY _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue GEY A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 THR A 30 ? THR A 144 . ? 1_555 ? 2 AC1 12 VAL A 42 ? VAL A 156 . ? 1_555 ? 3 AC1 12 PHE A 46 ? PHE A 160 . ? 1_555 ? 4 AC1 12 SER A 55 ? SER A 169 . ? 1_555 ? 5 AC1 12 ASN A 58 ? ASN A 172 . ? 1_555 ? 6 AC1 12 VAL A 59 ? VAL A 173 . ? 1_555 ? 7 AC1 12 TYR A 69 ? TYR A 183 . ? 1_555 ? 8 AC1 12 VAL A 71 ? VAL A 185 . ? 1_555 ? 9 AC1 12 ARG A 73 ? ARG A 187 . ? 1_555 ? 10 AC1 12 ILE A 75 ? ILE A 189 . ? 1_555 ? 11 AC1 12 ASN A 88 ? ASN A 202 . ? 1_555 ? 12 AC1 12 CYS A 104 ? CYS A 218 . ? 1_555 ? # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HE21 A GLN 149 ? ? 1_555 O A GLN 195 ? ? 1_545 1.59 2 1 NE2 A GLN 149 ? ? 1_555 O A GLN 195 ? ? 1_545 2.13 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 193 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -114.41 _pdbx_validate_torsion.psi 50.13 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 3.8364 18.2766 13.2246 0.2027 0.1156 0.1361 0.0015 -0.0210 0.0012 3.4779 2.2991 2.2483 0.2928 0.2906 -1.0944 0.0705 0.1980 -0.2121 -0.1507 -0.1324 0.0874 0.3537 0.2489 -0.0827 'X-RAY DIFFRACTION' 2 ? refined 9.1943 25.7398 1.5726 0.2631 0.1973 0.1428 -0.0133 0.0311 -0.0250 1.6380 3.1924 1.6142 -1.9671 1.3715 -1.0451 -0.0284 -0.2022 0.2408 0.4252 -0.0209 0.0139 0.0833 -0.0324 0.0737 'X-RAY DIFFRACTION' 3 ? refined 11.7617 26.7699 10.9350 0.1914 0.0901 0.1175 -0.0289 -0.0455 -0.0225 1.7275 3.9852 2.8136 -1.1004 -0.8325 0.5559 0.1749 -0.0581 -0.1094 0.0763 -0.0498 0.0250 -0.2515 -0.1998 0.1248 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 116 A 151 ;chain 'A' and (resid 116 through 151 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 152 A 176 ;chain 'A' and (resid 152 through 176 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 177 A 224 ;chain 'A' and (resid 177 through 224 ) ; ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 115 ? A GLN 1 2 1 Y 1 A HIS 206 ? A HIS 92 3 1 Y 1 A SER 207 ? A SER 93 4 1 Y 1 A GLY 208 ? A GLY 94 5 1 Y 1 A SER 209 ? A SER 95 6 1 Y 1 A GLY 210 ? A GLY 96 7 1 Y 1 A ARG 211 ? A ARG 97 8 1 Y 1 A ASN 212 ? A ASN 98 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GEY C1 C N N 88 GEY C2 C N N 89 GEY C3 C N N 90 GEY C4 C N N 91 GEY C5 C N N 92 GEY C6 C N N 93 GEY C8 C N N 94 GEY O2 O N N 95 GEY O1 O N N 96 GEY C7 C N N 97 GEY C9 C N N 98 GEY C10 C N N 99 GEY C11 C N N 100 GEY C12 C N N 101 GEY H1 H N N 102 GEY H2 H N N 103 GEY H4 H N N 104 GEY H3 H N N 105 GEY H5 H N N 106 GEY H6 H N N 107 GEY H7 H N N 108 GEY H8 H N N 109 GEY H9 H N N 110 GEY H10 H N N 111 GEY H11 H N N 112 GEY H12 H N N 113 GEY H13 H N N 114 GEY H14 H N N 115 GEY H15 H N N 116 GEY H16 H N N 117 GEY H17 H N N 118 GEY H19 H N N 119 GEY H18 H N N 120 GEY H20 H N N 121 GEY H21 H N N 122 GEY H22 H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 HOH O O N N 194 HOH H1 H N N 195 HOH H2 H N N 196 ILE N N N N 197 ILE CA C N S 198 ILE C C N N 199 ILE O O N N 200 ILE CB C N S 201 ILE CG1 C N N 202 ILE CG2 C N N 203 ILE CD1 C N N 204 ILE OXT O N N 205 ILE H H N N 206 ILE H2 H N N 207 ILE HA H N N 208 ILE HB H N N 209 ILE HG12 H N N 210 ILE HG13 H N N 211 ILE HG21 H N N 212 ILE HG22 H N N 213 ILE HG23 H N N 214 ILE HD11 H N N 215 ILE HD12 H N N 216 ILE HD13 H N N 217 ILE HXT H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 PHE N N N N 286 PHE CA C N S 287 PHE C C N N 288 PHE O O N N 289 PHE CB C N N 290 PHE CG C Y N 291 PHE CD1 C Y N 292 PHE CD2 C Y N 293 PHE CE1 C Y N 294 PHE CE2 C Y N 295 PHE CZ C Y N 296 PHE OXT O N N 297 PHE H H N N 298 PHE H2 H N N 299 PHE HA H N N 300 PHE HB2 H N N 301 PHE HB3 H N N 302 PHE HD1 H N N 303 PHE HD2 H N N 304 PHE HE1 H N N 305 PHE HE2 H N N 306 PHE HZ H N N 307 PHE HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GEY O2 C1 doub N N 83 GEY C1 C2 sing N N 84 GEY C1 O1 sing N N 85 GEY C2 C3 doub N Z 86 GEY C3 C4 sing N N 87 GEY C4 C5 sing N N 88 GEY C6 C5 sing N N 89 GEY C6 C7 sing N N 90 GEY C8 C7 sing N N 91 GEY C8 C9 sing N N 92 GEY C9 C10 sing N N 93 GEY C10 C11 sing N N 94 GEY C11 C12 sing N N 95 GEY C2 H1 sing N N 96 GEY C3 H2 sing N N 97 GEY C4 H4 sing N N 98 GEY C4 H3 sing N N 99 GEY C5 H5 sing N N 100 GEY C5 H6 sing N N 101 GEY C6 H7 sing N N 102 GEY C6 H8 sing N N 103 GEY C8 H9 sing N N 104 GEY C8 H10 sing N N 105 GEY O1 H11 sing N N 106 GEY C7 H12 sing N N 107 GEY C7 H13 sing N N 108 GEY C9 H14 sing N N 109 GEY C9 H15 sing N N 110 GEY C10 H16 sing N N 111 GEY C10 H17 sing N N 112 GEY C11 H19 sing N N 113 GEY C11 H18 sing N N 114 GEY C12 H20 sing N N 115 GEY C12 H21 sing N N 116 GEY C12 H22 sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HIS N CA sing N N 164 HIS N H sing N N 165 HIS N H2 sing N N 166 HIS CA C sing N N 167 HIS CA CB sing N N 168 HIS CA HA sing N N 169 HIS C O doub N N 170 HIS C OXT sing N N 171 HIS CB CG sing N N 172 HIS CB HB2 sing N N 173 HIS CB HB3 sing N N 174 HIS CG ND1 sing Y N 175 HIS CG CD2 doub Y N 176 HIS ND1 CE1 doub Y N 177 HIS ND1 HD1 sing N N 178 HIS CD2 NE2 sing Y N 179 HIS CD2 HD2 sing N N 180 HIS CE1 NE2 sing Y N 181 HIS CE1 HE1 sing N N 182 HIS NE2 HE2 sing N N 183 HIS OXT HXT sing N N 184 HOH O H1 sing N N 185 HOH O H2 sing N N 186 ILE N CA sing N N 187 ILE N H sing N N 188 ILE N H2 sing N N 189 ILE CA C sing N N 190 ILE CA CB sing N N 191 ILE CA HA sing N N 192 ILE C O doub N N 193 ILE C OXT sing N N 194 ILE CB CG1 sing N N 195 ILE CB CG2 sing N N 196 ILE CB HB sing N N 197 ILE CG1 CD1 sing N N 198 ILE CG1 HG12 sing N N 199 ILE CG1 HG13 sing N N 200 ILE CG2 HG21 sing N N 201 ILE CG2 HG22 sing N N 202 ILE CG2 HG23 sing N N 203 ILE CD1 HD11 sing N N 204 ILE CD1 HD12 sing N N 205 ILE CD1 HD13 sing N N 206 ILE OXT HXT sing N N 207 LEU N CA sing N N 208 LEU N H sing N N 209 LEU N H2 sing N N 210 LEU CA C sing N N 211 LEU CA CB sing N N 212 LEU CA HA sing N N 213 LEU C O doub N N 214 LEU C OXT sing N N 215 LEU CB CG sing N N 216 LEU CB HB2 sing N N 217 LEU CB HB3 sing N N 218 LEU CG CD1 sing N N 219 LEU CG CD2 sing N N 220 LEU CG HG sing N N 221 LEU CD1 HD11 sing N N 222 LEU CD1 HD12 sing N N 223 LEU CD1 HD13 sing N N 224 LEU CD2 HD21 sing N N 225 LEU CD2 HD22 sing N N 226 LEU CD2 HD23 sing N N 227 LEU OXT HXT sing N N 228 LYS N CA sing N N 229 LYS N H sing N N 230 LYS N H2 sing N N 231 LYS CA C sing N N 232 LYS CA CB sing N N 233 LYS CA HA sing N N 234 LYS C O doub N N 235 LYS C OXT sing N N 236 LYS CB CG sing N N 237 LYS CB HB2 sing N N 238 LYS CB HB3 sing N N 239 LYS CG CD sing N N 240 LYS CG HG2 sing N N 241 LYS CG HG3 sing N N 242 LYS CD CE sing N N 243 LYS CD HD2 sing N N 244 LYS CD HD3 sing N N 245 LYS CE NZ sing N N 246 LYS CE HE2 sing N N 247 LYS CE HE3 sing N N 248 LYS NZ HZ1 sing N N 249 LYS NZ HZ2 sing N N 250 LYS NZ HZ3 sing N N 251 LYS OXT HXT sing N N 252 MET N CA sing N N 253 MET N H sing N N 254 MET N H2 sing N N 255 MET CA C sing N N 256 MET CA CB sing N N 257 MET CA HA sing N N 258 MET C O doub N N 259 MET C OXT sing N N 260 MET CB CG sing N N 261 MET CB HB2 sing N N 262 MET CB HB3 sing N N 263 MET CG SD sing N N 264 MET CG HG2 sing N N 265 MET CG HG3 sing N N 266 MET SD CE sing N N 267 MET CE HE1 sing N N 268 MET CE HE2 sing N N 269 MET CE HE3 sing N N 270 MET OXT HXT sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI125452 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM110444 2 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI125185 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GEY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GEY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 6DGJ _atom_sites.fract_transf_matrix[1][1] 0.025043 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.011939 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.034305 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026660 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_