data_6DHB # _entry.id 6DHB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DHB pdb_00006dhb 10.2210/pdb6dhb/pdb WWPDB D_1000234599 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-12 2 'Structure model' 1 1 2018-12-19 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2023-10-11 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_pdbx_audit_support.funding_organization' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DHB _pdbx_database_status.recvd_initial_deposition_date 2018-05-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gandhi, A.K.' 1 ? 'Kim, W.M.' 2 ? 'Huang, Y.H.' 3 ? 'Bonsor, D.' 4 ? 'Sundberg, E.' 5 ? 'Sun, Z.-Y.' 6 ? 'Petsko, G.A.' 7 ? 'Kuchroo, V.' 8 ? 'Blumberg, R.S.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 17512 _citation.page_last 17512 _citation.title 'High resolution X-ray and NMR structural study of human T-cell immunoglobulin and mucin domain containing protein-3.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-35754-0 _citation.pdbx_database_id_PubMed 30504845 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gandhi, A.K.' 1 ? primary 'Kim, W.M.' 2 ? primary 'Sun, Z.J.' 3 ? primary 'Huang, Y.H.' 4 ? primary 'Bonsor, D.A.' 5 ? primary 'Sundberg, E.J.' 6 ? primary 'Kondo, Y.' 7 ? primary 'Wagner, G.' 8 ? primary 'Kuchroo, V.K.' 9 ? primary 'Petsko, G.' 10 ? primary 'Blumberg, R.S.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hepatitis A virus cellular receptor 2' 12213.006 1 ? ? 'unp residues 24-130' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'BENZOIC ACID' 122.121 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 5 water nat water 18.015 100 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;HAVcr-2,T-cell immunoglobulin and mucin domain-containing protein 3,TIMD-3,T-cell immunoglobulin mucin receptor 3,TIM-3,T-cell membrane protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTL ADSGIYCCRIQIPGIMNDEKFNLKLVIK ; _entity_poly.pdbx_seq_one_letter_code_can ;MVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTL ADSGIYCCRIQIPGIMNDEKFNLKLVIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'BENZOIC ACID' BEZ 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 GLU n 1 4 TYR n 1 5 ARG n 1 6 ALA n 1 7 GLU n 1 8 VAL n 1 9 GLY n 1 10 GLN n 1 11 ASN n 1 12 ALA n 1 13 TYR n 1 14 LEU n 1 15 PRO n 1 16 CYS n 1 17 PHE n 1 18 TYR n 1 19 THR n 1 20 PRO n 1 21 ALA n 1 22 ALA n 1 23 PRO n 1 24 GLY n 1 25 ASN n 1 26 LEU n 1 27 VAL n 1 28 PRO n 1 29 VAL n 1 30 CYS n 1 31 TRP n 1 32 GLY n 1 33 LYS n 1 34 GLY n 1 35 ALA n 1 36 CYS n 1 37 PRO n 1 38 VAL n 1 39 PHE n 1 40 GLU n 1 41 CYS n 1 42 GLY n 1 43 ASN n 1 44 VAL n 1 45 VAL n 1 46 LEU n 1 47 ARG n 1 48 THR n 1 49 ASP n 1 50 GLU n 1 51 ARG n 1 52 ASP n 1 53 VAL n 1 54 ASN n 1 55 TYR n 1 56 TRP n 1 57 THR n 1 58 SER n 1 59 ARG n 1 60 TYR n 1 61 TRP n 1 62 LEU n 1 63 ASN n 1 64 GLY n 1 65 ASP n 1 66 PHE n 1 67 ARG n 1 68 LYS n 1 69 GLY n 1 70 ASP n 1 71 VAL n 1 72 SER n 1 73 LEU n 1 74 THR n 1 75 ILE n 1 76 GLU n 1 77 ASN n 1 78 VAL n 1 79 THR n 1 80 LEU n 1 81 ALA n 1 82 ASP n 1 83 SER n 1 84 GLY n 1 85 ILE n 1 86 TYR n 1 87 CYS n 1 88 CYS n 1 89 ARG n 1 90 ILE n 1 91 GLN n 1 92 ILE n 1 93 PRO n 1 94 GLY n 1 95 ILE n 1 96 MET n 1 97 ASN n 1 98 ASP n 1 99 GLU n 1 100 LYS n 1 101 PHE n 1 102 ASN n 1 103 LEU n 1 104 LYS n 1 105 LEU n 1 106 VAL n 1 107 ILE n 1 108 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HAVCR2, TIM3, TIMD3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEZ non-polymer . 'BENZOIC ACID' ? 'C7 H6 O2' 122.121 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LYS 108 108 108 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 201 CA CA A . C 3 BEZ 1 202 202 BEZ BEZ A . D 4 EDO 1 203 203 EDO EDO A . E 4 EDO 1 204 204 EDO EDO A . F 5 HOH 1 301 301 HOH HOH A . F 5 HOH 2 302 302 HOH HOH A . F 5 HOH 3 303 303 HOH HOH A . F 5 HOH 4 304 304 HOH HOH A . F 5 HOH 5 305 305 HOH HOH A . F 5 HOH 6 306 306 HOH HOH A . F 5 HOH 7 307 307 HOH HOH A . F 5 HOH 8 308 308 HOH HOH A . F 5 HOH 9 309 309 HOH HOH A . F 5 HOH 10 310 310 HOH HOH A . F 5 HOH 11 311 311 HOH HOH A . F 5 HOH 12 312 312 HOH HOH A . F 5 HOH 13 313 313 HOH HOH A . F 5 HOH 14 314 314 HOH HOH A . F 5 HOH 15 315 315 HOH HOH A . F 5 HOH 16 316 316 HOH HOH A . F 5 HOH 17 317 317 HOH HOH A . F 5 HOH 18 318 318 HOH HOH A . F 5 HOH 19 319 319 HOH HOH A . F 5 HOH 20 320 320 HOH HOH A . F 5 HOH 21 321 321 HOH HOH A . F 5 HOH 22 322 322 HOH HOH A . F 5 HOH 23 323 323 HOH HOH A . F 5 HOH 24 324 324 HOH HOH A . F 5 HOH 25 325 325 HOH HOH A . F 5 HOH 26 326 326 HOH HOH A . F 5 HOH 27 327 327 HOH HOH A . F 5 HOH 28 328 328 HOH HOH A . F 5 HOH 29 329 329 HOH HOH A . F 5 HOH 30 330 330 HOH HOH A . F 5 HOH 31 331 331 HOH HOH A . F 5 HOH 32 332 332 HOH HOH A . F 5 HOH 33 333 333 HOH HOH A . F 5 HOH 34 334 334 HOH HOH A . F 5 HOH 35 335 335 HOH HOH A . F 5 HOH 36 336 336 HOH HOH A . F 5 HOH 37 337 337 HOH HOH A . F 5 HOH 38 338 338 HOH HOH A . F 5 HOH 39 339 339 HOH HOH A . F 5 HOH 40 340 340 HOH HOH A . F 5 HOH 41 341 341 HOH HOH A . F 5 HOH 42 342 342 HOH HOH A . F 5 HOH 43 343 343 HOH HOH A . F 5 HOH 44 344 344 HOH HOH A . F 5 HOH 45 345 345 HOH HOH A . F 5 HOH 46 346 346 HOH HOH A . F 5 HOH 47 347 347 HOH HOH A . F 5 HOH 48 348 348 HOH HOH A . F 5 HOH 49 349 349 HOH HOH A . F 5 HOH 50 350 350 HOH HOH A . F 5 HOH 51 351 351 HOH HOH A . F 5 HOH 52 352 352 HOH HOH A . F 5 HOH 53 353 353 HOH HOH A . F 5 HOH 54 354 354 HOH HOH A . F 5 HOH 55 355 355 HOH HOH A . F 5 HOH 56 356 356 HOH HOH A . F 5 HOH 57 357 357 HOH HOH A . F 5 HOH 58 358 358 HOH HOH A . F 5 HOH 59 359 359 HOH HOH A . F 5 HOH 60 360 360 HOH HOH A . F 5 HOH 61 361 361 HOH HOH A . F 5 HOH 62 362 362 HOH HOH A . F 5 HOH 63 363 363 HOH HOH A . F 5 HOH 64 364 364 HOH HOH A . F 5 HOH 65 365 365 HOH HOH A . F 5 HOH 66 366 366 HOH HOH A . F 5 HOH 67 367 367 HOH HOH A . F 5 HOH 68 368 368 HOH HOH A . F 5 HOH 69 369 369 HOH HOH A . F 5 HOH 70 370 370 HOH HOH A . F 5 HOH 71 371 371 HOH HOH A . F 5 HOH 72 372 372 HOH HOH A . F 5 HOH 73 373 373 HOH HOH A . F 5 HOH 74 374 374 HOH HOH A . F 5 HOH 75 375 375 HOH HOH A . F 5 HOH 76 376 376 HOH HOH A . F 5 HOH 77 377 377 HOH HOH A . F 5 HOH 78 378 378 HOH HOH A . F 5 HOH 79 379 379 HOH HOH A . F 5 HOH 80 380 380 HOH HOH A . F 5 HOH 81 381 381 HOH HOH A . F 5 HOH 82 382 382 HOH HOH A . F 5 HOH 83 383 383 HOH HOH A . F 5 HOH 84 384 384 HOH HOH A . F 5 HOH 85 385 385 HOH HOH A . F 5 HOH 86 386 386 HOH HOH A . F 5 HOH 87 387 387 HOH HOH A . F 5 HOH 88 388 388 HOH HOH A . F 5 HOH 89 389 389 HOH HOH A . F 5 HOH 90 390 390 HOH HOH A . F 5 HOH 91 391 391 HOH HOH A . F 5 HOH 92 392 392 HOH HOH A . F 5 HOH 93 393 393 HOH HOH A . F 5 HOH 94 394 394 HOH HOH A . F 5 HOH 95 395 395 HOH HOH A . F 5 HOH 96 396 396 HOH HOH A . F 5 HOH 97 397 397 HOH HOH A . F 5 HOH 98 398 398 HOH HOH A . F 5 HOH 99 399 399 HOH HOH A . F 5 HOH 100 400 400 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6DHB _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.310 _cell.length_a_esd ? _cell.length_b 43.060 _cell.length_b_esd ? _cell.length_c 51.720 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DHB _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DHB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Tris, PEG' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6DHB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 43.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10879 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.085 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.51 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.02 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.50 _refine.B_iso_max ? _refine.B_iso_mean 13.759 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.942 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DHB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 33.09 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10256 _refine.ls_number_reflns_R_free 528 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.13 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.15174 _refine.ls_R_factor_R_free 0.18054 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.15024 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '5F71, 2OYP' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.102 _refine.pdbx_overall_ESU_R_Free 0.097 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.665 _refine.overall_SU_ML 0.056 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 856 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 974 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 33.09 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.023 0.020 898 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 839 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.056 1.968 1217 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.092 3.000 1923 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.682 5.000 107 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 26.986 23.902 41 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.584 15.000 140 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.637 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.125 0.200 129 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.021 1014 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 212 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.391 1.054 431 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.327 1.049 430 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.073 1.574 537 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.072 1.582 538 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.865 1.394 467 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.866 1.394 467 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.481 1.933 681 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.200 9.804 1034 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.066 9.368 998 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.700 _refine_ls_shell.d_res_low 1.744 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 684 _refine_ls_shell.percent_reflns_obs 91.60 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.235 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.139 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6DHB _struct.title 'Crystal structure of the human TIM-3 with bound Calcium' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DHB _struct_keywords.text 'T Cell Immunoglobulin Mucin-3 Immunological tolerance, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HAVR2_HUMAN _struct_ref.pdbx_db_accession Q8TDQ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLA DSGIYCCRIQIPGIMNDEKFNLKLVIK ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6DHB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TDQ0 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 108 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6DHB _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8TDQ0 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 65 ? GLY A 69 ? ASP A 65 GLY A 69 5 ? 5 HELX_P HELX_P2 AA2 THR A 79 ? SER A 83 ? THR A 79 SER A 83 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 16 A CYS 88 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 30 A CYS 41 1_555 ? ? ? ? ? ? ? 2.124 ? ? disulf3 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 36 A CYS 87 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc1 metalc ? ? A ILE 92 O ? ? ? 1_555 B CA . CA ? ? A ILE 92 A CA 201 1_555 ? ? ? ? ? ? ? 2.260 ? ? metalc2 metalc ? ? A GLY 94 O ? ? ? 1_555 B CA . CA ? ? A GLY 94 A CA 201 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc3 metalc ? ? A ASN 97 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 97 A CA 201 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc4 metalc ? ? A ASP 98 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 98 A CA 201 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 C BEZ . O2 ? ? A CA 201 A BEZ 202 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 201 A HOH 387 1_555 ? ? ? ? ? ? ? 2.345 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ILE 92 ? A ILE 92 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A GLY 94 ? A GLY 94 ? 1_555 100.9 ? 2 O ? A ILE 92 ? A ILE 92 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 85.7 ? 3 O ? A GLY 94 ? A GLY 94 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 81.9 ? 4 O ? A ILE 92 ? A ILE 92 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 92.3 ? 5 O ? A GLY 94 ? A GLY 94 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 166.7 ? 6 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 101.2 ? 7 O ? A ILE 92 ? A ILE 92 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O2 ? C BEZ . ? A BEZ 202 ? 1_555 167.5 ? 8 O ? A GLY 94 ? A GLY 94 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O2 ? C BEZ . ? A BEZ 202 ? 1_555 87.3 ? 9 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O2 ? C BEZ . ? A BEZ 202 ? 1_555 86.1 ? 10 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O2 ? C BEZ . ? A BEZ 202 ? 1_555 80.0 ? 11 O ? A ILE 92 ? A ILE 92 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 89.1 ? 12 O ? A GLY 94 ? A GLY 94 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 86.0 ? 13 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 165.7 ? 14 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 92.4 ? 15 O2 ? C BEZ . ? A BEZ 202 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? F HOH . ? A HOH 387 ? 1_555 100.9 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 16 ? CYS A 88 ? CYS A 16 ? 1_555 CYS A 88 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 30 ? CYS A 41 ? CYS A 30 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 36 ? CYS A 87 ? CYS A 36 ? 1_555 CYS A 87 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? GLU A 7 ? VAL A 2 GLU A 7 AA1 2 GLU A 99 ? LYS A 108 ? GLU A 99 LYS A 108 AA1 3 GLY A 84 ? ILE A 90 ? GLY A 84 ILE A 90 AA1 4 VAL A 29 ? LYS A 33 ? VAL A 29 LYS A 33 AA1 5 VAL A 44 ? THR A 48 ? VAL A 44 THR A 48 AA1 6 VAL A 53 ? TYR A 55 ? VAL A 53 TYR A 55 AA2 1 ALA A 12 ? LEU A 14 ? ALA A 12 LEU A 14 AA2 2 LEU A 73 ? ILE A 75 ? LEU A 73 ILE A 75 AA2 3 TYR A 60 ? LEU A 62 ? TYR A 60 LEU A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 4 ? N TYR A 4 O LYS A 104 ? O LYS A 104 AA1 2 3 O LEU A 105 ? O LEU A 105 N GLY A 84 ? N GLY A 84 AA1 3 4 O ARG A 89 ? O ARG A 89 N CYS A 30 ? N CYS A 30 AA1 4 5 N TRP A 31 ? N TRP A 31 O VAL A 45 ? O VAL A 45 AA1 5 6 N ARG A 47 ? N ARG A 47 O TYR A 55 ? O TYR A 55 AA2 1 2 N ALA A 12 ? N ALA A 12 O ILE A 75 ? O ILE A 75 AA2 2 3 O THR A 74 ? O THR A 74 N TRP A 61 ? N TRP A 61 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 6 'binding site for residue CA A 201' AC2 Software A BEZ 202 ? 10 'binding site for residue BEZ A 202' AC3 Software A EDO 203 ? 5 'binding site for residue EDO A 203' AC4 Software A EDO 204 ? 5 'binding site for residue EDO A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ILE A 92 ? ILE A 92 . ? 1_555 ? 2 AC1 6 GLY A 94 ? GLY A 94 . ? 1_555 ? 3 AC1 6 ASN A 97 ? ASN A 97 . ? 1_555 ? 4 AC1 6 ASP A 98 ? ASP A 98 . ? 1_555 ? 5 AC1 6 BEZ C . ? BEZ A 202 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 387 . ? 1_555 ? 7 AC2 10 TYR A 13 ? TYR A 13 . ? 4_545 ? 8 AC2 10 VAL A 38 ? VAL A 38 . ? 1_555 ? 9 AC2 10 PHE A 39 ? PHE A 39 . ? 1_555 ? 10 AC2 10 ARG A 89 ? ARG A 89 . ? 1_555 ? 11 AC2 10 GLY A 94 ? GLY A 94 . ? 1_555 ? 12 AC2 10 MET A 96 ? MET A 96 . ? 1_555 ? 13 AC2 10 ASN A 97 ? ASN A 97 . ? 1_555 ? 14 AC2 10 ASP A 98 ? ASP A 98 . ? 1_555 ? 15 AC2 10 CA B . ? CA A 201 . ? 1_555 ? 16 AC2 10 HOH F . ? HOH A 331 . ? 1_555 ? 17 AC3 5 GLY A 34 ? GLY A 34 . ? 1_555 ? 18 AC3 5 ALA A 81 ? ALA A 81 . ? 1_555 ? 19 AC3 5 SER A 83 ? SER A 83 . ? 1_555 ? 20 AC3 5 ILE A 85 ? ILE A 85 . ? 1_555 ? 21 AC3 5 TYR A 86 ? TYR A 86 . ? 1_555 ? 22 AC4 5 GLU A 3 ? GLU A 3 . ? 2_455 ? 23 AC4 5 TRP A 56 ? TRP A 56 . ? 1_555 ? 24 AC4 5 LEU A 62 ? LEU A 62 . ? 1_555 ? 25 AC4 5 LYS A 104 ? LYS A 104 . ? 2_455 ? 26 AC4 5 HOH F . ? HOH A 350 . ? 1_555 ? # _pdbx_entry_details.entry_id 6DHB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 320 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 337 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_545 _pdbx_validate_symm_contact.dist 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 47 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 47 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 47 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.68 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.62 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 40 ? ? 68.30 -166.02 2 1 ASP A 49 ? ? -127.98 -149.57 3 1 ARG A 51 ? ? -140.88 -21.98 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEZ C C N N 74 BEZ O1 O N N 75 BEZ O2 O N N 76 BEZ C1 C Y N 77 BEZ C2 C Y N 78 BEZ C3 C Y N 79 BEZ C4 C Y N 80 BEZ C5 C Y N 81 BEZ C6 C Y N 82 BEZ HO2 H N N 83 BEZ H2 H N N 84 BEZ H3 H N N 85 BEZ H4 H N N 86 BEZ H5 H N N 87 BEZ H6 H N N 88 CA CA CA N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 EDO C1 C N N 104 EDO O1 O N N 105 EDO C2 C N N 106 EDO O2 O N N 107 EDO H11 H N N 108 EDO H12 H N N 109 EDO HO1 H N N 110 EDO H21 H N N 111 EDO H22 H N N 112 EDO HO2 H N N 113 GLN N N N N 114 GLN CA C N S 115 GLN C C N N 116 GLN O O N N 117 GLN CB C N N 118 GLN CG C N N 119 GLN CD C N N 120 GLN OE1 O N N 121 GLN NE2 N N N 122 GLN OXT O N N 123 GLN H H N N 124 GLN H2 H N N 125 GLN HA H N N 126 GLN HB2 H N N 127 GLN HB3 H N N 128 GLN HG2 H N N 129 GLN HG3 H N N 130 GLN HE21 H N N 131 GLN HE22 H N N 132 GLN HXT H N N 133 GLU N N N N 134 GLU CA C N S 135 GLU C C N N 136 GLU O O N N 137 GLU CB C N N 138 GLU CG C N N 139 GLU CD C N N 140 GLU OE1 O N N 141 GLU OE2 O N N 142 GLU OXT O N N 143 GLU H H N N 144 GLU H2 H N N 145 GLU HA H N N 146 GLU HB2 H N N 147 GLU HB3 H N N 148 GLU HG2 H N N 149 GLU HG3 H N N 150 GLU HE2 H N N 151 GLU HXT H N N 152 GLY N N N N 153 GLY CA C N N 154 GLY C C N N 155 GLY O O N N 156 GLY OXT O N N 157 GLY H H N N 158 GLY H2 H N N 159 GLY HA2 H N N 160 GLY HA3 H N N 161 GLY HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEZ C O1 doub N N 70 BEZ C O2 sing N N 71 BEZ C C1 sing N N 72 BEZ O2 HO2 sing N N 73 BEZ C1 C2 doub Y N 74 BEZ C1 C6 sing Y N 75 BEZ C2 C3 sing Y N 76 BEZ C2 H2 sing N N 77 BEZ C3 C4 doub Y N 78 BEZ C3 H3 sing N N 79 BEZ C4 C5 sing Y N 80 BEZ C4 H4 sing N N 81 BEZ C5 C6 doub Y N 82 BEZ C5 H5 sing N N 83 BEZ C6 H6 sing N N 84 CYS N CA sing N N 85 CYS N H sing N N 86 CYS N H2 sing N N 87 CYS CA C sing N N 88 CYS CA CB sing N N 89 CYS CA HA sing N N 90 CYS C O doub N N 91 CYS C OXT sing N N 92 CYS CB SG sing N N 93 CYS CB HB2 sing N N 94 CYS CB HB3 sing N N 95 CYS SG HG sing N N 96 CYS OXT HXT sing N N 97 EDO C1 O1 sing N N 98 EDO C1 C2 sing N N 99 EDO C1 H11 sing N N 100 EDO C1 H12 sing N N 101 EDO O1 HO1 sing N N 102 EDO C2 O2 sing N N 103 EDO C2 H21 sing N N 104 EDO C2 H22 sing N N 105 EDO O2 HO2 sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HOH O H1 sing N N 153 HOH O H2 sing N N 154 ILE N CA sing N N 155 ILE N H sing N N 156 ILE N H2 sing N N 157 ILE CA C sing N N 158 ILE CA CB sing N N 159 ILE CA HA sing N N 160 ILE C O doub N N 161 ILE C OXT sing N N 162 ILE CB CG1 sing N N 163 ILE CB CG2 sing N N 164 ILE CB HB sing N N 165 ILE CG1 CD1 sing N N 166 ILE CG1 HG12 sing N N 167 ILE CG1 HG13 sing N N 168 ILE CG2 HG21 sing N N 169 ILE CG2 HG22 sing N N 170 ILE CG2 HG23 sing N N 171 ILE CD1 HD11 sing N N 172 ILE CD1 HD12 sing N N 173 ILE CD1 HD13 sing N N 174 ILE OXT HXT sing N N 175 LEU N CA sing N N 176 LEU N H sing N N 177 LEU N H2 sing N N 178 LEU CA C sing N N 179 LEU CA CB sing N N 180 LEU CA HA sing N N 181 LEU C O doub N N 182 LEU C OXT sing N N 183 LEU CB CG sing N N 184 LEU CB HB2 sing N N 185 LEU CB HB3 sing N N 186 LEU CG CD1 sing N N 187 LEU CG CD2 sing N N 188 LEU CG HG sing N N 189 LEU CD1 HD11 sing N N 190 LEU CD1 HD12 sing N N 191 LEU CD1 HD13 sing N N 192 LEU CD2 HD21 sing N N 193 LEU CD2 HD22 sing N N 194 LEU CD2 HD23 sing N N 195 LEU OXT HXT sing N N 196 LYS N CA sing N N 197 LYS N H sing N N 198 LYS N H2 sing N N 199 LYS CA C sing N N 200 LYS CA CB sing N N 201 LYS CA HA sing N N 202 LYS C O doub N N 203 LYS C OXT sing N N 204 LYS CB CG sing N N 205 LYS CB HB2 sing N N 206 LYS CB HB3 sing N N 207 LYS CG CD sing N N 208 LYS CG HG2 sing N N 209 LYS CG HG3 sing N N 210 LYS CD CE sing N N 211 LYS CD HD2 sing N N 212 LYS CD HD3 sing N N 213 LYS CE NZ sing N N 214 LYS CE HE2 sing N N 215 LYS CE HE3 sing N N 216 LYS NZ HZ1 sing N N 217 LYS NZ HZ2 sing N N 218 LYS NZ HZ3 sing N N 219 LYS OXT HXT sing N N 220 MET N CA sing N N 221 MET N H sing N N 222 MET N H2 sing N N 223 MET CA C sing N N 224 MET CA CB sing N N 225 MET CA HA sing N N 226 MET C O doub N N 227 MET C OXT sing N N 228 MET CB CG sing N N 229 MET CB HB2 sing N N 230 MET CB HB3 sing N N 231 MET CG SD sing N N 232 MET CG HG2 sing N N 233 MET CG HG3 sing N N 234 MET SD CE sing N N 235 MET CE HE1 sing N N 236 MET CE HE2 sing N N 237 MET CE HE3 sing N N 238 MET OXT HXT sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 5F71 '5F71, 2OYP' 2 ? 'experimental model' PDB 2OYP '5F71, 2OYP' # _atom_sites.entry_id 6DHB _atom_sites.fract_transf_matrix[1][1] 0.023635 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023223 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019335 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_