data_6DLC # _entry.id 6DLC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DLC pdb_00006dlc 10.2210/pdb6dlc/pdb WWPDB D_1000234847 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-26 2 'Structure model' 1 1 2019-01-09 3 'Structure model' 1 2 2019-01-16 4 'Structure model' 1 3 2019-11-20 5 'Structure model' 1 4 2024-03-13 6 'Structure model' 1 5 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.year' 14 4 'Structure model' '_pdbx_audit_support.funding_organization' 15 5 'Structure model' '_database_2.pdbx_DOI' 16 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DLC _pdbx_database_status.recvd_initial_deposition_date 2018-05-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bick, M.J.' 1 0000-0002-9585-859X 'Chen, Z.' 2 0000-0003-2990-2895 'Baker, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 565 _citation.language ? _citation.page_first 106 _citation.page_last 111 _citation.title 'Programmable design of orthogonal protein heterodimers.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-018-0802-y _citation.pdbx_database_id_PubMed 30568301 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, Z.' 1 ? primary 'Boyken, S.E.' 2 ? primary 'Jia, M.' 3 ? primary 'Busch, F.' 4 ? primary 'Flores-Solis, D.' 5 ? primary 'Bick, M.J.' 6 ? primary 'Lu, P.' 7 ? primary 'VanAernum, Z.L.' 8 ? primary 'Sahasrabuddhe, A.' 9 ? primary 'Langan, R.A.' 10 ? primary 'Bermeo, S.' 11 ? primary 'Brunette, T.J.' 12 ? primary 'Mulligan, V.K.' 13 ? primary 'Carter, L.P.' 14 ? primary 'DiMaio, F.' 15 ? primary 'Sgourakis, N.G.' 16 ? primary 'Wysocki, V.H.' 17 ? primary 'Baker, D.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Designed protein DHD1:234_A' 13897.054 1 ? ? ? ? 2 polymer man 'Designed protein DHD1:234_B' 4177.902 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDSDEHLYKLKTFLENLRRHLDRLDKHIKQLRDILSENPEDERVKDAIDLSERSVRIVKTVIKIFEDSVRKKEKRPIDKR DDKELDKLLDTLEKILQTATKIIDDANKLLEYLRR ; ;MDSDEHLYKLKTFLENLRRHLDRLDKHIKQLRDILSENPEDERVKDAIDLSERSVRIVKTVIKIFEDSVRKKEKRPIDKR DDKELDKLLDTLEKILQTATKIIDDANKLLEYLRR ; A ? 2 'polypeptide(L)' no no HGDPKVVETYVELLKRHEKAVKELLEIAKTHAKKVE HGDPKVVETYVELLKRHEKAVKELLEIAKTHAKKVE B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 ASP n 1 5 GLU n 1 6 HIS n 1 7 LEU n 1 8 TYR n 1 9 LYS n 1 10 LEU n 1 11 LYS n 1 12 THR n 1 13 PHE n 1 14 LEU n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 ARG n 1 19 ARG n 1 20 HIS n 1 21 LEU n 1 22 ASP n 1 23 ARG n 1 24 LEU n 1 25 ASP n 1 26 LYS n 1 27 HIS n 1 28 ILE n 1 29 LYS n 1 30 GLN n 1 31 LEU n 1 32 ARG n 1 33 ASP n 1 34 ILE n 1 35 LEU n 1 36 SER n 1 37 GLU n 1 38 ASN n 1 39 PRO n 1 40 GLU n 1 41 ASP n 1 42 GLU n 1 43 ARG n 1 44 VAL n 1 45 LYS n 1 46 ASP n 1 47 ALA n 1 48 ILE n 1 49 ASP n 1 50 LEU n 1 51 SER n 1 52 GLU n 1 53 ARG n 1 54 SER n 1 55 VAL n 1 56 ARG n 1 57 ILE n 1 58 VAL n 1 59 LYS n 1 60 THR n 1 61 VAL n 1 62 ILE n 1 63 LYS n 1 64 ILE n 1 65 PHE n 1 66 GLU n 1 67 ASP n 1 68 SER n 1 69 VAL n 1 70 ARG n 1 71 LYS n 1 72 LYS n 1 73 GLU n 1 74 LYS n 1 75 ARG n 1 76 PRO n 1 77 ILE n 1 78 ASP n 1 79 LYS n 1 80 ARG n 1 81 ASP n 1 82 ASP n 1 83 LYS n 1 84 GLU n 1 85 LEU n 1 86 ASP n 1 87 LYS n 1 88 LEU n 1 89 LEU n 1 90 ASP n 1 91 THR n 1 92 LEU n 1 93 GLU n 1 94 LYS n 1 95 ILE n 1 96 LEU n 1 97 GLN n 1 98 THR n 1 99 ALA n 1 100 THR n 1 101 LYS n 1 102 ILE n 1 103 ILE n 1 104 ASP n 1 105 ASP n 1 106 ALA n 1 107 ASN n 1 108 LYS n 1 109 LEU n 1 110 LEU n 1 111 GLU n 1 112 TYR n 1 113 LEU n 1 114 ARG n 1 115 ARG n 2 1 HIS n 2 2 GLY n 2 3 ASP n 2 4 PRO n 2 5 LYS n 2 6 VAL n 2 7 VAL n 2 8 GLU n 2 9 THR n 2 10 TYR n 2 11 VAL n 2 12 GLU n 2 13 LEU n 2 14 LEU n 2 15 LYS n 2 16 ARG n 2 17 HIS n 2 18 GLU n 2 19 LYS n 2 20 ALA n 2 21 VAL n 2 22 LYS n 2 23 GLU n 2 24 LEU n 2 25 LEU n 2 26 GLU n 2 27 ILE n 2 28 ALA n 2 29 LYS n 2 30 THR n 2 31 HIS n 2 32 ALA n 2 33 LYS n 2 34 LYS n 2 35 VAL n 2 36 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 115 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 36 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASP 2 1 ? ? ? A . n A 1 3 SER 3 2 ? ? ? A . n A 1 4 ASP 4 3 ? ? ? A . n A 1 5 GLU 5 4 ? ? ? A . n A 1 6 HIS 6 5 ? ? ? A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 TYR 8 7 7 TYR TYR A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 PHE 13 12 12 PHE PHE A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 ASN 16 15 15 ASN ASN A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 HIS 20 19 19 HIS HIS A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 ASP 25 24 24 ASP ASP A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 HIS 27 26 26 HIS HIS A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 ILE 34 33 33 ILE ILE A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 GLU 37 36 36 GLU GLU A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 PRO 39 38 38 PRO PRO A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 ARG 43 42 42 ARG ARG A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 ASP 49 48 48 ASP ASP A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ARG 56 55 55 ARG ARG A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 LYS 59 58 58 LYS LYS A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 VAL 61 60 60 VAL VAL A . n A 1 62 ILE 62 61 61 ILE ILE A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 PHE 65 64 64 PHE PHE A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 ASP 67 66 66 ASP ASP A . n A 1 68 SER 68 67 67 SER SER A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 LYS 71 70 70 LYS LYS A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 ILE 77 76 ? ? ? A . n A 1 78 ASP 78 77 ? ? ? A . n A 1 79 LYS 79 78 ? ? ? A . n A 1 80 ARG 80 79 ? ? ? A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 THR 91 90 90 THR THR A . n A 1 92 LEU 92 91 91 LEU LEU A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 GLN 97 96 96 GLN GLN A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 THR 100 99 99 THR THR A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 ASP 104 103 103 ASP ASP A . n A 1 105 ASP 105 104 104 ASP ASP A . n A 1 106 ALA 106 105 105 ALA ALA A . n A 1 107 ASN 107 106 106 ASN ASN A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 GLU 111 110 110 GLU GLU A . n A 1 112 TYR 112 111 111 TYR TYR A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 ARG 114 113 113 ARG ARG A . n A 1 115 ARG 115 114 114 ARG ARG A . n B 2 1 HIS 1 114 ? ? ? B . n B 2 2 GLY 2 115 115 GLY GLY B . n B 2 3 ASP 3 116 116 ASP ASP B . n B 2 4 PRO 4 117 117 PRO PRO B . n B 2 5 LYS 5 118 118 LYS LYS B . n B 2 6 VAL 6 119 119 VAL VAL B . n B 2 7 VAL 7 120 120 VAL VAL B . n B 2 8 GLU 8 121 121 GLU GLU B . n B 2 9 THR 9 122 122 THR THR B . n B 2 10 TYR 10 123 123 TYR TYR B . n B 2 11 VAL 11 124 124 VAL VAL B . n B 2 12 GLU 12 125 125 GLU GLU B . n B 2 13 LEU 13 126 126 LEU LEU B . n B 2 14 LEU 14 127 127 LEU LEU B . n B 2 15 LYS 15 128 128 LYS LYS B . n B 2 16 ARG 16 129 129 ARG ARG B . n B 2 17 HIS 17 130 130 HIS HIS B . n B 2 18 GLU 18 131 131 GLU GLU B . n B 2 19 LYS 19 132 132 LYS LYS B . n B 2 20 ALA 20 133 133 ALA ALA B . n B 2 21 VAL 21 134 134 VAL VAL B . n B 2 22 LYS 22 135 135 LYS LYS B . n B 2 23 GLU 23 136 136 GLU GLU B . n B 2 24 LEU 24 137 137 LEU LEU B . n B 2 25 LEU 25 138 138 LEU LEU B . n B 2 26 GLU 26 139 139 GLU GLU B . n B 2 27 ILE 27 140 140 ILE ILE B . n B 2 28 ALA 28 141 141 ALA ALA B . n B 2 29 LYS 29 142 142 LYS LYS B . n B 2 30 THR 30 143 143 THR THR B . n B 2 31 HIS 31 144 144 HIS HIS B . n B 2 32 ALA 32 145 145 ALA ALA B . n B 2 33 LYS 33 146 146 LYS LYS B . n B 2 34 LYS 34 147 147 LYS LYS B . n B 2 35 VAL 35 148 ? ? ? B . n B 2 36 GLU 36 149 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 6 ? CG ? A LEU 7 CG 2 1 Y 1 A LEU 6 ? CD1 ? A LEU 7 CD1 3 1 Y 1 A LEU 6 ? CD2 ? A LEU 7 CD2 4 1 Y 1 A LYS 8 ? CG ? A LYS 9 CG 5 1 Y 1 A LYS 8 ? CD ? A LYS 9 CD 6 1 Y 1 A LYS 8 ? CE ? A LYS 9 CE 7 1 Y 1 A LYS 8 ? NZ ? A LYS 9 NZ 8 1 Y 1 A LEU 9 ? CD1 ? A LEU 10 CD1 9 1 Y 1 A LEU 9 ? CD2 ? A LEU 10 CD2 10 1 Y 1 A LYS 10 ? CG ? A LYS 11 CG 11 1 Y 1 A LYS 10 ? CD ? A LYS 11 CD 12 1 Y 1 A LYS 10 ? CE ? A LYS 11 CE 13 1 Y 1 A LYS 10 ? NZ ? A LYS 11 NZ 14 1 Y 1 A LEU 13 ? CD1 ? A LEU 14 CD1 15 1 Y 1 A LEU 13 ? CD2 ? A LEU 14 CD2 16 1 Y 1 A GLU 14 ? CG ? A GLU 15 CG 17 1 Y 1 A GLU 14 ? CD ? A GLU 15 CD 18 1 Y 1 A GLU 14 ? OE1 ? A GLU 15 OE1 19 1 Y 1 A GLU 14 ? OE2 ? A GLU 15 OE2 20 1 Y 1 A LEU 16 ? CD1 ? A LEU 17 CD1 21 1 Y 1 A LEU 16 ? CD2 ? A LEU 17 CD2 22 1 Y 1 A LEU 20 ? CD1 ? A LEU 21 CD1 23 1 Y 1 A LEU 20 ? CD2 ? A LEU 21 CD2 24 1 Y 1 A ASP 21 ? CG ? A ASP 22 CG 25 1 Y 1 A ASP 21 ? OD1 ? A ASP 22 OD1 26 1 Y 1 A ASP 21 ? OD2 ? A ASP 22 OD2 27 1 Y 1 A LYS 25 ? CG ? A LYS 26 CG 28 1 Y 1 A LYS 25 ? CD ? A LYS 26 CD 29 1 Y 1 A LYS 25 ? CE ? A LYS 26 CE 30 1 Y 1 A LYS 25 ? NZ ? A LYS 26 NZ 31 1 Y 1 A LYS 28 ? CD ? A LYS 29 CD 32 1 Y 1 A LYS 28 ? CE ? A LYS 29 CE 33 1 Y 1 A LYS 28 ? NZ ? A LYS 29 NZ 34 1 Y 1 A ARG 31 ? CD ? A ARG 32 CD 35 1 Y 1 A ARG 31 ? NE ? A ARG 32 NE 36 1 Y 1 A ARG 31 ? CZ ? A ARG 32 CZ 37 1 Y 1 A ARG 31 ? NH1 ? A ARG 32 NH1 38 1 Y 1 A ARG 31 ? NH2 ? A ARG 32 NH2 39 1 Y 1 A ASP 32 ? CG ? A ASP 33 CG 40 1 Y 1 A ASP 32 ? OD1 ? A ASP 33 OD1 41 1 Y 1 A ASP 32 ? OD2 ? A ASP 33 OD2 42 1 Y 1 A ILE 33 ? CG1 ? A ILE 34 CG1 43 1 Y 1 A ILE 33 ? CG2 ? A ILE 34 CG2 44 1 Y 1 A ILE 33 ? CD1 ? A ILE 34 CD1 45 1 Y 1 A LEU 34 ? CG ? A LEU 35 CG 46 1 Y 1 A LEU 34 ? CD1 ? A LEU 35 CD1 47 1 Y 1 A LEU 34 ? CD2 ? A LEU 35 CD2 48 1 Y 1 A SER 35 ? OG ? A SER 36 OG 49 1 Y 1 A GLU 36 ? CD ? A GLU 37 CD 50 1 Y 1 A GLU 36 ? OE1 ? A GLU 37 OE1 51 1 Y 1 A GLU 36 ? OE2 ? A GLU 37 OE2 52 1 Y 1 A GLU 39 ? CG ? A GLU 40 CG 53 1 Y 1 A GLU 39 ? CD ? A GLU 40 CD 54 1 Y 1 A GLU 39 ? OE1 ? A GLU 40 OE1 55 1 Y 1 A GLU 39 ? OE2 ? A GLU 40 OE2 56 1 Y 1 A GLU 41 ? CG ? A GLU 42 CG 57 1 Y 1 A GLU 41 ? CD ? A GLU 42 CD 58 1 Y 1 A GLU 41 ? OE1 ? A GLU 42 OE1 59 1 Y 1 A GLU 41 ? OE2 ? A GLU 42 OE2 60 1 Y 1 A LYS 44 ? CG ? A LYS 45 CG 61 1 Y 1 A LYS 44 ? CD ? A LYS 45 CD 62 1 Y 1 A LYS 44 ? CE ? A LYS 45 CE 63 1 Y 1 A LYS 44 ? NZ ? A LYS 45 NZ 64 1 Y 1 A ILE 47 ? CG1 ? A ILE 48 CG1 65 1 Y 1 A ILE 47 ? CG2 ? A ILE 48 CG2 66 1 Y 1 A ILE 47 ? CD1 ? A ILE 48 CD1 67 1 Y 1 A ASP 48 ? CG ? A ASP 49 CG 68 1 Y 1 A ASP 48 ? OD1 ? A ASP 49 OD1 69 1 Y 1 A ASP 48 ? OD2 ? A ASP 49 OD2 70 1 Y 1 A LEU 49 ? CD1 ? A LEU 50 CD1 71 1 Y 1 A LEU 49 ? CD2 ? A LEU 50 CD2 72 1 Y 1 A GLU 51 ? CG ? A GLU 52 CG 73 1 Y 1 A GLU 51 ? CD ? A GLU 52 CD 74 1 Y 1 A GLU 51 ? OE1 ? A GLU 52 OE1 75 1 Y 1 A GLU 51 ? OE2 ? A GLU 52 OE2 76 1 Y 1 A VAL 54 ? CG1 ? A VAL 55 CG1 77 1 Y 1 A VAL 54 ? CG2 ? A VAL 55 CG2 78 1 Y 1 A ARG 55 ? CD ? A ARG 56 CD 79 1 Y 1 A ARG 55 ? NE ? A ARG 56 NE 80 1 Y 1 A ARG 55 ? CZ ? A ARG 56 CZ 81 1 Y 1 A ARG 55 ? NH1 ? A ARG 56 NH1 82 1 Y 1 A ARG 55 ? NH2 ? A ARG 56 NH2 83 1 Y 1 A LYS 58 ? CG ? A LYS 59 CG 84 1 Y 1 A LYS 58 ? CD ? A LYS 59 CD 85 1 Y 1 A LYS 58 ? CE ? A LYS 59 CE 86 1 Y 1 A LYS 58 ? NZ ? A LYS 59 NZ 87 1 Y 1 A ILE 61 ? CG1 ? A ILE 62 CG1 88 1 Y 1 A ILE 61 ? CG2 ? A ILE 62 CG2 89 1 Y 1 A ILE 61 ? CD1 ? A ILE 62 CD1 90 1 Y 1 A LYS 62 ? CG ? A LYS 63 CG 91 1 Y 1 A LYS 62 ? CD ? A LYS 63 CD 92 1 Y 1 A LYS 62 ? CE ? A LYS 63 CE 93 1 Y 1 A LYS 62 ? NZ ? A LYS 63 NZ 94 1 Y 1 A ILE 63 ? CG1 ? A ILE 64 CG1 95 1 Y 1 A ILE 63 ? CG2 ? A ILE 64 CG2 96 1 Y 1 A ILE 63 ? CD1 ? A ILE 64 CD1 97 1 Y 1 A GLU 65 ? CG ? A GLU 66 CG 98 1 Y 1 A GLU 65 ? CD ? A GLU 66 CD 99 1 Y 1 A GLU 65 ? OE1 ? A GLU 66 OE1 100 1 Y 1 A GLU 65 ? OE2 ? A GLU 66 OE2 101 1 Y 1 A SER 67 ? OG ? A SER 68 OG 102 1 Y 1 A LYS 70 ? CG ? A LYS 71 CG 103 1 Y 1 A LYS 70 ? CD ? A LYS 71 CD 104 1 Y 1 A LYS 70 ? CE ? A LYS 71 CE 105 1 Y 1 A LYS 70 ? NZ ? A LYS 71 NZ 106 1 Y 1 A LYS 71 ? CD ? A LYS 72 CD 107 1 Y 1 A LYS 71 ? CE ? A LYS 72 CE 108 1 Y 1 A LYS 71 ? NZ ? A LYS 72 NZ 109 1 Y 1 A GLU 72 ? CG ? A GLU 73 CG 110 1 Y 1 A GLU 72 ? CD ? A GLU 73 CD 111 1 Y 1 A GLU 72 ? OE1 ? A GLU 73 OE1 112 1 Y 1 A GLU 72 ? OE2 ? A GLU 73 OE2 113 1 Y 1 A LYS 73 ? CG ? A LYS 74 CG 114 1 Y 1 A LYS 73 ? CD ? A LYS 74 CD 115 1 Y 1 A LYS 73 ? CE ? A LYS 74 CE 116 1 Y 1 A LYS 73 ? NZ ? A LYS 74 NZ 117 1 Y 1 A ARG 74 ? CG ? A ARG 75 CG 118 1 Y 1 A ARG 74 ? CD ? A ARG 75 CD 119 1 Y 1 A ARG 74 ? NE ? A ARG 75 NE 120 1 Y 1 A ARG 74 ? CZ ? A ARG 75 CZ 121 1 Y 1 A ARG 74 ? NH1 ? A ARG 75 NH1 122 1 Y 1 A ARG 74 ? NH2 ? A ARG 75 NH2 123 1 Y 1 A ASP 80 ? CG ? A ASP 81 CG 124 1 Y 1 A ASP 80 ? OD1 ? A ASP 81 OD1 125 1 Y 1 A ASP 80 ? OD2 ? A ASP 81 OD2 126 1 Y 1 A LYS 82 ? CG ? A LYS 83 CG 127 1 Y 1 A LYS 82 ? CD ? A LYS 83 CD 128 1 Y 1 A LYS 82 ? CE ? A LYS 83 CE 129 1 Y 1 A LYS 82 ? NZ ? A LYS 83 NZ 130 1 Y 1 A GLU 83 ? CD ? A GLU 84 CD 131 1 Y 1 A GLU 83 ? OE1 ? A GLU 84 OE1 132 1 Y 1 A GLU 83 ? OE2 ? A GLU 84 OE2 133 1 Y 1 A LEU 84 ? CG ? A LEU 85 CG 134 1 Y 1 A LEU 84 ? CD1 ? A LEU 85 CD1 135 1 Y 1 A LEU 84 ? CD2 ? A LEU 85 CD2 136 1 Y 1 A ASP 85 ? OD1 ? A ASP 86 OD1 137 1 Y 1 A ASP 85 ? OD2 ? A ASP 86 OD2 138 1 Y 1 A LYS 86 ? CD ? A LYS 87 CD 139 1 Y 1 A LYS 86 ? CE ? A LYS 87 CE 140 1 Y 1 A LYS 86 ? NZ ? A LYS 87 NZ 141 1 Y 1 A LEU 87 ? CG ? A LEU 88 CG 142 1 Y 1 A LEU 87 ? CD1 ? A LEU 88 CD1 143 1 Y 1 A LEU 87 ? CD2 ? A LEU 88 CD2 144 1 Y 1 A LEU 88 ? CG ? A LEU 89 CG 145 1 Y 1 A LEU 88 ? CD1 ? A LEU 89 CD1 146 1 Y 1 A LEU 88 ? CD2 ? A LEU 89 CD2 147 1 Y 1 A ASP 89 ? OD1 ? A ASP 90 OD1 148 1 Y 1 A ASP 89 ? OD2 ? A ASP 90 OD2 149 1 Y 1 A GLU 92 ? CG ? A GLU 93 CG 150 1 Y 1 A GLU 92 ? CD ? A GLU 93 CD 151 1 Y 1 A GLU 92 ? OE1 ? A GLU 93 OE1 152 1 Y 1 A GLU 92 ? OE2 ? A GLU 93 OE2 153 1 Y 1 A LYS 93 ? CG ? A LYS 94 CG 154 1 Y 1 A LYS 93 ? CD ? A LYS 94 CD 155 1 Y 1 A LYS 93 ? CE ? A LYS 94 CE 156 1 Y 1 A LYS 93 ? NZ ? A LYS 94 NZ 157 1 Y 1 A GLN 96 ? CD ? A GLN 97 CD 158 1 Y 1 A GLN 96 ? OE1 ? A GLN 97 OE1 159 1 Y 1 A GLN 96 ? NE2 ? A GLN 97 NE2 160 1 Y 1 A LYS 100 ? CG ? A LYS 101 CG 161 1 Y 1 A LYS 100 ? CD ? A LYS 101 CD 162 1 Y 1 A LYS 100 ? CE ? A LYS 101 CE 163 1 Y 1 A LYS 100 ? NZ ? A LYS 101 NZ 164 1 Y 1 A ASP 104 ? OD1 ? A ASP 105 OD1 165 1 Y 1 A ASP 104 ? OD2 ? A ASP 105 OD2 166 1 Y 1 A ASN 106 ? OD1 ? A ASN 107 OD1 167 1 Y 1 A ASN 106 ? ND2 ? A ASN 107 ND2 168 1 Y 1 A LYS 107 ? CE ? A LYS 108 CE 169 1 Y 1 A LYS 107 ? NZ ? A LYS 108 NZ 170 1 Y 1 A GLU 110 ? CD ? A GLU 111 CD 171 1 Y 1 A GLU 110 ? OE1 ? A GLU 111 OE1 172 1 Y 1 A GLU 110 ? OE2 ? A GLU 111 OE2 173 1 Y 1 A ARG 113 ? CD ? A ARG 114 CD 174 1 Y 1 A ARG 113 ? NE ? A ARG 114 NE 175 1 Y 1 A ARG 113 ? CZ ? A ARG 114 CZ 176 1 Y 1 A ARG 113 ? NH1 ? A ARG 114 NH1 177 1 Y 1 A ARG 113 ? NH2 ? A ARG 114 NH2 178 1 Y 1 A ARG 114 ? NE ? A ARG 115 NE 179 1 Y 1 A ARG 114 ? CZ ? A ARG 115 CZ 180 1 Y 1 A ARG 114 ? NH1 ? A ARG 115 NH1 181 1 Y 1 A ARG 114 ? NH2 ? A ARG 115 NH2 182 1 Y 1 B LYS 118 ? CD ? B LYS 5 CD 183 1 Y 1 B LYS 118 ? CE ? B LYS 5 CE 184 1 Y 1 B LYS 118 ? NZ ? B LYS 5 NZ 185 1 Y 1 B GLU 121 ? CD ? B GLU 8 CD 186 1 Y 1 B GLU 121 ? OE1 ? B GLU 8 OE1 187 1 Y 1 B GLU 121 ? OE2 ? B GLU 8 OE2 188 1 Y 1 B GLU 125 ? CD ? B GLU 12 CD 189 1 Y 1 B GLU 125 ? OE1 ? B GLU 12 OE1 190 1 Y 1 B GLU 125 ? OE2 ? B GLU 12 OE2 191 1 Y 1 B LYS 128 ? CD ? B LYS 15 CD 192 1 Y 1 B LYS 128 ? CE ? B LYS 15 CE 193 1 Y 1 B LYS 128 ? NZ ? B LYS 15 NZ 194 1 Y 1 B ARG 129 ? CD ? B ARG 16 CD 195 1 Y 1 B ARG 129 ? NE ? B ARG 16 NE 196 1 Y 1 B ARG 129 ? CZ ? B ARG 16 CZ 197 1 Y 1 B ARG 129 ? NH1 ? B ARG 16 NH1 198 1 Y 1 B ARG 129 ? NH2 ? B ARG 16 NH2 199 1 Y 1 B GLU 131 ? CD ? B GLU 18 CD 200 1 Y 1 B GLU 131 ? OE1 ? B GLU 18 OE1 201 1 Y 1 B GLU 131 ? OE2 ? B GLU 18 OE2 202 1 Y 1 B LYS 132 ? CD ? B LYS 19 CD 203 1 Y 1 B LYS 132 ? CE ? B LYS 19 CE 204 1 Y 1 B LYS 132 ? NZ ? B LYS 19 NZ 205 1 Y 1 B LYS 135 ? CG ? B LYS 22 CG 206 1 Y 1 B LYS 135 ? CD ? B LYS 22 CD 207 1 Y 1 B LYS 135 ? CE ? B LYS 22 CE 208 1 Y 1 B LYS 135 ? NZ ? B LYS 22 NZ 209 1 Y 1 B GLU 136 ? CD ? B GLU 23 CD 210 1 Y 1 B GLU 136 ? OE1 ? B GLU 23 OE1 211 1 Y 1 B GLU 136 ? OE2 ? B GLU 23 OE2 212 1 Y 1 B GLU 139 ? CD ? B GLU 26 CD 213 1 Y 1 B GLU 139 ? OE1 ? B GLU 26 OE1 214 1 Y 1 B GLU 139 ? OE2 ? B GLU 26 OE2 215 1 Y 1 B LYS 142 ? CD ? B LYS 29 CD 216 1 Y 1 B LYS 142 ? CE ? B LYS 29 CE 217 1 Y 1 B LYS 142 ? NZ ? B LYS 29 NZ 218 1 Y 1 B LYS 146 ? CG ? B LYS 33 CG 219 1 Y 1 B LYS 146 ? CD ? B LYS 33 CD 220 1 Y 1 B LYS 146 ? CE ? B LYS 33 CE 221 1 Y 1 B LYS 146 ? NZ ? B LYS 33 NZ 222 1 Y 1 B LYS 147 ? CG ? B LYS 34 CG 223 1 Y 1 B LYS 147 ? CD ? B LYS 34 CD 224 1 Y 1 B LYS 147 ? CE ? B LYS 34 CE 225 1 Y 1 B LYS 147 ? NZ ? B LYS 34 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3112 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'June 17, 2015' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'June 17, 2015' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6. 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6DLC _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.885 _cell.length_a_esd ? _cell.length_b 96.885 _cell.length_b_esd ? _cell.length_c 27.846 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DLC _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DLC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.7 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15M Potassium bromide, 30% (w/v) PEG 2,000 MME, plus 20% glycerol as cryoprotectant' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-12-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double-crystal Si(111) and multilayer' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999954 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999954 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 109.04 _reflns.entry_id 6DLC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.26 _reflns.d_resolution_low 48.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2485 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.6 _reflns.pdbx_Rmerge_I_obs 0.125 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.135 _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.26 _reflns_shell.d_res_low 3.52 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 512 _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.343 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.440 _reflns_shell.pdbx_Rpim_I_all 0.708 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.472 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 117.01 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DLC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.261 _refine.ls_d_res_low 48.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2482 _refine.ls_number_reflns_R_free 252 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 10.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2614 _refine.ls_R_factor_R_free 0.2855 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2583 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational Design Model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.34 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.45 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 932 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 932 _refine_hist.d_res_high 3.261 _refine_hist.d_res_low 48.44 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 941 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.638 ? 1286 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.952 ? 575 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 169 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 164 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2609 4.1080 . . 118 1105 100.00 . . . 0.3422 . 0.2996 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1080 48.4478 . . 134 1125 100.00 . . . 0.2699 . 0.2443 . . . . . . . . . . # _struct.entry_id 6DLC _struct.title 'Designed protein DHD1:234_A, Designed protein DHD1:234_B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DLC _struct_keywords.text 'Computational Design, Heterodimer, Coiled-coil, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6DLC 6DLC ? 1 ? 1 2 PDB 6DLC 6DLC ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6DLC A 1 ? 115 ? 6DLC 0 ? 114 ? 0 114 2 2 6DLC B 1 ? 36 ? 6DLC 114 ? 149 ? 114 149 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5670 ? 1 MORE -68 ? 1 'SSA (A^2)' 15030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'mass spectrometry' 'Native mass spectrometry confirmed molecular weight of the heterodimer in solution' 2 1 'gel filtration' 'Heterodimer was monodisperse and eluted at the expected volume' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 96.8850000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 7 ? ASN A 38 ? LEU A 6 ASN A 37 1 ? 32 HELX_P HELX_P2 AA2 ASP A 41 ? LYS A 74 ? ASP A 40 LYS A 73 1 ? 34 HELX_P HELX_P3 AA3 ASP A 82 ? ARG A 115 ? ASP A 81 ARG A 114 1 ? 34 HELX_P HELX_P4 AA4 ASP B 3 ? LYS B 34 ? ASP B 116 LYS B 147 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 66 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 69 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ASP 1 ? A ASP 2 3 1 Y 1 A SER 2 ? A SER 3 4 1 Y 1 A ASP 3 ? A ASP 4 5 1 Y 1 A GLU 4 ? A GLU 5 6 1 Y 1 A HIS 5 ? A HIS 6 7 1 Y 1 A ILE 76 ? A ILE 77 8 1 Y 1 A ASP 77 ? A ASP 78 9 1 Y 1 A LYS 78 ? A LYS 79 10 1 Y 1 A ARG 79 ? A ARG 80 11 1 Y 1 B HIS 114 ? B HIS 1 12 1 Y 1 B VAL 148 ? B VAL 35 13 1 Y 1 B GLU 149 ? B GLU 36 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Computational Design Model' # _atom_sites.entry_id 6DLC _atom_sites.fract_transf_matrix[1][1] 0.010322 _atom_sites.fract_transf_matrix[1][2] 0.005959 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011918 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.035912 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #