data_6DO6 # _entry.id 6DO6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DO6 pdb_00006do6 10.2210/pdb6do6/pdb WWPDB D_1000234245 ? ? BMRB 30477 ? 10.13018/BMR30477 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-26 2 'Structure model' 1 1 2019-01-09 3 'Structure model' 1 2 2019-03-20 4 'Structure model' 1 3 2020-01-01 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' pdbx_audit_support 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.year' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_pdbx_audit_support.funding_organization' 16 4 'Structure model' '_pdbx_nmr_software.name' 17 4 'Structure model' '_pdbx_nmr_spectrometer.model' 18 5 'Structure model' '_database_2.pdbx_DOI' 19 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6DO6 _pdbx_database_status.recvd_initial_deposition_date 2018-06-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of wild type apo hFABP1 at 308 K' _pdbx_database_related.db_id 30477 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Scanlon, M.J.' 1 ? 'Mohanty, B.' 2 ? 'Doak, B.C.' 3 ? 'Patil, R.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 294 _citation.language ? _citation.page_first 3720 _citation.page_last 3734 _citation.title ;A ligand-induced structural change in fatty acid-binding protein 1 is associated with potentiation of peroxisome proliferator-activated receptor alpha agonists. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.006848 _citation.pdbx_database_id_PubMed 30598509 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Patil, R.' 1 ? primary 'Mohanty, B.' 2 0000-0002-6921-343X primary 'Liu, B.' 3 ? primary 'Chandrashekaran, I.R.' 4 ? primary 'Headey, S.J.' 5 ? primary 'Williams, M.L.' 6 ? primary 'Clements, C.S.' 7 ? primary 'Ilyichova, O.' 8 ? primary 'Doak, B.C.' 9 ? primary 'Genissel, P.' 10 ? primary 'Weaver, R.J.' 11 ? primary 'Vuillard, L.' 12 ? primary 'Halls, M.L.' 13 ? primary 'Porter, C.J.H.' 14 0000-0003-3474-7551 primary 'Scanlon, M.J.' 15 0000-0002-9230-7506 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Fatty acid-binding protein, liver' _entity.formula_weight 15225.457 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Fatty acid-binding protein 1,Liver-type fatty acid-binding protein,L-FABP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELE TMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHVAMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELE TMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 VAL n 1 8 ALA n 1 9 MET n 1 10 SER n 1 11 PHE n 1 12 SER n 1 13 GLY n 1 14 LYS n 1 15 TYR n 1 16 GLN n 1 17 LEU n 1 18 GLN n 1 19 SER n 1 20 GLN n 1 21 GLU n 1 22 ASN n 1 23 PHE n 1 24 GLU n 1 25 ALA n 1 26 PHE n 1 27 MET n 1 28 LYS n 1 29 ALA n 1 30 ILE n 1 31 GLY n 1 32 LEU n 1 33 PRO n 1 34 GLU n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 GLN n 1 39 LYS n 1 40 GLY n 1 41 LYS n 1 42 ASP n 1 43 ILE n 1 44 LYS n 1 45 GLY n 1 46 VAL n 1 47 SER n 1 48 GLU n 1 49 ILE n 1 50 VAL n 1 51 GLN n 1 52 ASN n 1 53 GLY n 1 54 LYS n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 PHE n 1 59 THR n 1 60 ILE n 1 61 THR n 1 62 ALA n 1 63 GLY n 1 64 SER n 1 65 LYS n 1 66 VAL n 1 67 ILE n 1 68 GLN n 1 69 ASN n 1 70 GLU n 1 71 PHE n 1 72 THR n 1 73 VAL n 1 74 GLY n 1 75 GLU n 1 76 GLU n 1 77 CYS n 1 78 GLU n 1 79 LEU n 1 80 GLU n 1 81 THR n 1 82 MET n 1 83 THR n 1 84 GLY n 1 85 GLU n 1 86 LYS n 1 87 VAL n 1 88 LYS n 1 89 THR n 1 90 VAL n 1 91 VAL n 1 92 GLN n 1 93 LEU n 1 94 GLU n 1 95 GLY n 1 96 ASP n 1 97 ASN n 1 98 LYS n 1 99 LEU n 1 100 VAL n 1 101 THR n 1 102 THR n 1 103 PHE n 1 104 LYS n 1 105 ASN n 1 106 ILE n 1 107 LYS n 1 108 SER n 1 109 VAL n 1 110 THR n 1 111 GLU n 1 112 LEU n 1 113 ASN n 1 114 GLY n 1 115 ASP n 1 116 ILE n 1 117 ILE n 1 118 THR n 1 119 ASN n 1 120 THR n 1 121 MET n 1 122 THR n 1 123 LEU n 1 124 GLY n 1 125 ASP n 1 126 ILE n 1 127 VAL n 1 128 PHE n 1 129 LYS n 1 130 ARG n 1 131 ILE n 1 132 SER n 1 133 LYS n 1 134 ARG n 1 135 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 135 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FABP1, FABPL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET-45b(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -7 -7 HIS HIS A . n A 1 2 HIS 2 -6 -6 HIS HIS A . n A 1 3 HIS 3 -5 -5 HIS HIS A . n A 1 4 HIS 4 -4 -4 HIS HIS A . n A 1 5 HIS 5 -3 -3 HIS HIS A . n A 1 6 HIS 6 -2 -2 HIS HIS A . n A 1 7 VAL 7 -1 -1 VAL VAL A . n A 1 8 ALA 8 0 0 ALA ALA A . n A 1 9 MET 9 1 1 MET MET A . n A 1 10 SER 10 2 2 SER SER A . n A 1 11 PHE 11 3 3 PHE PHE A . n A 1 12 SER 12 4 4 SER SER A . n A 1 13 GLY 13 5 5 GLY GLY A . n A 1 14 LYS 14 6 6 LYS LYS A . n A 1 15 TYR 15 7 7 TYR TYR A . n A 1 16 GLN 16 8 8 GLN GLN A . n A 1 17 LEU 17 9 9 LEU LEU A . n A 1 18 GLN 18 10 10 GLN GLN A . n A 1 19 SER 19 11 11 SER SER A . n A 1 20 GLN 20 12 12 GLN GLN A . n A 1 21 GLU 21 13 13 GLU GLU A . n A 1 22 ASN 22 14 14 ASN ASN A . n A 1 23 PHE 23 15 15 PHE PHE A . n A 1 24 GLU 24 16 16 GLU GLU A . n A 1 25 ALA 25 17 17 ALA ALA A . n A 1 26 PHE 26 18 18 PHE PHE A . n A 1 27 MET 27 19 19 MET MET A . n A 1 28 LYS 28 20 20 LYS LYS A . n A 1 29 ALA 29 21 21 ALA ALA A . n A 1 30 ILE 30 22 22 ILE ILE A . n A 1 31 GLY 31 23 23 GLY GLY A . n A 1 32 LEU 32 24 24 LEU LEU A . n A 1 33 PRO 33 25 25 PRO PRO A . n A 1 34 GLU 34 26 26 GLU GLU A . n A 1 35 GLU 35 27 27 GLU GLU A . n A 1 36 LEU 36 28 28 LEU LEU A . n A 1 37 ILE 37 29 29 ILE ILE A . n A 1 38 GLN 38 30 30 GLN GLN A . n A 1 39 LYS 39 31 31 LYS LYS A . n A 1 40 GLY 40 32 32 GLY GLY A . n A 1 41 LYS 41 33 33 LYS LYS A . n A 1 42 ASP 42 34 34 ASP ASP A . n A 1 43 ILE 43 35 35 ILE ILE A . n A 1 44 LYS 44 36 36 LYS LYS A . n A 1 45 GLY 45 37 37 GLY GLY A . n A 1 46 VAL 46 38 38 VAL VAL A . n A 1 47 SER 47 39 39 SER SER A . n A 1 48 GLU 48 40 40 GLU GLU A . n A 1 49 ILE 49 41 41 ILE ILE A . n A 1 50 VAL 50 42 42 VAL VAL A . n A 1 51 GLN 51 43 43 GLN GLN A . n A 1 52 ASN 52 44 44 ASN ASN A . n A 1 53 GLY 53 45 45 GLY GLY A . n A 1 54 LYS 54 46 46 LYS LYS A . n A 1 55 HIS 55 47 47 HIS HIS A . n A 1 56 PHE 56 48 48 PHE PHE A . n A 1 57 LYS 57 49 49 LYS LYS A . n A 1 58 PHE 58 50 50 PHE PHE A . n A 1 59 THR 59 51 51 THR THR A . n A 1 60 ILE 60 52 52 ILE ILE A . n A 1 61 THR 61 53 53 THR THR A . n A 1 62 ALA 62 54 54 ALA ALA A . n A 1 63 GLY 63 55 55 GLY GLY A . n A 1 64 SER 64 56 56 SER SER A . n A 1 65 LYS 65 57 57 LYS LYS A . n A 1 66 VAL 66 58 58 VAL VAL A . n A 1 67 ILE 67 59 59 ILE ILE A . n A 1 68 GLN 68 60 60 GLN GLN A . n A 1 69 ASN 69 61 61 ASN ASN A . n A 1 70 GLU 70 62 62 GLU GLU A . n A 1 71 PHE 71 63 63 PHE PHE A . n A 1 72 THR 72 64 64 THR THR A . n A 1 73 VAL 73 65 65 VAL VAL A . n A 1 74 GLY 74 66 66 GLY GLY A . n A 1 75 GLU 75 67 67 GLU GLU A . n A 1 76 GLU 76 68 68 GLU GLU A . n A 1 77 CYS 77 69 69 CYS CYS A . n A 1 78 GLU 78 70 70 GLU GLU A . n A 1 79 LEU 79 71 71 LEU LEU A . n A 1 80 GLU 80 72 72 GLU GLU A . n A 1 81 THR 81 73 73 THR THR A . n A 1 82 MET 82 74 74 MET MET A . n A 1 83 THR 83 75 75 THR THR A . n A 1 84 GLY 84 76 76 GLY GLY A . n A 1 85 GLU 85 77 77 GLU GLU A . n A 1 86 LYS 86 78 78 LYS LYS A . n A 1 87 VAL 87 79 79 VAL VAL A . n A 1 88 LYS 88 80 80 LYS LYS A . n A 1 89 THR 89 81 81 THR THR A . n A 1 90 VAL 90 82 82 VAL VAL A . n A 1 91 VAL 91 83 83 VAL VAL A . n A 1 92 GLN 92 84 84 GLN GLN A . n A 1 93 LEU 93 85 85 LEU LEU A . n A 1 94 GLU 94 86 86 GLU GLU A . n A 1 95 GLY 95 87 87 GLY GLY A . n A 1 96 ASP 96 88 88 ASP ASP A . n A 1 97 ASN 97 89 89 ASN ASN A . n A 1 98 LYS 98 90 90 LYS LYS A . n A 1 99 LEU 99 91 91 LEU LEU A . n A 1 100 VAL 100 92 92 VAL VAL A . n A 1 101 THR 101 93 93 THR THR A . n A 1 102 THR 102 94 94 THR THR A . n A 1 103 PHE 103 95 95 PHE PHE A . n A 1 104 LYS 104 96 96 LYS LYS A . n A 1 105 ASN 105 97 97 ASN ASN A . n A 1 106 ILE 106 98 98 ILE ILE A . n A 1 107 LYS 107 99 99 LYS LYS A . n A 1 108 SER 108 100 100 SER SER A . n A 1 109 VAL 109 101 101 VAL VAL A . n A 1 110 THR 110 102 102 THR THR A . n A 1 111 GLU 111 103 103 GLU GLU A . n A 1 112 LEU 112 104 104 LEU LEU A . n A 1 113 ASN 113 105 105 ASN ASN A . n A 1 114 GLY 114 106 106 GLY GLY A . n A 1 115 ASP 115 107 107 ASP ASP A . n A 1 116 ILE 116 108 108 ILE ILE A . n A 1 117 ILE 117 109 109 ILE ILE A . n A 1 118 THR 118 110 110 THR THR A . n A 1 119 ASN 119 111 111 ASN ASN A . n A 1 120 THR 120 112 112 THR THR A . n A 1 121 MET 121 113 113 MET MET A . n A 1 122 THR 122 114 114 THR THR A . n A 1 123 LEU 123 115 115 LEU LEU A . n A 1 124 GLY 124 116 116 GLY GLY A . n A 1 125 ASP 125 117 117 ASP ASP A . n A 1 126 ILE 126 118 118 ILE ILE A . n A 1 127 VAL 127 119 119 VAL VAL A . n A 1 128 PHE 128 120 120 PHE PHE A . n A 1 129 LYS 129 121 121 LYS LYS A . n A 1 130 ARG 130 122 122 ARG ARG A . n A 1 131 ILE 131 123 123 ILE ILE A . n A 1 132 SER 132 124 124 SER SER A . n A 1 133 LYS 133 125 125 LYS LYS A . n A 1 134 ARG 134 126 126 ARG ARG A . n A 1 135 ILE 135 127 127 ILE ILE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DO6 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6DO6 _struct.title 'NMR solution structure of wild type apo hFABP1 at 308 K' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DO6 _struct_keywords.text 'LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FABPL_HUMAN _struct_ref.pdbx_db_accession P07148 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVK TVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6DO6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07148 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6DO6 HIS A 1 ? UNP P07148 ? ? 'expression tag' -7 1 1 6DO6 HIS A 2 ? UNP P07148 ? ? 'expression tag' -6 2 1 6DO6 HIS A 3 ? UNP P07148 ? ? 'expression tag' -5 3 1 6DO6 HIS A 4 ? UNP P07148 ? ? 'expression tag' -4 4 1 6DO6 HIS A 5 ? UNP P07148 ? ? 'expression tag' -3 5 1 6DO6 HIS A 6 ? UNP P07148 ? ? 'expression tag' -2 6 1 6DO6 VAL A 7 ? UNP P07148 ? ? 'expression tag' -1 7 1 6DO6 ALA A 8 ? UNP P07148 ? ? 'expression tag' 0 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8000 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'The protein is a monomer.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 22 ? ILE A 30 ? ASN A 14 ILE A 22 1 ? 9 HELX_P HELX_P2 AA2 PRO A 33 ? LYS A 41 ? PRO A 25 LYS A 33 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 66 ? THR A 72 ? VAL A 58 THR A 64 AA1 2 HIS A 55 ? THR A 61 ? HIS A 47 THR A 53 AA1 3 VAL A 46 ? ASN A 52 ? VAL A 38 ASN A 44 AA1 4 GLY A 13 ? GLU A 21 ? GLY A 5 GLU A 13 AA1 5 ILE A 126 ? ARG A 134 ? ILE A 118 ARG A 126 AA1 6 ILE A 116 ? LEU A 123 ? ILE A 108 LEU A 115 AA1 7 ILE A 106 ? ASN A 113 ? ILE A 98 ASN A 105 AA1 8 LYS A 98 ? PHE A 103 ? LYS A 90 PHE A 95 AA1 9 GLN A 92 ? LEU A 93 ? GLN A 84 LEU A 85 AA2 1 GLU A 76 ? GLU A 80 ? GLU A 68 GLU A 72 AA2 2 LYS A 86 ? VAL A 90 ? LYS A 78 VAL A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 71 ? O PHE A 63 N PHE A 56 ? N PHE A 48 AA1 2 3 O THR A 61 ? O THR A 53 N VAL A 46 ? N VAL A 38 AA1 3 4 O SER A 47 ? O SER A 39 N TYR A 15 ? N TYR A 7 AA1 4 5 N GLN A 18 ? N GLN A 10 O ILE A 131 ? O ILE A 123 AA1 5 6 O SER A 132 ? O SER A 124 N ILE A 117 ? N ILE A 109 AA1 6 7 O THR A 118 ? O THR A 110 N GLU A 111 ? N GLU A 103 AA1 7 8 O SER A 108 ? O SER A 100 N THR A 101 ? N THR A 93 AA1 8 9 O VAL A 100 ? O VAL A 92 N GLN A 92 ? N GLN A 84 AA2 1 2 N LEU A 79 ? N LEU A 71 O VAL A 87 ? O VAL A 79 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -6 ? ? 57.59 -158.98 2 1 HIS A -3 ? ? 60.38 87.67 3 2 HIS A -5 ? ? 66.45 172.63 4 2 HIS A -4 ? ? 65.58 -172.26 5 2 HIS A -2 ? ? -145.04 49.59 6 2 ALA A 0 ? ? 60.34 -162.34 7 2 MET A 1 ? ? -96.01 45.81 8 2 LYS A 36 ? ? -61.16 98.22 9 2 THR A 81 ? ? -171.49 147.65 10 2 ASN A 97 ? ? 73.17 -3.14 11 3 HIS A -5 ? ? 67.07 -178.58 12 3 ALA A 54 ? ? -170.05 137.04 13 4 HIS A -6 ? ? -157.75 -43.83 14 4 HIS A -5 ? ? 62.96 -169.23 15 4 HIS A -4 ? ? -146.49 59.40 16 4 HIS A -2 ? ? 70.87 104.90 17 4 MET A 1 ? ? -70.77 43.58 18 4 ASN A 44 ? ? -119.64 68.55 19 4 ALA A 54 ? ? -127.05 -163.65 20 4 SER A 56 ? ? -163.12 22.70 21 5 HIS A -5 ? ? -153.35 -74.10 22 5 HIS A -4 ? ? 64.77 70.21 23 5 HIS A -3 ? ? -134.95 -73.53 24 5 MET A 1 ? ? -72.88 30.82 25 5 ASN A 97 ? ? 72.99 -2.41 26 6 ASN A 44 ? ? -103.39 73.81 27 6 ALA A 54 ? ? -173.53 137.88 28 6 SER A 56 ? ? 75.67 -34.91 29 7 HIS A -4 ? ? -143.28 -32.56 30 7 SER A 56 ? ? 77.01 -26.77 31 7 ASP A 88 ? ? -76.47 24.56 32 7 ASN A 97 ? ? 71.80 -7.16 33 8 HIS A -5 ? ? 61.65 -89.65 34 8 MET A 1 ? ? -79.77 46.49 35 8 ASN A 44 ? ? -110.67 70.81 36 8 ASN A 97 ? ? 71.91 -2.20 37 8 ASN A 105 ? ? -154.48 68.89 38 9 HIS A -6 ? ? 62.36 -151.98 39 9 HIS A -5 ? ? 37.93 85.51 40 9 HIS A -4 ? ? 52.23 -146.35 41 9 LYS A 36 ? ? -61.78 99.89 42 9 SER A 56 ? ? -163.91 24.74 43 9 ASP A 88 ? ? -118.42 51.85 44 9 ASN A 97 ? ? 73.75 -3.57 45 10 HIS A -6 ? ? 50.26 16.22 46 10 HIS A -5 ? ? 66.57 153.51 47 10 HIS A -3 ? ? -175.23 -45.96 48 10 MET A 1 ? ? -153.66 33.08 49 10 THR A 81 ? ? -170.73 142.56 50 10 ASN A 97 ? ? 67.10 -9.07 # _pdbx_nmr_ensemble.entry_id 6DO6 _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6DO6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1 mM [U-13C; U-15N] Human liver fatty acid binding protein (hFABP1), 20 mM sodium phosphate, 50 mM sodium chloride, pH 5.5 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1 mM 15N13C labelled apo hFABP1, 20 mM Sodium Phosphate, 50 mM NaCl, pH 5.5' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'Human liver fatty acid binding protein (hFABP1)' 1 ? mM '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM Sodium Phosphate, 50 mM NaCl' _pdbx_nmr_exptl_sample_conditions.details '1 mM 15N13C labelled apo hFABP1, 20 mM Sodium Phosphate, 50 mM NaCl, pH 5.5' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D 15N-edited [1H,1H]-NOESY' 2 isotropic 7 1 1 '3D 13Cali-edited [1H,1H]-NOESY' 2 isotropic 9 1 1 '3D 13Caro-edited [1H,1H]-NOESY' 2 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 6DO6 'molecular dynamics' ;the structures are based on a total of 3098 NOE-derived restraints, 208 dihedral angle restraints, 60 distance restraints from hydrogen bonds ; 5 6DO6 'Constrained energy minimization' ? 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 'structure calculation' UNIO10-ATNOS/CANID 2.0.2 'Dr. Torsten Herrmann' 7 refinement OPALp ? 'Koradi et al, 2000' 8 refinement Prime ? 'Prime, Schrodinger, LLC, New York, NY, 2018' 9 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Australian Research Council (ARC)' Australia DP120102930 1 'Australian Research Council (ARC)' Australia DP150102587 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _atom_sites.entry_id 6DO6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_