data_6DQ5 # _entry.id 6DQ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DQ5 pdb_00006dq5 10.2210/pdb6dq5/pdb WWPDB D_1000234861 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DQ5 _pdbx_database_status.recvd_initial_deposition_date 2018-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Horton, J.R.' 1 ? 'Cheng, X.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 61 ? 10588 10601 'Structure-Based Engineering of Irreversible Inhibitors against Histone Lysine Demethylase KDM5A.' 2018 ? 10.1021/acs.jmedchem.8b01219 30392349 ? ? ? ? ? ? ? ? US ? ? 1 'Cell Chem Biol' ? ? 2451-9456 ? ? 23 ? 769 781 'Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.' 2016 ? 10.1016/j.chembiol.2016.06.006 27427228 ? ? ? ? ? ? ? ? US ? ? 2 'J. Biol. Chem.' JBCHA3 0071 1083-351X ? ? 291 ? 2631 2646 'Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.' 2016 ? 10.1074/jbc.M115.698449 26645689 ? ? ? ? ? ? ? ? US ? ? 3 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 61 ? 3193 3208 'Insights into the Action of Inhibitor Enantiomers against Histone Lysine Demethylase 5A.' 2018 ? 10.1021/acs.jmedchem.8b00261 29537847 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horton, J.R.' 1 ? primary 'Woodcock, C.B.' 2 ? primary 'Chen, Q.' 3 ? primary 'Liu, X.' 4 ? primary 'Zhang, X.' 5 ? primary 'Shanks, J.' 6 ? primary 'Rai, G.' 7 0000-0001-9763-9641 primary 'Mott, B.T.' 8 ? primary 'Jansen, D.J.' 9 ? primary 'Kales, S.C.' 10 ? primary 'Henderson, M.J.' 11 ? primary 'Cyr, M.' 12 ? primary 'Pohida, K.' 13 ? primary 'Hu, X.' 14 ? primary 'Shah, P.' 15 ? primary 'Xu, X.' 16 ? primary 'Jadhav, A.' 17 ? primary 'Maloney, D.J.' 18 ? primary 'Hall, M.D.' 19 0000-0002-5073-442X primary 'Simeonov, A.' 20 ? primary 'Fu, H.' 21 ? primary 'Vertino, P.M.' 22 ? primary 'Cheng, X.' 23 0000-0002-6967-6362 1 'Horton, J.R.' 24 ? 1 'Liu, X.' 25 ? 1 'Gale, M.' 26 ? 1 'Wu, L.' 27 ? 1 'Shanks, J.R.' 28 ? 1 'Zhang, X.' 29 ? 1 'Webber, P.J.' 30 ? 1 'Bell, J.S.' 31 ? 1 'Kales, S.C.' 32 ? 1 'Mott, B.T.' 33 ? 1 'Rai, G.' 34 ? 1 'Jansen, D.J.' 35 ? 1 'Henderson, M.J.' 36 ? 1 'Urban, D.J.' 37 ? 1 'Hall, M.D.' 38 ? 1 'Simeonov, A.' 39 ? 1 'Maloney, D.J.' 40 ? 1 'Johns, M.A.' 41 ? 1 'Fu, H.' 42 ? 1 'Jadhav, A.' 43 ? 1 'Vertino, P.M.' 44 ? 1 'Yan, Q.' 45 ? 1 'Cheng, X.' 46 ? 2 'Horton, J.R.' 47 ? 2 'Engstrom, A.' 48 ? 2 'Zoeller, E.L.' 49 ? 2 'Liu, X.' 50 ? 2 'Shanks, J.R.' 51 ? 2 'Zhang, X.' 52 ? 2 'Johns, M.A.' 53 ? 2 'Vertino, P.M.' 54 ? 2 'Fu, H.' 55 ? 2 'Cheng, X.' 56 ? 3 'Horton, J.R.' 57 ? 3 'Liu, X.' 58 ? 3 'Wu, L.' 59 ? 3 'Zhang, K.' 60 ? 3 'Shanks, J.' 61 ? 3 'Zhang, X.' 62 ? 3 'Rai, G.' 63 ? 3 'Mott, B.T.' 64 ? 3 'Jansen, D.J.' 65 ? 3 'Kales, S.C.' 66 ? 3 'Henderson, M.J.' 67 ? 3 'Pohida, K.' 68 ? 3 'Fang, Y.' 69 ? 3 'Hu, X.' 70 ? 3 'Jadhav, A.' 71 ? 3 'Maloney, D.J.' 72 ? 3 'Hall, M.D.' 73 ? 3 'Simeonov, A.' 74 ? 3 'Fu, H.' 75 ? 3 'Vertino, P.M.' 76 ? 3 'Yan, Q.' 77 ? 3 'Cheng, X.' 78 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 92.13 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6DQ5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 116.749 _cell.length_a_esd ? _cell.length_b 62.134 _cell.length_b_esd ? _cell.length_c 46.601 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DQ5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Linked KDM5A Jmj Domain' 37944.836 1 1.14.11.- ? ? ? 2 non-polymer syn 'N-[6-(4-acryloyl-1,4-diazepan-1-yl)-2-(pyridin-2-yl)pyrimidin-4-yl]-beta-alanine' 396.443 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 4 water nat water 18.015 102 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Histone demethylase JARID1A,Jumonji/ARID domain-containing protein 1A,Retinoblastoma-binding protein 2,RBBP-2,Histone demethylase JARID1A,Jumonji/ARID domain-containing protein 1A,Retinoblastoma-binding protein 2,RBBP-2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HNMAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLN ELEAMTRVRPREAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDF GSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWG EPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGY NFAEAVNFCT ; _entity_poly.pdbx_seq_one_letter_code_can ;HNMAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLN ELEAMTRVRPREAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDF GSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWG EPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGY NFAEAVNFCT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 ASN n 1 3 MET n 1 4 ALA n 1 5 GLY n 1 6 VAL n 1 7 GLY n 1 8 PRO n 1 9 GLY n 1 10 GLY n 1 11 TYR n 1 12 ALA n 1 13 ALA n 1 14 GLU n 1 15 PHE n 1 16 VAL n 1 17 PRO n 1 18 PRO n 1 19 PRO n 1 20 GLU n 1 21 CYS n 1 22 PRO n 1 23 VAL n 1 24 PHE n 1 25 GLU n 1 26 PRO n 1 27 SER n 1 28 TRP n 1 29 GLU n 1 30 GLU n 1 31 PHE n 1 32 THR n 1 33 ASP n 1 34 PRO n 1 35 LEU n 1 36 SER n 1 37 PHE n 1 38 ILE n 1 39 GLY n 1 40 ARG n 1 41 ILE n 1 42 ARG n 1 43 PRO n 1 44 LEU n 1 45 ALA n 1 46 GLU n 1 47 LYS n 1 48 THR n 1 49 GLY n 1 50 ILE n 1 51 CYS n 1 52 LYS n 1 53 ILE n 1 54 ARG n 1 55 PRO n 1 56 PRO n 1 57 LYS n 1 58 ASP n 1 59 TRP n 1 60 GLN n 1 61 PRO n 1 62 PRO n 1 63 PHE n 1 64 ALA n 1 65 CYS n 1 66 GLU n 1 67 VAL n 1 68 LYS n 1 69 SER n 1 70 PHE n 1 71 ARG n 1 72 PHE n 1 73 THR n 1 74 PRO n 1 75 ARG n 1 76 VAL n 1 77 GLN n 1 78 ARG n 1 79 LEU n 1 80 ASN n 1 81 GLU n 1 82 LEU n 1 83 GLU n 1 84 ALA n 1 85 MET n 1 86 THR n 1 87 ARG n 1 88 VAL n 1 89 ARG n 1 90 PRO n 1 91 ARG n 1 92 GLU n 1 93 ALA n 1 94 PHE n 1 95 GLY n 1 96 PHE n 1 97 GLU n 1 98 GLN n 1 99 ALA n 1 100 VAL n 1 101 ARG n 1 102 GLU n 1 103 TYR n 1 104 THR n 1 105 LEU n 1 106 GLN n 1 107 SER n 1 108 PHE n 1 109 GLY n 1 110 GLU n 1 111 MET n 1 112 ALA n 1 113 ASP n 1 114 ASN n 1 115 PHE n 1 116 LYS n 1 117 SER n 1 118 ASP n 1 119 TYR n 1 120 PHE n 1 121 ASN n 1 122 MET n 1 123 PRO n 1 124 VAL n 1 125 HIS n 1 126 MET n 1 127 VAL n 1 128 PRO n 1 129 THR n 1 130 GLU n 1 131 LEU n 1 132 VAL n 1 133 GLU n 1 134 LYS n 1 135 GLU n 1 136 PHE n 1 137 TRP n 1 138 ARG n 1 139 LEU n 1 140 VAL n 1 141 SER n 1 142 SER n 1 143 ILE n 1 144 GLU n 1 145 GLU n 1 146 ASP n 1 147 VAL n 1 148 ILE n 1 149 VAL n 1 150 GLU n 1 151 TYR n 1 152 GLY n 1 153 ALA n 1 154 ASP n 1 155 ILE n 1 156 SER n 1 157 SER n 1 158 LYS n 1 159 ASP n 1 160 PHE n 1 161 GLY n 1 162 SER n 1 163 GLY n 1 164 PHE n 1 165 PRO n 1 166 VAL n 1 167 LYS n 1 168 ASP n 1 169 GLY n 1 170 ARG n 1 171 ARG n 1 172 LYS n 1 173 ILE n 1 174 LEU n 1 175 PRO n 1 176 GLU n 1 177 GLU n 1 178 GLU n 1 179 GLU n 1 180 TYR n 1 181 ALA n 1 182 LEU n 1 183 SER n 1 184 GLY n 1 185 TRP n 1 186 ASN n 1 187 LEU n 1 188 ASN n 1 189 ASN n 1 190 MET n 1 191 PRO n 1 192 VAL n 1 193 LEU n 1 194 GLU n 1 195 GLN n 1 196 SER n 1 197 VAL n 1 198 LEU n 1 199 ALA n 1 200 HIS n 1 201 ILE n 1 202 ASN n 1 203 VAL n 1 204 ASP n 1 205 ILE n 1 206 SER n 1 207 GLY n 1 208 MET n 1 209 LYS n 1 210 VAL n 1 211 PRO n 1 212 TRP n 1 213 LEU n 1 214 TYR n 1 215 VAL n 1 216 GLY n 1 217 MET n 1 218 CYS n 1 219 PHE n 1 220 SER n 1 221 SER n 1 222 PHE n 1 223 CYS n 1 224 TRP n 1 225 HIS n 1 226 ILE n 1 227 GLU n 1 228 ASP n 1 229 HIS n 1 230 TRP n 1 231 SER n 1 232 TYR n 1 233 SER n 1 234 ILE n 1 235 ASN n 1 236 TYR n 1 237 LEU n 1 238 HIS n 1 239 TRP n 1 240 GLY n 1 241 GLU n 1 242 PRO n 1 243 LYS n 1 244 THR n 1 245 TRP n 1 246 TYR n 1 247 GLY n 1 248 VAL n 1 249 PRO n 1 250 SER n 1 251 HIS n 1 252 ALA n 1 253 ALA n 1 254 GLU n 1 255 GLN n 1 256 LEU n 1 257 GLU n 1 258 GLU n 1 259 VAL n 1 260 MET n 1 261 ARG n 1 262 GLU n 1 263 LEU n 1 264 ALA n 1 265 PRO n 1 266 GLU n 1 267 LEU n 1 268 PHE n 1 269 GLU n 1 270 SER n 1 271 GLN n 1 272 PRO n 1 273 ASP n 1 274 LEU n 1 275 LEU n 1 276 HIS n 1 277 GLN n 1 278 LEU n 1 279 VAL n 1 280 THR n 1 281 ILE n 1 282 MET n 1 283 ASN n 1 284 PRO n 1 285 ASN n 1 286 VAL n 1 287 LEU n 1 288 MET n 1 289 GLU n 1 290 HIS n 1 291 GLY n 1 292 VAL n 1 293 PRO n 1 294 VAL n 1 295 TYR n 1 296 ARG n 1 297 THR n 1 298 ASN n 1 299 GLN n 1 300 CYS n 1 301 ALA n 1 302 GLY n 1 303 GLU n 1 304 PHE n 1 305 VAL n 1 306 VAL n 1 307 THR n 1 308 PHE n 1 309 PRO n 1 310 ARG n 1 311 ALA n 1 312 TYR n 1 313 HIS n 1 314 SER n 1 315 GLY n 1 316 PHE n 1 317 ASN n 1 318 GLN n 1 319 GLY n 1 320 TYR n 1 321 ASN n 1 322 PHE n 1 323 ALA n 1 324 GLU n 1 325 ALA n 1 326 VAL n 1 327 ASN n 1 328 PHE n 1 329 CYS n 1 330 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 89 Human ? 'KDM5A, JARID1A, RBBP2, RBP2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' 'GOLD C-PLUS' ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 90 330 Human ? 'KDM5A, JARID1A, RBBP2, RBP2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' 'GOLD C-PLUS' ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KDM5A_HUMAN P29375 ? 1 ;MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNEL EAMTRVR ; 1 2 UNP KDM5A_HUMAN P29375 ? 1 ;PREAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDG RRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVP SHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFC T ; 348 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6DQ5 A 3 ? 89 ? P29375 1 ? 87 ? 1 347 2 2 6DQ5 A 90 ? 330 ? P29375 348 ? 588 ? 348 588 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6DQ5 HIS A 1 ? UNP P29375 ? ? 'expression tag' -1 1 1 6DQ5 ASN A 2 ? UNP P29375 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H6G non-polymer . 'N-[6-(4-acryloyl-1,4-diazepan-1-yl)-2-(pyridin-2-yl)pyrimidin-4-yl]-beta-alanine' ? 'C20 H24 N6 O3' 396.443 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DQ5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2-1.35 M (NH4)2SO4, 0.1 M Tris-HCl (pH 8.6-9.2) 0-20% glycerol 25 mM (Na/K) dibasic/monobasic phosphate' _exptl_crystal_grow.pdbx_pH_range 8.6-9.2 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6DQ5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.89 _reflns.d_resolution_low 32.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26638 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.1 _reflns.pdbx_Rmerge_I_obs 0.163 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.89 _reflns_shell.d_res_low 1.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 2562 _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.885 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.428 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.673 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DQ5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.890 _refine.ls_d_res_low 32.965 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25667 _refine.ls_number_reflns_R_free 1268 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.74 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2284 _refine.ls_R_factor_R_free 0.2539 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2271 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5IVB _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.35 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 102 _refine_hist.number_atoms_total 2429 _refine_hist.d_res_high 1.890 _refine_hist.d_res_low 32.965 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2425 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.494 ? 3326 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.406 ? 1396 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 347 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 436 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8896 1.9652 . . 114 2159 77.00 . . . 0.3480 . 0.2966 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9652 2.0547 . . 130 2483 88.00 . . . 0.3065 . 0.2647 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0547 2.1630 . . 128 2728 96.00 . . . 0.3222 . 0.2612 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1630 2.2985 . . 144 2818 100.00 . . . 0.2815 . 0.2480 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2985 2.4759 . . 164 2809 100.00 . . . 0.2657 . 0.2448 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4759 2.7249 . . 134 2839 100.00 . . . 0.2985 . 0.2417 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7249 3.1190 . . 151 2837 100.00 . . . 0.2355 . 0.2258 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1190 3.9285 . . 146 2845 100.00 . . . 0.2510 . 0.2095 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9285 32.9699 . . 157 2881 100.00 . . . 0.2034 . 0.1983 . . . . . . . . . . # _struct.entry_id 6DQ5 _struct.title ;LINKED KDM5A JMJ DOMAIN BOUND TO THE INHIBITOR N43 i.e. 3-((6-(4-acryloyl-1,4-diazepan-1-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoic acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DQ5 _struct_keywords.text 'DEMETHYLASE INHIBITION, OXIDOREDUCTASE-INHIBITOR complex' _struct_keywords.pdbx_keywords OXIDOREDUCTASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 29 ? THR A 32 ? GLU A 27 THR A 30 5 ? 4 HELX_P HELX_P2 AA2 ASP A 33 ? GLU A 46 ? ASP A 31 GLU A 44 1 ? 14 HELX_P HELX_P3 AA3 LEU A 82 ? THR A 86 ? LEU A 80 THR A 84 5 ? 5 HELX_P HELX_P4 AA4 LEU A 105 ? ASN A 121 ? LEU A 363 ASN A 379 1 ? 17 HELX_P HELX_P5 AA5 PRO A 123 ? VAL A 127 ? PRO A 381 VAL A 385 5 ? 5 HELX_P HELX_P6 AA6 PRO A 128 ? SER A 141 ? PRO A 386 SER A 399 1 ? 14 HELX_P HELX_P7 AA7 SER A 157 ? GLY A 161 ? SER A 415 GLY A 419 1 ? 5 HELX_P HELX_P8 AA8 LEU A 174 ? GLU A 176 ? LEU A 432 GLU A 434 5 ? 3 HELX_P HELX_P9 AA9 GLU A 177 ? LEU A 182 ? GLU A 435 LEU A 440 1 ? 6 HELX_P HELX_P10 AB1 ASN A 186 ? MET A 190 ? ASN A 444 MET A 448 5 ? 5 HELX_P HELX_P11 AB2 SER A 196 ? ASN A 202 ? SER A 454 ASN A 460 1 ? 7 HELX_P HELX_P12 AB3 GLU A 227 ? SER A 231 ? GLU A 485 SER A 489 5 ? 5 HELX_P HELX_P13 AB4 PRO A 249 ? HIS A 251 ? PRO A 507 HIS A 509 5 ? 3 HELX_P HELX_P14 AB5 ALA A 252 ? ALA A 264 ? ALA A 510 ALA A 522 1 ? 13 HELX_P HELX_P15 AB6 PRO A 265 ? GLU A 269 ? PRO A 523 GLU A 527 5 ? 5 HELX_P HELX_P16 AB7 PRO A 272 ? GLN A 277 ? PRO A 530 GLN A 535 1 ? 6 HELX_P HELX_P17 AB8 LEU A 278 ? THR A 280 ? LEU A 536 THR A 538 5 ? 3 HELX_P HELX_P18 AB9 ASN A 283 ? HIS A 290 ? ASN A 541 HIS A 548 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 225 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 483 A MN 602 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc2 metalc ? ? A GLU 227 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 485 A MN 602 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc3 metalc ? ? B H6G . N28 ? ? ? 1_555 C MN . MN ? ? A H6G 601 A MN 602 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc4 metalc ? ? B H6G . N29 ? ? ? 1_555 C MN . MN ? ? A H6G 601 A MN 602 1_555 ? ? ? ? ? ? ? 2.285 ? ? metalc5 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 602 A HOH 725 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc6 metalc ? ? C MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 602 A HOH 734 1_555 ? ? ? ? ? ? ? 1.944 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 23 ? PHE A 24 ? VAL A 21 PHE A 22 AA1 2 ILE A 50 ? ILE A 53 ? ILE A 48 ILE A 51 AA1 3 PHE A 304 ? THR A 307 ? PHE A 562 THR A 565 AA1 4 TYR A 232 ? GLY A 240 ? TYR A 490 GLY A 498 AA1 5 ASN A 321 ? PHE A 328 ? ASN A 579 PHE A 586 AA1 6 TRP A 212 ? GLY A 216 ? TRP A 470 GLY A 474 AA1 7 ILE A 148 ? SER A 156 ? ILE A 406 SER A 414 AA1 8 ARG A 75 ? ARG A 78 ? ARG A 73 ARG A 76 AA2 1 ARG A 71 ? PHE A 72 ? ARG A 69 PHE A 70 AA2 2 TYR A 103 ? THR A 104 ? TYR A 361 THR A 362 AA3 1 SER A 221 ? HIS A 225 ? SER A 479 HIS A 483 AA3 2 HIS A 313 ? ASN A 317 ? HIS A 571 ASN A 575 AA3 3 LYS A 243 ? GLY A 247 ? LYS A 501 GLY A 505 AA3 4 TYR A 295 ? GLN A 299 ? TYR A 553 GLN A 557 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 24 ? N PHE A 22 O LYS A 52 ? O LYS A 50 AA1 2 3 N ILE A 53 ? N ILE A 51 O PHE A 304 ? O PHE A 562 AA1 3 4 O THR A 307 ? O THR A 565 N SER A 233 ? N SER A 491 AA1 4 5 N TYR A 236 ? N TYR A 494 O GLU A 324 ? O GLU A 582 AA1 5 6 O ALA A 325 ? O ALA A 583 N TRP A 212 ? N TRP A 470 AA1 6 7 O LEU A 213 ? O LEU A 471 N ILE A 155 ? N ILE A 413 AA1 7 8 O VAL A 149 ? O VAL A 407 N GLN A 77 ? N GLN A 75 AA2 1 2 N PHE A 72 ? N PHE A 70 O TYR A 103 ? O TYR A 361 AA3 1 2 N PHE A 222 ? N PHE A 480 O GLY A 315 ? O GLY A 573 AA3 2 3 O PHE A 316 ? O PHE A 574 N THR A 244 ? N THR A 502 AA3 3 4 N GLY A 247 ? N GLY A 505 O TYR A 295 ? O TYR A 553 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A H6G 601 ? 15 'binding site for residue H6G A 601' AC2 Software A MN 602 ? 5 'binding site for residue MN A 602' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 ARG A 75 ? ARG A 73 . ? 1_555 ? 2 AC1 15 TYR A 151 ? TYR A 409 . ? 1_555 ? 3 AC1 15 ALA A 153 ? ALA A 411 . ? 1_555 ? 4 AC1 15 ASP A 154 ? ASP A 412 . ? 1_555 ? 5 AC1 15 TYR A 214 ? TYR A 472 . ? 1_555 ? 6 AC1 15 SER A 221 ? SER A 479 . ? 1_555 ? 7 AC1 15 PHE A 222 ? PHE A 480 . ? 1_555 ? 8 AC1 15 CYS A 223 ? CYS A 481 . ? 1_555 ? 9 AC1 15 HIS A 225 ? HIS A 483 . ? 1_555 ? 10 AC1 15 GLU A 227 ? GLU A 485 . ? 1_555 ? 11 AC1 15 ASN A 235 ? ASN A 493 . ? 1_555 ? 12 AC1 15 LYS A 243 ? LYS A 501 . ? 1_555 ? 13 AC1 15 MN C . ? MN A 602 . ? 1_555 ? 14 AC1 15 HOH D . ? HOH A 725 . ? 1_555 ? 15 AC1 15 HOH D . ? HOH A 734 . ? 1_555 ? 16 AC2 5 HIS A 225 ? HIS A 483 . ? 1_555 ? 17 AC2 5 GLU A 227 ? GLU A 485 . ? 1_555 ? 18 AC2 5 H6G B . ? H6G A 601 . ? 1_555 ? 19 AC2 5 HOH D . ? HOH A 725 . ? 1_555 ? 20 AC2 5 HOH D . ? HOH A 734 . ? 1_555 ? # _atom_sites.entry_id 6DQ5 _atom_sites.fract_transf_matrix[1][1] 0.008565 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000319 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016094 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021474 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -1 ? ? ? A . n A 1 2 ASN 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ALA 4 2 ? ? ? A . n A 1 5 GLY 5 3 ? ? ? A . n A 1 6 VAL 6 4 ? ? ? A . n A 1 7 GLY 7 5 ? ? ? A . n A 1 8 PRO 8 6 ? ? ? A . n A 1 9 GLY 9 7 ? ? ? A . n A 1 10 GLY 10 8 ? ? ? A . n A 1 11 TYR 11 9 ? ? ? A . n A 1 12 ALA 12 10 ? ? ? A . n A 1 13 ALA 13 11 ? ? ? A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 PHE 15 13 13 PHE PHE A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 PRO 17 15 15 PRO PRO A . n A 1 18 PRO 18 16 16 PRO PRO A . n A 1 19 PRO 19 17 17 PRO PRO A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 CYS 21 19 19 CYS CYS A . n A 1 22 PRO 22 20 20 PRO PRO A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 PHE 24 22 22 PHE PHE A . n A 1 25 GLU 25 23 23 GLU GLU A . n A 1 26 PRO 26 24 24 PRO PRO A . n A 1 27 SER 27 25 25 SER SER A . n A 1 28 TRP 28 26 26 TRP TRP A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 GLU 30 28 28 GLU GLU A . n A 1 31 PHE 31 29 29 PHE PHE A . n A 1 32 THR 32 30 30 THR THR A . n A 1 33 ASP 33 31 31 ASP ASP A . n A 1 34 PRO 34 32 32 PRO PRO A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 PHE 37 35 35 PHE PHE A . n A 1 38 ILE 38 36 36 ILE ILE A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 ARG 40 38 38 ARG ARG A . n A 1 41 ILE 41 39 39 ILE ILE A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 PRO 43 41 41 PRO PRO A . n A 1 44 LEU 44 42 42 LEU LEU A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 GLU 46 44 44 GLU GLU A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 THR 48 46 46 THR THR A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 ILE 50 48 48 ILE ILE A . n A 1 51 CYS 51 49 49 CYS CYS A . n A 1 52 LYS 52 50 50 LYS LYS A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 ARG 54 52 52 ARG ARG A . n A 1 55 PRO 55 53 53 PRO PRO A . n A 1 56 PRO 56 54 54 PRO PRO A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 ASP 58 56 56 ASP ASP A . n A 1 59 TRP 59 57 57 TRP TRP A . n A 1 60 GLN 60 58 58 GLN GLN A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 PRO 62 60 60 PRO PRO A . n A 1 63 PHE 63 61 61 PHE PHE A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 CYS 65 63 63 CYS CYS A . n A 1 66 GLU 66 64 64 GLU GLU A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 PHE 70 68 68 PHE PHE A . n A 1 71 ARG 71 69 69 ARG ARG A . n A 1 72 PHE 72 70 70 PHE PHE A . n A 1 73 THR 73 71 71 THR THR A . n A 1 74 PRO 74 72 72 PRO PRO A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 LEU 79 77 77 LEU LEU A . n A 1 80 ASN 80 78 78 ASN ASN A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 ALA 84 82 82 ALA ALA A . n A 1 85 MET 85 83 83 MET MET A . n A 1 86 THR 86 84 84 THR THR A . n A 1 87 ARG 87 345 ? ? ? A . n A 1 88 VAL 88 346 ? ? ? A . n A 1 89 ARG 89 347 ? ? ? A . n A 1 90 PRO 90 348 ? ? ? A . n A 1 91 ARG 91 349 ? ? ? A . n A 1 92 GLU 92 350 ? ? ? A . n A 1 93 ALA 93 351 ? ? ? A . n A 1 94 PHE 94 352 ? ? ? A . n A 1 95 GLY 95 353 ? ? ? A . n A 1 96 PHE 96 354 ? ? ? A . n A 1 97 GLU 97 355 ? ? ? A . n A 1 98 GLN 98 356 ? ? ? A . n A 1 99 ALA 99 357 ? ? ? A . n A 1 100 VAL 100 358 358 VAL VAL A . n A 1 101 ARG 101 359 359 ARG ARG A . n A 1 102 GLU 102 360 360 GLU GLU A . n A 1 103 TYR 103 361 361 TYR TYR A . n A 1 104 THR 104 362 362 THR THR A . n A 1 105 LEU 105 363 363 LEU LEU A . n A 1 106 GLN 106 364 364 GLN GLN A . n A 1 107 SER 107 365 365 SER SER A . n A 1 108 PHE 108 366 366 PHE PHE A . n A 1 109 GLY 109 367 367 GLY GLY A . n A 1 110 GLU 110 368 368 GLU GLU A . n A 1 111 MET 111 369 369 MET MET A . n A 1 112 ALA 112 370 370 ALA ALA A . n A 1 113 ASP 113 371 371 ASP ASP A . n A 1 114 ASN 114 372 372 ASN ASN A . n A 1 115 PHE 115 373 373 PHE PHE A . n A 1 116 LYS 116 374 374 LYS LYS A . n A 1 117 SER 117 375 375 SER SER A . n A 1 118 ASP 118 376 376 ASP ASP A . n A 1 119 TYR 119 377 377 TYR TYR A . n A 1 120 PHE 120 378 378 PHE PHE A . n A 1 121 ASN 121 379 379 ASN ASN A . n A 1 122 MET 122 380 380 MET MET A . n A 1 123 PRO 123 381 381 PRO PRO A . n A 1 124 VAL 124 382 382 VAL VAL A . n A 1 125 HIS 125 383 383 HIS HIS A . n A 1 126 MET 126 384 384 MET MET A . n A 1 127 VAL 127 385 385 VAL VAL A . n A 1 128 PRO 128 386 386 PRO PRO A . n A 1 129 THR 129 387 387 THR THR A . n A 1 130 GLU 130 388 388 GLU GLU A . n A 1 131 LEU 131 389 389 LEU LEU A . n A 1 132 VAL 132 390 390 VAL VAL A . n A 1 133 GLU 133 391 391 GLU GLU A . n A 1 134 LYS 134 392 392 LYS LYS A . n A 1 135 GLU 135 393 393 GLU GLU A . n A 1 136 PHE 136 394 394 PHE PHE A . n A 1 137 TRP 137 395 395 TRP TRP A . n A 1 138 ARG 138 396 396 ARG ARG A . n A 1 139 LEU 139 397 397 LEU LEU A . n A 1 140 VAL 140 398 398 VAL VAL A . n A 1 141 SER 141 399 399 SER SER A . n A 1 142 SER 142 400 400 SER SER A . n A 1 143 ILE 143 401 401 ILE ILE A . n A 1 144 GLU 144 402 402 GLU GLU A . n A 1 145 GLU 145 403 403 GLU GLU A . n A 1 146 ASP 146 404 404 ASP ASP A . n A 1 147 VAL 147 405 405 VAL VAL A . n A 1 148 ILE 148 406 406 ILE ILE A . n A 1 149 VAL 149 407 407 VAL VAL A . n A 1 150 GLU 150 408 408 GLU GLU A . n A 1 151 TYR 151 409 409 TYR TYR A . n A 1 152 GLY 152 410 410 GLY GLY A . n A 1 153 ALA 153 411 411 ALA ALA A . n A 1 154 ASP 154 412 412 ASP ASP A . n A 1 155 ILE 155 413 413 ILE ILE A . n A 1 156 SER 156 414 414 SER SER A . n A 1 157 SER 157 415 415 SER SER A . n A 1 158 LYS 158 416 416 LYS LYS A . n A 1 159 ASP 159 417 417 ASP ASP A . n A 1 160 PHE 160 418 418 PHE PHE A . n A 1 161 GLY 161 419 419 GLY GLY A . n A 1 162 SER 162 420 420 SER SER A . n A 1 163 GLY 163 421 421 GLY GLY A . n A 1 164 PHE 164 422 422 PHE PHE A . n A 1 165 PRO 165 423 423 PRO PRO A . n A 1 166 VAL 166 424 424 VAL VAL A . n A 1 167 LYS 167 425 425 LYS LYS A . n A 1 168 ASP 168 426 426 ASP ASP A . n A 1 169 GLY 169 427 427 GLY GLY A . n A 1 170 ARG 170 428 428 ARG ARG A . n A 1 171 ARG 171 429 429 ARG ARG A . n A 1 172 LYS 172 430 430 LYS LYS A . n A 1 173 ILE 173 431 431 ILE ILE A . n A 1 174 LEU 174 432 432 LEU LEU A . n A 1 175 PRO 175 433 433 PRO PRO A . n A 1 176 GLU 176 434 434 GLU GLU A . n A 1 177 GLU 177 435 435 GLU GLU A . n A 1 178 GLU 178 436 436 GLU GLU A . n A 1 179 GLU 179 437 437 GLU GLU A . n A 1 180 TYR 180 438 438 TYR TYR A . n A 1 181 ALA 181 439 439 ALA ALA A . n A 1 182 LEU 182 440 440 LEU LEU A . n A 1 183 SER 183 441 441 SER SER A . n A 1 184 GLY 184 442 442 GLY GLY A . n A 1 185 TRP 185 443 443 TRP TRP A . n A 1 186 ASN 186 444 444 ASN ASN A . n A 1 187 LEU 187 445 445 LEU LEU A . n A 1 188 ASN 188 446 446 ASN ASN A . n A 1 189 ASN 189 447 447 ASN ASN A . n A 1 190 MET 190 448 448 MET MET A . n A 1 191 PRO 191 449 449 PRO PRO A . n A 1 192 VAL 192 450 450 VAL VAL A . n A 1 193 LEU 193 451 451 LEU LEU A . n A 1 194 GLU 194 452 452 GLU GLU A . n A 1 195 GLN 195 453 453 GLN GLN A . n A 1 196 SER 196 454 454 SER SER A . n A 1 197 VAL 197 455 455 VAL VAL A . n A 1 198 LEU 198 456 456 LEU LEU A . n A 1 199 ALA 199 457 457 ALA ALA A . n A 1 200 HIS 200 458 458 HIS HIS A . n A 1 201 ILE 201 459 459 ILE ILE A . n A 1 202 ASN 202 460 460 ASN ASN A . n A 1 203 VAL 203 461 461 VAL MET A . n A 1 204 ASP 204 462 ? ? ? A . n A 1 205 ILE 205 463 ? ? ? A . n A 1 206 SER 206 464 ? ? ? A . n A 1 207 GLY 207 465 ? ? ? A . n A 1 208 MET 208 466 ? ? ? A . n A 1 209 LYS 209 467 467 LYS LYS A . n A 1 210 VAL 210 468 468 VAL VAL A . n A 1 211 PRO 211 469 469 PRO PRO A . n A 1 212 TRP 212 470 470 TRP TRP A . n A 1 213 LEU 213 471 471 LEU LEU A . n A 1 214 TYR 214 472 472 TYR TYR A . n A 1 215 VAL 215 473 473 VAL VAL A . n A 1 216 GLY 216 474 474 GLY GLY A . n A 1 217 MET 217 475 475 MET MET A . n A 1 218 CYS 218 476 476 CYS CYS A . n A 1 219 PHE 219 477 477 PHE PHE A . n A 1 220 SER 220 478 478 SER SER A . n A 1 221 SER 221 479 479 SER SER A . n A 1 222 PHE 222 480 480 PHE PHE A . n A 1 223 CYS 223 481 481 CYS CYS A . n A 1 224 TRP 224 482 482 TRP TRP A . n A 1 225 HIS 225 483 483 HIS HIS A . n A 1 226 ILE 226 484 484 ILE ILE A . n A 1 227 GLU 227 485 485 GLU GLU A . n A 1 228 ASP 228 486 486 ASP ASP A . n A 1 229 HIS 229 487 487 HIS HIS A . n A 1 230 TRP 230 488 488 TRP TRP A . n A 1 231 SER 231 489 489 SER SER A . n A 1 232 TYR 232 490 490 TYR TYR A . n A 1 233 SER 233 491 491 SER SER A . n A 1 234 ILE 234 492 492 ILE ILE A . n A 1 235 ASN 235 493 493 ASN ASN A . n A 1 236 TYR 236 494 494 TYR TYR A . n A 1 237 LEU 237 495 495 LEU LEU A . n A 1 238 HIS 238 496 496 HIS HIS A . n A 1 239 TRP 239 497 497 TRP TRP A . n A 1 240 GLY 240 498 498 GLY GLY A . n A 1 241 GLU 241 499 499 GLU GLU A . n A 1 242 PRO 242 500 500 PRO PRO A . n A 1 243 LYS 243 501 501 LYS LYS A . n A 1 244 THR 244 502 502 THR THR A . n A 1 245 TRP 245 503 503 TRP TRP A . n A 1 246 TYR 246 504 504 TYR TYR A . n A 1 247 GLY 247 505 505 GLY GLY A . n A 1 248 VAL 248 506 506 VAL VAL A . n A 1 249 PRO 249 507 507 PRO PRO A . n A 1 250 SER 250 508 508 SER SER A . n A 1 251 HIS 251 509 509 HIS HIS A . n A 1 252 ALA 252 510 510 ALA ALA A . n A 1 253 ALA 253 511 511 ALA ALA A . n A 1 254 GLU 254 512 512 GLU GLU A . n A 1 255 GLN 255 513 513 GLN GLN A . n A 1 256 LEU 256 514 514 LEU LEU A . n A 1 257 GLU 257 515 515 GLU GLU A . n A 1 258 GLU 258 516 516 GLU GLU A . n A 1 259 VAL 259 517 517 VAL VAL A . n A 1 260 MET 260 518 518 MET MET A . n A 1 261 ARG 261 519 519 ARG ARG A . n A 1 262 GLU 262 520 520 GLU GLU A . n A 1 263 LEU 263 521 521 LEU LEU A . n A 1 264 ALA 264 522 522 ALA ALA A . n A 1 265 PRO 265 523 523 PRO PRO A . n A 1 266 GLU 266 524 524 GLU GLU A . n A 1 267 LEU 267 525 525 LEU LEU A . n A 1 268 PHE 268 526 526 PHE PHE A . n A 1 269 GLU 269 527 527 GLU GLU A . n A 1 270 SER 270 528 528 SER SER A . n A 1 271 GLN 271 529 529 GLN GLN A . n A 1 272 PRO 272 530 530 PRO PRO A . n A 1 273 ASP 273 531 531 ASP ASP A . n A 1 274 LEU 274 532 532 LEU LEU A . n A 1 275 LEU 275 533 533 LEU LEU A . n A 1 276 HIS 276 534 534 HIS HIS A . n A 1 277 GLN 277 535 535 GLN GLN A . n A 1 278 LEU 278 536 536 LEU LEU A . n A 1 279 VAL 279 537 537 VAL VAL A . n A 1 280 THR 280 538 538 THR THR A . n A 1 281 ILE 281 539 539 ILE ILE A . n A 1 282 MET 282 540 540 MET MET A . n A 1 283 ASN 283 541 541 ASN ASN A . n A 1 284 PRO 284 542 542 PRO PRO A . n A 1 285 ASN 285 543 543 ASN ASN A . n A 1 286 VAL 286 544 544 VAL VAL A . n A 1 287 LEU 287 545 545 LEU LEU A . n A 1 288 MET 288 546 546 MET MET A . n A 1 289 GLU 289 547 547 GLU GLU A . n A 1 290 HIS 290 548 548 HIS HIS A . n A 1 291 GLY 291 549 549 GLY GLY A . n A 1 292 VAL 292 550 550 VAL VAL A . n A 1 293 PRO 293 551 551 PRO PRO A . n A 1 294 VAL 294 552 552 VAL VAL A . n A 1 295 TYR 295 553 553 TYR TYR A . n A 1 296 ARG 296 554 554 ARG ARG A . n A 1 297 THR 297 555 555 THR THR A . n A 1 298 ASN 298 556 556 ASN ASN A . n A 1 299 GLN 299 557 557 GLN GLN A . n A 1 300 CYS 300 558 558 CYS CYS A . n A 1 301 ALA 301 559 559 ALA ALA A . n A 1 302 GLY 302 560 560 GLY GLY A . n A 1 303 GLU 303 561 561 GLU GLU A . n A 1 304 PHE 304 562 562 PHE PHE A . n A 1 305 VAL 305 563 563 VAL VAL A . n A 1 306 VAL 306 564 564 VAL VAL A . n A 1 307 THR 307 565 565 THR THR A . n A 1 308 PHE 308 566 566 PHE PHE A . n A 1 309 PRO 309 567 567 PRO PRO A . n A 1 310 ARG 310 568 568 ARG ARG A . n A 1 311 ALA 311 569 569 ALA ALA A . n A 1 312 TYR 312 570 570 TYR TYR A . n A 1 313 HIS 313 571 571 HIS HIS A . n A 1 314 SER 314 572 572 SER SER A . n A 1 315 GLY 315 573 573 GLY GLY A . n A 1 316 PHE 316 574 574 PHE PHE A . n A 1 317 ASN 317 575 575 ASN ASN A . n A 1 318 GLN 318 576 576 GLN GLN A . n A 1 319 GLY 319 577 577 GLY GLY A . n A 1 320 TYR 320 578 578 TYR TYR A . n A 1 321 ASN 321 579 579 ASN ASN A . n A 1 322 PHE 322 580 580 PHE PHE A . n A 1 323 ALA 323 581 581 ALA ALA A . n A 1 324 GLU 324 582 582 GLU GLU A . n A 1 325 ALA 325 583 583 ALA ALA A . n A 1 326 VAL 326 584 584 VAL VAL A . n A 1 327 ASN 327 585 585 ASN ASN A . n A 1 328 PHE 328 586 586 PHE PHE A . n A 1 329 CYS 329 587 587 CYS CYS A . n A 1 330 THR 330 588 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 H6G 1 601 1 H6G LIG A . C 3 MN 1 602 1 MN MN A . D 4 HOH 1 701 103 HOH HOH A . D 4 HOH 2 702 80 HOH HOH A . D 4 HOH 3 703 49 HOH HOH A . D 4 HOH 4 704 7 HOH HOH A . D 4 HOH 5 705 22 HOH HOH A . D 4 HOH 6 706 10 HOH HOH A . D 4 HOH 7 707 69 HOH HOH A . D 4 HOH 8 708 52 HOH HOH A . D 4 HOH 9 709 111 HOH HOH A . D 4 HOH 10 710 21 HOH HOH A . D 4 HOH 11 711 25 HOH HOH A . D 4 HOH 12 712 35 HOH HOH A . D 4 HOH 13 713 110 HOH HOH A . D 4 HOH 14 714 53 HOH HOH A . D 4 HOH 15 715 93 HOH HOH A . D 4 HOH 16 716 16 HOH HOH A . D 4 HOH 17 717 48 HOH HOH A . D 4 HOH 18 718 2 HOH HOH A . D 4 HOH 19 719 38 HOH HOH A . D 4 HOH 20 720 18 HOH HOH A . D 4 HOH 21 721 20 HOH HOH A . D 4 HOH 22 722 89 HOH HOH A . D 4 HOH 23 723 27 HOH HOH A . D 4 HOH 24 724 57 HOH HOH A . D 4 HOH 25 725 99 HOH HOH A . D 4 HOH 26 726 15 HOH HOH A . D 4 HOH 27 727 33 HOH HOH A . D 4 HOH 28 728 41 HOH HOH A . D 4 HOH 29 729 9 HOH HOH A . D 4 HOH 30 730 105 HOH HOH A . D 4 HOH 31 731 75 HOH HOH A . D 4 HOH 32 732 26 HOH HOH A . D 4 HOH 33 733 8 HOH HOH A . D 4 HOH 34 734 98 HOH HOH A . D 4 HOH 35 735 14 HOH HOH A . D 4 HOH 36 736 46 HOH HOH A . D 4 HOH 37 737 4 HOH HOH A . D 4 HOH 38 738 117 HOH HOH A . D 4 HOH 39 739 31 HOH HOH A . D 4 HOH 40 740 30 HOH HOH A . D 4 HOH 41 741 23 HOH HOH A . D 4 HOH 42 742 3 HOH HOH A . D 4 HOH 43 743 39 HOH HOH A . D 4 HOH 44 744 32 HOH HOH A . D 4 HOH 45 745 12 HOH HOH A . D 4 HOH 46 746 104 HOH HOH A . D 4 HOH 47 747 63 HOH HOH A . D 4 HOH 48 748 70 HOH HOH A . D 4 HOH 49 749 24 HOH HOH A . D 4 HOH 50 750 6 HOH HOH A . D 4 HOH 51 751 107 HOH HOH A . D 4 HOH 52 752 29 HOH HOH A . D 4 HOH 53 753 114 HOH HOH A . D 4 HOH 54 754 40 HOH HOH A . D 4 HOH 55 755 36 HOH HOH A . D 4 HOH 56 756 61 HOH HOH A . D 4 HOH 57 757 1 HOH HOH A . D 4 HOH 58 758 77 HOH HOH A . D 4 HOH 59 759 5 HOH HOH A . D 4 HOH 60 760 118 HOH HOH A . D 4 HOH 61 761 37 HOH HOH A . D 4 HOH 62 762 17 HOH HOH A . D 4 HOH 63 763 112 HOH HOH A . D 4 HOH 64 764 28 HOH HOH A . D 4 HOH 65 765 62 HOH HOH A . D 4 HOH 66 766 67 HOH HOH A . D 4 HOH 67 767 97 HOH HOH A . D 4 HOH 68 768 109 HOH HOH A . D 4 HOH 69 769 59 HOH HOH A . D 4 HOH 70 770 116 HOH HOH A . D 4 HOH 71 771 56 HOH HOH A . D 4 HOH 72 772 102 HOH HOH A . D 4 HOH 73 773 13 HOH HOH A . D 4 HOH 74 774 44 HOH HOH A . D 4 HOH 75 775 11 HOH HOH A . D 4 HOH 76 776 100 HOH HOH A . D 4 HOH 77 777 42 HOH HOH A . D 4 HOH 78 778 86 HOH HOH A . D 4 HOH 79 779 108 HOH HOH A . D 4 HOH 80 780 71 HOH HOH A . D 4 HOH 81 781 50 HOH HOH A . D 4 HOH 82 782 47 HOH HOH A . D 4 HOH 83 783 106 HOH HOH A . D 4 HOH 84 784 19 HOH HOH A . D 4 HOH 85 785 51 HOH HOH A . D 4 HOH 86 786 87 HOH HOH A . D 4 HOH 87 787 95 HOH HOH A . D 4 HOH 88 788 45 HOH HOH A . D 4 HOH 89 789 120 HOH HOH A . D 4 HOH 90 790 79 HOH HOH A . D 4 HOH 91 791 74 HOH HOH A . D 4 HOH 92 792 60 HOH HOH A . D 4 HOH 93 793 115 HOH HOH A . D 4 HOH 94 794 76 HOH HOH A . D 4 HOH 95 795 101 HOH HOH A . D 4 HOH 96 796 34 HOH HOH A . D 4 HOH 97 797 122 HOH HOH A . D 4 HOH 98 798 82 HOH HOH A . D 4 HOH 99 799 113 HOH HOH A . D 4 HOH 100 800 43 HOH HOH A . D 4 HOH 101 801 119 HOH HOH A . D 4 HOH 102 802 121 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 130 ? 1 MORE -6 ? 1 'SSA (A^2)' 14050 ? 2 'ABSA (A^2)' 1420 ? 2 MORE -22 ? 2 'SSA (A^2)' 26950 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 790 ? D HOH . 2 1 A HOH 794 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 225 ? A HIS 483 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 OE2 ? A GLU 227 ? A GLU 485 ? 1_555 89.9 ? 2 NE2 ? A HIS 225 ? A HIS 483 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 N28 ? B H6G . ? A H6G 601 ? 1_555 96.5 ? 3 OE2 ? A GLU 227 ? A GLU 485 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 N28 ? B H6G . ? A H6G 601 ? 1_555 101.0 ? 4 NE2 ? A HIS 225 ? A HIS 483 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 N29 ? B H6G . ? A H6G 601 ? 1_555 91.4 ? 5 OE2 ? A GLU 227 ? A GLU 485 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 N29 ? B H6G . ? A H6G 601 ? 1_555 175.7 ? 6 N28 ? B H6G . ? A H6G 601 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 N29 ? B H6G . ? A H6G 601 ? 1_555 74.8 ? 7 NE2 ? A HIS 225 ? A HIS 483 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 725 ? 1_555 93.3 ? 8 OE2 ? A GLU 227 ? A GLU 485 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 725 ? 1_555 80.9 ? 9 N28 ? B H6G . ? A H6G 601 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 725 ? 1_555 170.0 ? 10 N29 ? B H6G . ? A H6G 601 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 725 ? 1_555 103.2 ? 11 NE2 ? A HIS 225 ? A HIS 483 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 734 ? 1_555 171.5 ? 12 OE2 ? A GLU 227 ? A GLU 485 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 734 ? 1_555 87.2 ? 13 N28 ? B H6G . ? A H6G 601 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 734 ? 1_555 91.8 ? 14 N29 ? B H6G . ? A H6G 601 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 734 ? 1_555 92.1 ? 15 O ? D HOH . ? A HOH 725 ? 1_555 MN ? C MN . ? A MN 602 ? 1_555 O ? D HOH . ? A HOH 734 ? 1_555 78.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-21 2 'Structure model' 1 1 2019-05-01 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -17.7747 2.2688 8.5130 0.2302 0.1884 0.2601 0.0203 0.0211 -0.0100 5.2814 2.2808 1.6796 -0.8192 1.1062 0.8548 -0.0184 0.2968 -0.2533 0.1356 0.1862 -0.4343 0.0831 0.3541 -0.1867 'X-RAY DIFFRACTION' 2 ? refined -12.9848 6.8164 5.3166 0.1229 0.1697 0.1801 -0.0180 -0.0102 0.0153 2.0375 2.9347 1.8226 0.5991 -0.0553 0.3036 -0.0364 0.0788 -0.1283 -0.1064 0.0318 -0.1064 0.0737 0.2963 0.0147 'X-RAY DIFFRACTION' 3 ? refined -27.6225 27.4045 18.1553 0.2949 0.1696 0.1554 0.0297 0.0164 -0.0221 1.7631 3.4933 3.0255 0.5262 0.1774 -1.1617 -0.0576 -0.0332 0.1467 0.2789 0.1028 0.0489 -0.5191 -0.0661 0.0188 'X-RAY DIFFRACTION' 4 ? refined -35.0370 15.0930 20.9202 0.2004 0.2606 0.1544 0.0117 0.0670 0.0214 0.4694 2.6676 3.6673 0.8257 -0.0822 1.0698 -0.1421 0.0173 0.0481 0.2685 0.1252 0.2730 0.1400 -0.4853 0.0148 'X-RAY DIFFRACTION' 5 ? refined -12.1708 26.3727 9.8640 0.2533 0.2381 0.3880 -0.0977 0.0159 0.0002 2.4873 0.4429 1.4024 -1.0736 -0.5623 0.3231 -0.1360 0.3862 1.1040 0.1028 0.1690 -0.2201 -0.1664 0.2392 -0.0231 'X-RAY DIFFRACTION' 6 ? refined -1.8549 15.6321 7.2574 0.1844 0.3223 0.2557 -0.0637 0.0219 -0.0114 5.5096 3.3949 2.4525 0.5931 0.0707 -0.3350 0.0966 -0.8134 -0.3657 0.4098 0.0577 -0.3090 -0.2176 0.4205 -0.0642 'X-RAY DIFFRACTION' 7 ? refined -13.1488 22.3738 -5.9918 0.6827 0.3439 0.2468 0.0165 0.0926 0.0888 0.7197 0.0801 0.4658 -0.1463 0.5391 -0.1511 0.5027 0.3215 0.3074 -0.7274 0.0196 -0.0541 -0.8710 0.4102 -0.4603 'X-RAY DIFFRACTION' 8 ? refined -23.5731 15.2364 6.2850 0.1345 0.1424 0.1407 -0.0185 -0.0003 0.0123 0.8174 1.2403 1.4765 0.0453 0.7930 0.1785 -0.0280 0.0296 -0.0499 -0.0137 0.0435 -0.0169 -0.0845 0.0691 -0.0213 'X-RAY DIFFRACTION' 9 ? refined -37.2169 9.5375 -5.2136 0.2722 0.3085 0.2085 -0.0532 -0.0685 -0.0309 6.0684 6.3368 3.7623 -3.6353 -1.4043 -0.7264 0.0200 0.5615 -0.5083 -0.7091 0.1827 0.8479 0.0864 -0.6999 -0.1177 'X-RAY DIFFRACTION' 10 ? refined -38.6081 22.9992 -3.8895 0.2988 0.2713 0.2892 0.0361 -0.0086 -0.0718 5.2768 3.5828 6.0630 -0.3492 -2.5064 -0.7555 -0.4278 0.3738 -0.5634 -0.2027 -0.0029 0.0807 0.5907 0.0297 0.5702 'X-RAY DIFFRACTION' 11 ? refined -26.2430 11.5004 6.1298 0.1692 0.1087 0.1270 -0.0085 -0.0036 0.0105 1.5857 1.4636 1.5325 0.1629 0.3749 0.2770 0.0115 0.0225 -0.0326 -0.0441 -0.0036 0.0630 0.1480 -0.0255 -0.0064 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 12 through 31 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 32 through 64 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 65 through 378 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 379 through 405 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 406 through 432 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 433 through 447 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 448 through 474 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 475 through 507 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 508 through 521 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 522 through 537 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 538 through 587 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 64 ? ? -68.22 84.40 2 1 PHE A 477 ? ? 80.32 -8.96 3 1 THR A 538 ? ? -113.23 59.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 12 ? CG ? A GLU 14 CG 2 1 Y 1 A GLU 12 ? CD ? A GLU 14 CD 3 1 Y 1 A GLU 12 ? OE1 ? A GLU 14 OE1 4 1 Y 1 A GLU 12 ? OE2 ? A GLU 14 OE2 5 1 Y 1 A GLU 27 ? CG ? A GLU 29 CG 6 1 Y 1 A GLU 27 ? CD ? A GLU 29 CD 7 1 Y 1 A GLU 27 ? OE1 ? A GLU 29 OE1 8 1 Y 1 A GLU 27 ? OE2 ? A GLU 29 OE2 9 1 Y 1 A THR 30 ? OG1 ? A THR 32 OG1 10 1 Y 1 A THR 30 ? CG2 ? A THR 32 CG2 11 1 Y 1 A LYS 55 ? CG ? A LYS 57 CG 12 1 Y 1 A LYS 55 ? CD ? A LYS 57 CD 13 1 Y 1 A LYS 55 ? CE ? A LYS 57 CE 14 1 Y 1 A LYS 55 ? NZ ? A LYS 57 NZ 15 1 Y 1 A ASP 56 ? CG ? A ASP 58 CG 16 1 Y 1 A ASP 56 ? OD1 ? A ASP 58 OD1 17 1 Y 1 A ASP 56 ? OD2 ? A ASP 58 OD2 18 1 Y 1 A GLU 64 ? CG ? A GLU 66 CG 19 1 Y 1 A GLU 64 ? CD ? A GLU 66 CD 20 1 Y 1 A GLU 64 ? OE1 ? A GLU 66 OE1 21 1 Y 1 A GLU 64 ? OE2 ? A GLU 66 OE2 22 1 Y 1 A LYS 66 ? CG ? A LYS 68 CG 23 1 Y 1 A LYS 66 ? CD ? A LYS 68 CD 24 1 Y 1 A LYS 66 ? CE ? A LYS 68 CE 25 1 Y 1 A LYS 66 ? NZ ? A LYS 68 NZ 26 1 Y 1 A ARG 69 ? CG ? A ARG 71 CG 27 1 Y 1 A ARG 69 ? CD ? A ARG 71 CD 28 1 Y 1 A ARG 69 ? NE ? A ARG 71 NE 29 1 Y 1 A ARG 69 ? CZ ? A ARG 71 CZ 30 1 Y 1 A ARG 69 ? NH1 ? A ARG 71 NH1 31 1 Y 1 A ARG 69 ? NH2 ? A ARG 71 NH2 32 1 Y 1 A GLU 81 ? CG ? A GLU 83 CG 33 1 Y 1 A GLU 81 ? CD ? A GLU 83 CD 34 1 Y 1 A GLU 81 ? OE1 ? A GLU 83 OE1 35 1 Y 1 A GLU 81 ? OE2 ? A GLU 83 OE2 36 1 Y 1 A THR 84 ? OG1 ? A THR 86 OG1 37 1 Y 1 A THR 84 ? CG2 ? A THR 86 CG2 38 1 Y 1 A VAL 358 ? CG1 ? A VAL 100 CG1 39 1 Y 1 A VAL 358 ? CG2 ? A VAL 100 CG2 40 1 Y 1 A GLU 388 ? CG ? A GLU 130 CG 41 1 Y 1 A GLU 388 ? CD ? A GLU 130 CD 42 1 Y 1 A GLU 388 ? OE1 ? A GLU 130 OE1 43 1 Y 1 A GLU 388 ? OE2 ? A GLU 130 OE2 44 1 Y 1 A LYS 392 ? CG ? A LYS 134 CG 45 1 Y 1 A LYS 392 ? CD ? A LYS 134 CD 46 1 Y 1 A LYS 392 ? CE ? A LYS 134 CE 47 1 Y 1 A LYS 392 ? NZ ? A LYS 134 NZ 48 1 Y 1 A GLU 402 ? CG ? A GLU 144 CG 49 1 Y 1 A GLU 402 ? CD ? A GLU 144 CD 50 1 Y 1 A GLU 402 ? OE1 ? A GLU 144 OE1 51 1 Y 1 A GLU 402 ? OE2 ? A GLU 144 OE2 52 1 Y 1 A GLU 403 ? CG ? A GLU 145 CG 53 1 Y 1 A GLU 403 ? CD ? A GLU 145 CD 54 1 Y 1 A GLU 403 ? OE1 ? A GLU 145 OE1 55 1 Y 1 A GLU 403 ? OE2 ? A GLU 145 OE2 56 1 Y 1 A ASP 404 ? CG ? A ASP 146 CG 57 1 Y 1 A ASP 404 ? OD1 ? A ASP 146 OD1 58 1 Y 1 A ASP 404 ? OD2 ? A ASP 146 OD2 59 1 Y 1 A LYS 416 ? CG ? A LYS 158 CG 60 1 Y 1 A LYS 416 ? CD ? A LYS 158 CD 61 1 Y 1 A LYS 416 ? CE ? A LYS 158 CE 62 1 Y 1 A LYS 416 ? NZ ? A LYS 158 NZ 63 1 Y 1 A LYS 425 ? CG ? A LYS 167 CG 64 1 Y 1 A LYS 425 ? CD ? A LYS 167 CD 65 1 Y 1 A LYS 425 ? CE ? A LYS 167 CE 66 1 Y 1 A LYS 425 ? NZ ? A LYS 167 NZ 67 1 Y 1 A ASP 426 ? CG ? A ASP 168 CG 68 1 Y 1 A ASP 426 ? OD1 ? A ASP 168 OD1 69 1 Y 1 A ASP 426 ? OD2 ? A ASP 168 OD2 70 1 Y 1 A ARG 428 ? CG ? A ARG 170 CG 71 1 Y 1 A ARG 428 ? CD ? A ARG 170 CD 72 1 Y 1 A ARG 428 ? NE ? A ARG 170 NE 73 1 Y 1 A ARG 428 ? CZ ? A ARG 170 CZ 74 1 Y 1 A ARG 428 ? NH1 ? A ARG 170 NH1 75 1 Y 1 A ARG 428 ? NH2 ? A ARG 170 NH2 76 1 Y 1 A ARG 429 ? CG ? A ARG 171 CG 77 1 Y 1 A ARG 429 ? CD ? A ARG 171 CD 78 1 Y 1 A ARG 429 ? NE ? A ARG 171 NE 79 1 Y 1 A ARG 429 ? CZ ? A ARG 171 CZ 80 1 Y 1 A ARG 429 ? NH1 ? A ARG 171 NH1 81 1 Y 1 A ARG 429 ? NH2 ? A ARG 171 NH2 82 1 Y 1 A LYS 430 ? CG ? A LYS 172 CG 83 1 Y 1 A LYS 430 ? CD ? A LYS 172 CD 84 1 Y 1 A LYS 430 ? CE ? A LYS 172 CE 85 1 Y 1 A LYS 430 ? NZ ? A LYS 172 NZ 86 1 Y 1 A ILE 431 ? CG1 ? A ILE 173 CG1 87 1 Y 1 A ILE 431 ? CG2 ? A ILE 173 CG2 88 1 Y 1 A ILE 431 ? CD1 ? A ILE 173 CD1 89 1 Y 1 A GLU 434 ? CG ? A GLU 176 CG 90 1 Y 1 A GLU 434 ? CD ? A GLU 176 CD 91 1 Y 1 A GLU 434 ? OE1 ? A GLU 176 OE1 92 1 Y 1 A GLU 434 ? OE2 ? A GLU 176 OE2 93 1 Y 1 A GLU 452 ? CG ? A GLU 194 CG 94 1 Y 1 A GLU 452 ? CD ? A GLU 194 CD 95 1 Y 1 A GLU 452 ? OE1 ? A GLU 194 OE1 96 1 Y 1 A GLU 452 ? OE2 ? A GLU 194 OE2 97 1 Y 1 A GLN 453 ? CG ? A GLN 195 CG 98 1 Y 1 A GLN 453 ? CD ? A GLN 195 CD 99 1 Y 1 A GLN 453 ? OE1 ? A GLN 195 OE1 100 1 Y 1 A GLN 453 ? NE2 ? A GLN 195 NE2 101 1 Y 1 A SER 454 ? OG ? A SER 196 OG 102 1 Y 1 A HIS 458 ? CG ? A HIS 200 CG 103 1 Y 1 A HIS 458 ? ND1 ? A HIS 200 ND1 104 1 Y 1 A HIS 458 ? CD2 ? A HIS 200 CD2 105 1 Y 1 A HIS 458 ? CE1 ? A HIS 200 CE1 106 1 Y 1 A HIS 458 ? NE2 ? A HIS 200 NE2 107 1 Y 1 A ILE 459 ? CG1 ? A ILE 201 CG1 108 1 Y 1 A ILE 459 ? CG2 ? A ILE 201 CG2 109 1 Y 1 A ILE 459 ? CD1 ? A ILE 201 CD1 110 1 Y 1 A VAL 461 ? CG1 ? A VAL 203 CG1 111 1 Y 1 A VAL 461 ? CG2 ? A VAL 203 CG2 112 1 Y 1 A LYS 467 ? CG ? A LYS 209 CG 113 1 Y 1 A LYS 467 ? CD ? A LYS 209 CD 114 1 Y 1 A LYS 467 ? CE ? A LYS 209 CE 115 1 Y 1 A LYS 467 ? NZ ? A LYS 209 NZ 116 1 Y 1 A ARG 519 ? CG ? A ARG 261 CG 117 1 Y 1 A ARG 519 ? CD ? A ARG 261 CD 118 1 Y 1 A ARG 519 ? NE ? A ARG 261 NE 119 1 Y 1 A ARG 519 ? CZ ? A ARG 261 CZ 120 1 Y 1 A ARG 519 ? NH1 ? A ARG 261 NH1 121 1 Y 1 A ARG 519 ? NH2 ? A ARG 261 NH2 122 1 Y 1 A GLU 520 ? CG ? A GLU 262 CG 123 1 Y 1 A GLU 520 ? CD ? A GLU 262 CD 124 1 Y 1 A GLU 520 ? OE1 ? A GLU 262 OE1 125 1 Y 1 A GLU 520 ? OE2 ? A GLU 262 OE2 126 1 Y 1 A LEU 521 ? CG ? A LEU 263 CG 127 1 Y 1 A LEU 521 ? CD1 ? A LEU 263 CD1 128 1 Y 1 A LEU 521 ? CD2 ? A LEU 263 CD2 129 1 Y 1 A GLU 524 ? CG ? A GLU 266 CG 130 1 Y 1 A GLU 524 ? CD ? A GLU 266 CD 131 1 Y 1 A GLU 524 ? OE1 ? A GLU 266 OE1 132 1 Y 1 A GLU 524 ? OE2 ? A GLU 266 OE2 133 1 Y 1 A GLU 527 ? CG ? A GLU 269 CG 134 1 Y 1 A GLU 527 ? CD ? A GLU 269 CD 135 1 Y 1 A GLU 527 ? OE1 ? A GLU 269 OE1 136 1 Y 1 A GLU 527 ? OE2 ? A GLU 269 OE2 137 1 Y 1 A LEU 532 ? CG ? A LEU 274 CG 138 1 Y 1 A LEU 532 ? CD1 ? A LEU 274 CD1 139 1 Y 1 A LEU 532 ? CD2 ? A LEU 274 CD2 140 1 Y 1 A GLU 547 ? CG ? A GLU 289 CG 141 1 Y 1 A GLU 547 ? CD ? A GLU 289 CD 142 1 Y 1 A GLU 547 ? OE1 ? A GLU 289 OE1 143 1 Y 1 A GLU 547 ? OE2 ? A GLU 289 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -1 ? A HIS 1 2 1 Y 1 A ASN 0 ? A ASN 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ALA 2 ? A ALA 4 5 1 Y 1 A GLY 3 ? A GLY 5 6 1 Y 1 A VAL 4 ? A VAL 6 7 1 Y 1 A GLY 5 ? A GLY 7 8 1 Y 1 A PRO 6 ? A PRO 8 9 1 Y 1 A GLY 7 ? A GLY 9 10 1 Y 1 A GLY 8 ? A GLY 10 11 1 Y 1 A TYR 9 ? A TYR 11 12 1 Y 1 A ALA 10 ? A ALA 12 13 1 Y 1 A ALA 11 ? A ALA 13 14 1 Y 1 A ARG 345 ? A ARG 87 15 1 Y 1 A VAL 346 ? A VAL 88 16 1 Y 1 A ARG 347 ? A ARG 89 17 1 Y 1 A PRO 348 ? A PRO 90 18 1 Y 1 A ARG 349 ? A ARG 91 19 1 Y 1 A GLU 350 ? A GLU 92 20 1 Y 1 A ALA 351 ? A ALA 93 21 1 Y 1 A PHE 352 ? A PHE 94 22 1 Y 1 A GLY 353 ? A GLY 95 23 1 Y 1 A PHE 354 ? A PHE 96 24 1 Y 1 A GLU 355 ? A GLU 97 25 1 Y 1 A GLN 356 ? A GLN 98 26 1 Y 1 A ALA 357 ? A ALA 99 27 1 Y 1 A ASP 462 ? A ASP 204 28 1 Y 1 A ILE 463 ? A ILE 205 29 1 Y 1 A SER 464 ? A SER 206 30 1 Y 1 A GLY 465 ? A GLY 207 31 1 Y 1 A MET 466 ? A MET 208 32 1 Y 1 A THR 588 ? A THR 330 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 H6G C13 C N N 137 H6G C15 C N N 138 H6G C17 C N N 139 H6G C20 C N N 140 H6G C22 C Y N 141 H6G C24 C Y N 142 H6G C26 C Y N 143 H6G C02 C N N 144 H6G C04 C N N 145 H6G C05 C N N 146 H6G C07 C Y N 147 H6G C08 C Y N 148 H6G C09 C Y N 149 H6G C11 C N N 150 H6G C12 C N N 151 H6G C16 C N N 152 H6G C19 C N N 153 H6G C23 C Y N 154 H6G C25 C Y N 155 H6G C27 C Y N 156 H6G N06 N N N 157 H6G N10 N N N 158 H6G N14 N N N 159 H6G N21 N Y N 160 H6G N28 N Y N 161 H6G N29 N Y N 162 H6G O01 O N N 163 H6G O03 O N N 164 H6G O18 O N N 165 H6G H1 H N N 166 H6G H2 H N N 167 H6G H3 H N N 168 H6G H4 H N N 169 H6G H5 H N N 170 H6G H6 H N N 171 H6G H7 H N N 172 H6G H8 H N N 173 H6G H9 H N N 174 H6G H10 H N N 175 H6G H11 H N N 176 H6G H12 H N N 177 H6G H13 H N N 178 H6G H14 H N N 179 H6G H15 H N N 180 H6G H16 H N N 181 H6G H17 H N N 182 H6G H18 H N N 183 H6G H19 H N N 184 H6G H20 H N N 185 H6G H21 H N N 186 H6G H22 H N N 187 H6G H23 H N N 188 H6G H24 H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 HOH O O N N 211 HOH H1 H N N 212 HOH H2 H N N 213 ILE N N N N 214 ILE CA C N S 215 ILE C C N N 216 ILE O O N N 217 ILE CB C N S 218 ILE CG1 C N N 219 ILE CG2 C N N 220 ILE CD1 C N N 221 ILE OXT O N N 222 ILE H H N N 223 ILE H2 H N N 224 ILE HA H N N 225 ILE HB H N N 226 ILE HG12 H N N 227 ILE HG13 H N N 228 ILE HG21 H N N 229 ILE HG22 H N N 230 ILE HG23 H N N 231 ILE HD11 H N N 232 ILE HD12 H N N 233 ILE HD13 H N N 234 ILE HXT H N N 235 LEU N N N N 236 LEU CA C N S 237 LEU C C N N 238 LEU O O N N 239 LEU CB C N N 240 LEU CG C N N 241 LEU CD1 C N N 242 LEU CD2 C N N 243 LEU OXT O N N 244 LEU H H N N 245 LEU H2 H N N 246 LEU HA H N N 247 LEU HB2 H N N 248 LEU HB3 H N N 249 LEU HG H N N 250 LEU HD11 H N N 251 LEU HD12 H N N 252 LEU HD13 H N N 253 LEU HD21 H N N 254 LEU HD22 H N N 255 LEU HD23 H N N 256 LEU HXT H N N 257 LYS N N N N 258 LYS CA C N S 259 LYS C C N N 260 LYS O O N N 261 LYS CB C N N 262 LYS CG C N N 263 LYS CD C N N 264 LYS CE C N N 265 LYS NZ N N N 266 LYS OXT O N N 267 LYS H H N N 268 LYS H2 H N N 269 LYS HA H N N 270 LYS HB2 H N N 271 LYS HB3 H N N 272 LYS HG2 H N N 273 LYS HG3 H N N 274 LYS HD2 H N N 275 LYS HD3 H N N 276 LYS HE2 H N N 277 LYS HE3 H N N 278 LYS HZ1 H N N 279 LYS HZ2 H N N 280 LYS HZ3 H N N 281 LYS HXT H N N 282 MET N N N N 283 MET CA C N S 284 MET C C N N 285 MET O O N N 286 MET CB C N N 287 MET CG C N N 288 MET SD S N N 289 MET CE C N N 290 MET OXT O N N 291 MET H H N N 292 MET H2 H N N 293 MET HA H N N 294 MET HB2 H N N 295 MET HB3 H N N 296 MET HG2 H N N 297 MET HG3 H N N 298 MET HE1 H N N 299 MET HE2 H N N 300 MET HE3 H N N 301 MET HXT H N N 302 MN MN MN N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 H6G C26 C27 doub Y N 129 H6G C26 C25 sing Y N 130 H6G C27 N28 sing Y N 131 H6G C25 C24 doub Y N 132 H6G N28 C23 doub Y N 133 H6G C24 C23 sing Y N 134 H6G C23 C22 sing N N 135 H6G C17 C16 doub N N 136 H6G C22 N29 doub Y N 137 H6G C22 N21 sing Y N 138 H6G C16 C15 sing N N 139 H6G N29 C07 sing Y N 140 H6G N21 C09 doub Y N 141 H6G C19 C20 sing N N 142 H6G C19 N14 sing N N 143 H6G C07 N06 sing N N 144 H6G C07 C08 doub Y N 145 H6G C15 N14 sing N N 146 H6G C15 O18 doub N N 147 H6G C09 C08 sing Y N 148 H6G C09 N10 sing N N 149 H6G C20 N10 sing N N 150 H6G N06 C05 sing N N 151 H6G N14 C13 sing N N 152 H6G N10 C11 sing N N 153 H6G C05 C04 sing N N 154 H6G C13 C12 sing N N 155 H6G C11 C12 sing N N 156 H6G C04 C02 sing N N 157 H6G C02 O01 doub N N 158 H6G C02 O03 sing N N 159 H6G C13 H1 sing N N 160 H6G C13 H2 sing N N 161 H6G C17 H3 sing N N 162 H6G C17 H4 sing N N 163 H6G C20 H5 sing N N 164 H6G C20 H6 sing N N 165 H6G C24 H7 sing N N 166 H6G C26 H8 sing N N 167 H6G C04 H9 sing N N 168 H6G C04 H10 sing N N 169 H6G C05 H11 sing N N 170 H6G C05 H12 sing N N 171 H6G C08 H13 sing N N 172 H6G C11 H14 sing N N 173 H6G C11 H15 sing N N 174 H6G C12 H16 sing N N 175 H6G C12 H17 sing N N 176 H6G C16 H18 sing N N 177 H6G C19 H19 sing N N 178 H6G C19 H20 sing N N 179 H6G C25 H21 sing N N 180 H6G C27 H22 sing N N 181 H6G N06 H23 sing N N 182 H6G O03 H24 sing N N 183 HIS N CA sing N N 184 HIS N H sing N N 185 HIS N H2 sing N N 186 HIS CA C sing N N 187 HIS CA CB sing N N 188 HIS CA HA sing N N 189 HIS C O doub N N 190 HIS C OXT sing N N 191 HIS CB CG sing N N 192 HIS CB HB2 sing N N 193 HIS CB HB3 sing N N 194 HIS CG ND1 sing Y N 195 HIS CG CD2 doub Y N 196 HIS ND1 CE1 doub Y N 197 HIS ND1 HD1 sing N N 198 HIS CD2 NE2 sing Y N 199 HIS CD2 HD2 sing N N 200 HIS CE1 NE2 sing Y N 201 HIS CE1 HE1 sing N N 202 HIS NE2 HE2 sing N N 203 HIS OXT HXT sing N N 204 HOH O H1 sing N N 205 HOH O H2 sing N N 206 ILE N CA sing N N 207 ILE N H sing N N 208 ILE N H2 sing N N 209 ILE CA C sing N N 210 ILE CA CB sing N N 211 ILE CA HA sing N N 212 ILE C O doub N N 213 ILE C OXT sing N N 214 ILE CB CG1 sing N N 215 ILE CB CG2 sing N N 216 ILE CB HB sing N N 217 ILE CG1 CD1 sing N N 218 ILE CG1 HG12 sing N N 219 ILE CG1 HG13 sing N N 220 ILE CG2 HG21 sing N N 221 ILE CG2 HG22 sing N N 222 ILE CG2 HG23 sing N N 223 ILE CD1 HD11 sing N N 224 ILE CD1 HD12 sing N N 225 ILE CD1 HD13 sing N N 226 ILE OXT HXT sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PHE N CA sing N N 292 PHE N H sing N N 293 PHE N H2 sing N N 294 PHE CA C sing N N 295 PHE CA CB sing N N 296 PHE CA HA sing N N 297 PHE C O doub N N 298 PHE C OXT sing N N 299 PHE CB CG sing N N 300 PHE CB HB2 sing N N 301 PHE CB HB3 sing N N 302 PHE CG CD1 doub Y N 303 PHE CG CD2 sing Y N 304 PHE CD1 CE1 sing Y N 305 PHE CD1 HD1 sing N N 306 PHE CD2 CE2 doub Y N 307 PHE CD2 HD2 sing N N 308 PHE CE1 CZ doub Y N 309 PHE CE1 HE1 sing N N 310 PHE CE2 CZ sing Y N 311 PHE CE2 HE2 sing N N 312 PHE CZ HZ sing N N 313 PHE OXT HXT sing N N 314 PRO N CA sing N N 315 PRO N CD sing N N 316 PRO N H sing N N 317 PRO CA C sing N N 318 PRO CA CB sing N N 319 PRO CA HA sing N N 320 PRO C O doub N N 321 PRO C OXT sing N N 322 PRO CB CG sing N N 323 PRO CB HB2 sing N N 324 PRO CB HB3 sing N N 325 PRO CG CD sing N N 326 PRO CG HG2 sing N N 327 PRO CG HG3 sing N N 328 PRO CD HD2 sing N N 329 PRO CD HD3 sing N N 330 PRO OXT HXT sing N N 331 SER N CA sing N N 332 SER N H sing N N 333 SER N H2 sing N N 334 SER CA C sing N N 335 SER CA CB sing N N 336 SER CA HA sing N N 337 SER C O doub N N 338 SER C OXT sing N N 339 SER CB OG sing N N 340 SER CB HB2 sing N N 341 SER CB HB3 sing N N 342 SER OG HG sing N N 343 SER OXT HXT sing N N 344 THR N CA sing N N 345 THR N H sing N N 346 THR N H2 sing N N 347 THR CA C sing N N 348 THR CA CB sing N N 349 THR CA HA sing N N 350 THR C O doub N N 351 THR C OXT sing N N 352 THR CB OG1 sing N N 353 THR CB CG2 sing N N 354 THR CB HB sing N N 355 THR OG1 HG1 sing N N 356 THR CG2 HG21 sing N N 357 THR CG2 HG22 sing N N 358 THR CG2 HG23 sing N N 359 THR OXT HXT sing N N 360 TRP N CA sing N N 361 TRP N H sing N N 362 TRP N H2 sing N N 363 TRP CA C sing N N 364 TRP CA CB sing N N 365 TRP CA HA sing N N 366 TRP C O doub N N 367 TRP C OXT sing N N 368 TRP CB CG sing N N 369 TRP CB HB2 sing N N 370 TRP CB HB3 sing N N 371 TRP CG CD1 doub Y N 372 TRP CG CD2 sing Y N 373 TRP CD1 NE1 sing Y N 374 TRP CD1 HD1 sing N N 375 TRP CD2 CE2 doub Y N 376 TRP CD2 CE3 sing Y N 377 TRP NE1 CE2 sing Y N 378 TRP NE1 HE1 sing N N 379 TRP CE2 CZ2 sing Y N 380 TRP CE3 CZ3 doub Y N 381 TRP CE3 HE3 sing N N 382 TRP CZ2 CH2 doub Y N 383 TRP CZ2 HZ2 sing N N 384 TRP CZ3 CH2 sing Y N 385 TRP CZ3 HZ3 sing N N 386 TRP CH2 HH2 sing N N 387 TRP OXT HXT sing N N 388 TYR N CA sing N N 389 TYR N H sing N N 390 TYR N H2 sing N N 391 TYR CA C sing N N 392 TYR CA CB sing N N 393 TYR CA HA sing N N 394 TYR C O doub N N 395 TYR C OXT sing N N 396 TYR CB CG sing N N 397 TYR CB HB2 sing N N 398 TYR CB HB3 sing N N 399 TYR CG CD1 doub Y N 400 TYR CG CD2 sing Y N 401 TYR CD1 CE1 sing Y N 402 TYR CD1 HD1 sing N N 403 TYR CD2 CE2 doub Y N 404 TYR CD2 HD2 sing N N 405 TYR CE1 CZ doub Y N 406 TYR CE1 HE1 sing N N 407 TYR CE2 CZ sing Y N 408 TYR CE2 HE2 sing N N 409 TYR CZ OH sing N N 410 TYR OH HH sing N N 411 TYR OXT HXT sing N N 412 VAL N CA sing N N 413 VAL N H sing N N 414 VAL N H2 sing N N 415 VAL CA C sing N N 416 VAL CA CB sing N N 417 VAL CA HA sing N N 418 VAL C O doub N N 419 VAL C OXT sing N N 420 VAL CB CG1 sing N N 421 VAL CB CG2 sing N N 422 VAL CB HB sing N N 423 VAL CG1 HG11 sing N N 424 VAL CG1 HG12 sing N N 425 VAL CG1 HG13 sing N N 426 VAL CG2 HG21 sing N N 427 VAL CG2 HG22 sing N N 428 VAL CG2 HG23 sing N N 429 VAL OXT HXT sing N N 430 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM049245-23 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id H6G _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id H6G _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-[6-(4-acryloyl-1,4-diazepan-1-yl)-2-(pyridin-2-yl)pyrimidin-4-yl]-beta-alanine' H6G 3 'MANGANESE (II) ION' MN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5IVB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #