data_6E25 # _entry.id 6E25 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6E25 pdb_00006e25 10.2210/pdb6e25/pdb WWPDB D_1000233373 ? ? BMRB 30491 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of the CARD9 CARD bound to zinc' _pdbx_database_related.db_id 30491 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6E25 _pdbx_database_status.recvd_initial_deposition_date 2018-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Holliday, M.J.' 1 ? 'Dueber, E.C.' 2 ? 'Fairbrother, W.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 16803 _citation.page_last 16817 _citation.title 'Picomolar zinc binding modulates formation of Bcl10-nucleating assemblies of the caspase recruitment domain (CARD) of CARD9.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.004821 _citation.pdbx_database_id_PubMed 30206119 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Holliday, M.J.' 1 0000-0002-1112-9892 primary 'Ferrao, R.' 2 ? primary 'de Leon Boenig, G.' 3 ? primary 'Estevez, A.' 4 ? primary 'Helgason, E.' 5 ? primary 'Rohou, A.' 6 0000-0002-3343-9621 primary 'Dueber, E.C.' 7 ? primary 'Fairbrother, W.J.' 8 0000-0003-0480-5124 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Caspase recruitment domain-containing protein 9' 11264.877 1 ? ? 'CARD domain residues 1-97' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hCARD9 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFL ESLELYYPQLYKKVTGK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFL ESLELYYPQLYKKVTGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 TYR n 1 5 GLU n 1 6 ASN n 1 7 ASP n 1 8 ASP n 1 9 GLU n 1 10 CYS n 1 11 TRP n 1 12 SER n 1 13 VAL n 1 14 LEU n 1 15 GLU n 1 16 GLY n 1 17 PHE n 1 18 ARG n 1 19 VAL n 1 20 THR n 1 21 LEU n 1 22 THR n 1 23 SER n 1 24 VAL n 1 25 ILE n 1 26 ASP n 1 27 PRO n 1 28 SER n 1 29 ARG n 1 30 ILE n 1 31 THR n 1 32 PRO n 1 33 TYR n 1 34 LEU n 1 35 ARG n 1 36 GLN n 1 37 CYS n 1 38 LYS n 1 39 VAL n 1 40 LEU n 1 41 ASN n 1 42 PRO n 1 43 ASP n 1 44 ASP n 1 45 GLU n 1 46 GLU n 1 47 GLN n 1 48 VAL n 1 49 LEU n 1 50 SER n 1 51 ASP n 1 52 PRO n 1 53 ASN n 1 54 LEU n 1 55 VAL n 1 56 ILE n 1 57 ARG n 1 58 LYS n 1 59 ARG n 1 60 LYS n 1 61 VAL n 1 62 GLY n 1 63 VAL n 1 64 LEU n 1 65 LEU n 1 66 ASP n 1 67 ILE n 1 68 LEU n 1 69 GLN n 1 70 ARG n 1 71 THR n 1 72 GLY n 1 73 HIS n 1 74 LYS n 1 75 GLY n 1 76 TYR n 1 77 VAL n 1 78 ALA n 1 79 PHE n 1 80 LEU n 1 81 GLU n 1 82 SER n 1 83 LEU n 1 84 GLU n 1 85 LEU n 1 86 TYR n 1 87 TYR n 1 88 PRO n 1 89 GLN n 1 90 LEU n 1 91 TYR n 1 92 LYS n 1 93 LYS n 1 94 VAL n 1 95 THR n 1 96 GLY n 1 97 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 97 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CARD9 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CARD9_HUMAN _struct_ref.pdbx_db_accession Q9H257 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFL ESLELYYPQLYKKVTGK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6E25 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H257 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 13 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D H(CCO)NH' 1 isotropic 12 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 9 1 3 '3D 1H-13C NOESY aliphatic' 1 isotropic 8 1 3 '3D 1H-13C NOESY aromatic' 1 isotropic 6 1 2 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 350 _pdbx_nmr_exptl_sample_conditions.details '50 mM HEPES, 300 mM NaCl, 0.5 mM TCEP, pH 7.0' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label 'Condition 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C15N_sample solution ? 3 '0.40 mM [U-13C; U-15N] CARD9 CARD, 0.46 mM zinc, 100% D2O' '100% D2O' 13C15N_D2O_sample solution ? 2 '0.40 mM [U-10% 13C; U-100% 15N] CARD9 CARD, 0.46 mM zinc, 50% H2O/50% D2O' '50% H2O/50% D2O' '[10%]13C[U]15N_sample' solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 6E25 'simulated annealing' ? 2 6E25 'simulated annealing' ? 1 # _pdbx_nmr_ensemble.entry_id 6E25 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6E25 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.2 'Brunger A. T. et.al.' 2 refinement CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Analysis 2.4.2 CCPN 4 'peak picking' Analysis 2.4.2 CCPN 5 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6E25 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6E25 _struct.title 'NMR solution structure of the CARD9 CARD bound to zinc' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6E25 _struct_keywords.text 'CARD, innate immunity, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 7 ? GLY A 16 ? ASP A 7 GLY A 16 1 ? 10 HELX_P HELX_P2 AA2 PHE A 17 ? ILE A 25 ? PHE A 17 ILE A 25 1 ? 9 HELX_P HELX_P3 AA3 ILE A 30 ? CYS A 37 ? ILE A 30 CYS A 37 1 ? 8 HELX_P HELX_P4 AA4 ASN A 41 ? LEU A 49 ? ASN A 41 LEU A 49 1 ? 9 HELX_P HELX_P5 AA5 ILE A 56 ? GLN A 69 ? ILE A 56 GLN A 69 1 ? 14 HELX_P HELX_P6 AA6 GLY A 72 ? TYR A 87 ? GLY A 72 TYR A 87 1 ? 16 HELX_P HELX_P7 AA7 TYR A 87 ? GLY A 96 ? TYR A 87 GLY A 96 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 7 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 7 A ZN 101 1_555 ? ? ? ? ? ? ? 1.784 ? ? metalc2 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 101 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc3 metalc ? ? A HIS 73 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 73 A ZN 101 1_555 ? ? ? ? ? ? ? 1.886 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASP A 7 ? ASP A 7 . ? 1_555 ? 2 AC1 3 CYS A 10 ? CYS A 10 . ? 1_555 ? 3 AC1 3 HIS A 73 ? HIS A 73 . ? 1_555 ? # _atom_sites.entry_id 6E25 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN2 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -35 ? 1 'SSA (A^2)' 6210 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 7 ? A ASP 7 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 10 ? A CYS 10 ? 1_555 111.2 ? 2 OD2 ? A ASP 7 ? A ASP 7 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 73 ? A HIS 73 ? 1_555 110.7 ? 3 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 73 ? A HIS 73 ? 1_555 109.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-26 2 'Structure model' 1 1 2018-11-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'CARD9 CARD' 0.40 ? mM '[U-13C; U-15N]' 1 zinc 0.46 ? mM none 3 'CARD9 CARD' 0.40 ? mM '[U-13C; U-15N]' 3 zinc 0.46 ? mM none 2 'CARD9 CARD' 0.40 ? mM '[U-10% 13C; U-100% 15N]' 2 zinc 0.46 ? mM none # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 ASN A 6 ? ? -83.80 34.18 2 3 ASP A 3 ? ? -68.59 -71.23 3 4 ASN A 6 ? ? -64.11 96.06 4 4 ASP A 7 ? ? -66.65 4.66 5 5 TYR A 87 ? ? -119.83 78.47 6 6 ASP A 3 ? ? -69.76 92.39 7 7 ASP A 7 ? ? -154.74 17.53 8 8 SER A 2 ? ? -91.62 54.74 9 8 ASP A 3 ? ? -125.55 -73.52 10 10 ASP A 7 ? ? -88.93 30.71 11 10 TYR A 87 ? ? -119.71 73.97 12 11 GLU A 5 ? ? -66.58 92.90 13 13 SER A 2 ? ? -73.72 -159.43 14 13 ASP A 3 ? ? -69.37 89.84 15 13 TYR A 4 ? ? -106.47 62.16 16 14 SER A 2 ? ? 67.26 -8.52 17 14 ASN A 6 ? ? -83.69 49.79 18 15 SER A 2 ? ? -152.32 -75.92 19 15 TYR A 4 ? ? -147.45 -43.36 20 15 GLU A 5 ? ? -58.93 105.99 21 15 ASN A 6 ? ? -126.69 -162.18 22 16 TYR A 4 ? ? -68.30 92.10 23 16 ASN A 6 ? ? -61.08 97.03 24 16 ASP A 7 ? ? -152.91 22.21 25 17 TYR A 4 ? ? -141.18 -19.75 26 17 ASP A 7 ? ? -143.06 29.02 27 17 HIS A 73 ? ? 179.30 -26.99 28 18 SER A 2 ? ? 175.07 -179.67 29 19 ASP A 3 ? ? -66.41 89.82 30 19 GLU A 5 ? ? -68.13 86.86 31 19 ASN A 6 ? ? -140.95 -62.15 32 19 ASP A 7 ? ? -162.57 7.87 33 19 HIS A 73 ? ? 74.84 -17.92 34 20 HIS A 73 ? ? -141.49 -25.05 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #