data_6EK1 # _entry.id 6EK1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.307 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6EK1 WWPDB D_1200006723 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EK1 _pdbx_database_status.recvd_initial_deposition_date 2017-09-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tamulaitiene, G.' 1 ? 'Manakova, E.' 2 ? 'Jovaisaite, V.' 3 ? 'Grazulis, S.' 4 ? 'Siksnys, V.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 47 _citation.language ? _citation.page_first 997 _citation.page_last 1010 _citation.title 'Unique mechanism of target recognition by PfoI restriction endonuclease of the CCGG-family.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gky1137 _citation.pdbx_database_id_PubMed 30445642 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tamulaitiene, G.' 1 ? primary 'Manakova, E.' 2 ? primary 'Jovaisaite, V.' 3 ? primary 'Tamulaitis, G.' 4 ? primary 'Grazulis, S.' 5 ? primary 'Bochtler, M.' 6 ? primary 'Siksnys, V.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6EK1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.067 _cell.length_a_esd ? _cell.length_b 48.067 _cell.length_b_esd ? _cell.length_c 266.693 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EK1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'restriction endonuclease PfoI' 35194.527 1 3.1.21.4 ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQKYRLYEKDGSPVQDFNRFVKGWLDIEFGLKEHQPPKVFDTIRDKYNEAIEAVVLSGVAPRTAHKAALSTLTELLFGHD LAKELSARLDIQPIGVGGFRSAHSQAFAKNVGENFVNLMVYALACILKDNDDVLVDKGLPPHLKKALTLSRECRIKDTLR EIKIPIEGDLCVFSRSNHCNAIVISAKTRLKEVFHIGTMWALFSDVAKDEYCLNKWGLKVESSESLKDTMYVFATADMIN KDGARSQGCDVERETPRNLIAMDASFFDYVFVSKMGIGHVSSDLSLKYGRESLFHELGCIIDMIEQKFDILL ; _entity_poly.pdbx_seq_one_letter_code_can ;MQKYRLYEKDGSPVQDFNRFVKGWLDIEFGLKEHQPPKVFDTIRDKYNEAIEAVVLSGVAPRTAHKAALSTLTELLFGHD LAKELSARLDIQPIGVGGFRSAHSQAFAKNVGENFVNLMVYALACILKDNDDVLVDKGLPPHLKKALTLSRECRIKDTLR EIKIPIEGDLCVFSRSNHCNAIVISAKTRLKEVFHIGTMWALFSDVAKDEYCLNKWGLKVESSESLKDTMYVFATADMIN KDGARSQGCDVERETPRNLIAMDASFFDYVFVSKMGIGHVSSDLSLKYGRESLFHELGCIIDMIEQKFDILL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 LYS n 1 4 TYR n 1 5 ARG n 1 6 LEU n 1 7 TYR n 1 8 GLU n 1 9 LYS n 1 10 ASP n 1 11 GLY n 1 12 SER n 1 13 PRO n 1 14 VAL n 1 15 GLN n 1 16 ASP n 1 17 PHE n 1 18 ASN n 1 19 ARG n 1 20 PHE n 1 21 VAL n 1 22 LYS n 1 23 GLY n 1 24 TRP n 1 25 LEU n 1 26 ASP n 1 27 ILE n 1 28 GLU n 1 29 PHE n 1 30 GLY n 1 31 LEU n 1 32 LYS n 1 33 GLU n 1 34 HIS n 1 35 GLN n 1 36 PRO n 1 37 PRO n 1 38 LYS n 1 39 VAL n 1 40 PHE n 1 41 ASP n 1 42 THR n 1 43 ILE n 1 44 ARG n 1 45 ASP n 1 46 LYS n 1 47 TYR n 1 48 ASN n 1 49 GLU n 1 50 ALA n 1 51 ILE n 1 52 GLU n 1 53 ALA n 1 54 VAL n 1 55 VAL n 1 56 LEU n 1 57 SER n 1 58 GLY n 1 59 VAL n 1 60 ALA n 1 61 PRO n 1 62 ARG n 1 63 THR n 1 64 ALA n 1 65 HIS n 1 66 LYS n 1 67 ALA n 1 68 ALA n 1 69 LEU n 1 70 SER n 1 71 THR n 1 72 LEU n 1 73 THR n 1 74 GLU n 1 75 LEU n 1 76 LEU n 1 77 PHE n 1 78 GLY n 1 79 HIS n 1 80 ASP n 1 81 LEU n 1 82 ALA n 1 83 LYS n 1 84 GLU n 1 85 LEU n 1 86 SER n 1 87 ALA n 1 88 ARG n 1 89 LEU n 1 90 ASP n 1 91 ILE n 1 92 GLN n 1 93 PRO n 1 94 ILE n 1 95 GLY n 1 96 VAL n 1 97 GLY n 1 98 GLY n 1 99 PHE n 1 100 ARG n 1 101 SER n 1 102 ALA n 1 103 HIS n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 PHE n 1 108 ALA n 1 109 LYS n 1 110 ASN n 1 111 VAL n 1 112 GLY n 1 113 GLU n 1 114 ASN n 1 115 PHE n 1 116 VAL n 1 117 ASN n 1 118 LEU n 1 119 MET n 1 120 VAL n 1 121 TYR n 1 122 ALA n 1 123 LEU n 1 124 ALA n 1 125 CYS n 1 126 ILE n 1 127 LEU n 1 128 LYS n 1 129 ASP n 1 130 ASN n 1 131 ASP n 1 132 ASP n 1 133 VAL n 1 134 LEU n 1 135 VAL n 1 136 ASP n 1 137 LYS n 1 138 GLY n 1 139 LEU n 1 140 PRO n 1 141 PRO n 1 142 HIS n 1 143 LEU n 1 144 LYS n 1 145 LYS n 1 146 ALA n 1 147 LEU n 1 148 THR n 1 149 LEU n 1 150 SER n 1 151 ARG n 1 152 GLU n 1 153 CYS n 1 154 ARG n 1 155 ILE n 1 156 LYS n 1 157 ASP n 1 158 THR n 1 159 LEU n 1 160 ARG n 1 161 GLU n 1 162 ILE n 1 163 LYS n 1 164 ILE n 1 165 PRO n 1 166 ILE n 1 167 GLU n 1 168 GLY n 1 169 ASP n 1 170 LEU n 1 171 CYS n 1 172 VAL n 1 173 PHE n 1 174 SER n 1 175 ARG n 1 176 SER n 1 177 ASN n 1 178 HIS n 1 179 CYS n 1 180 ASN n 1 181 ALA n 1 182 ILE n 1 183 VAL n 1 184 ILE n 1 185 SER n 1 186 ALA n 1 187 LYS n 1 188 THR n 1 189 ARG n 1 190 LEU n 1 191 LYS n 1 192 GLU n 1 193 VAL n 1 194 PHE n 1 195 HIS n 1 196 ILE n 1 197 GLY n 1 198 THR n 1 199 MET n 1 200 TRP n 1 201 ALA n 1 202 LEU n 1 203 PHE n 1 204 SER n 1 205 ASP n 1 206 VAL n 1 207 ALA n 1 208 LYS n 1 209 ASP n 1 210 GLU n 1 211 TYR n 1 212 CYS n 1 213 LEU n 1 214 ASN n 1 215 LYS n 1 216 TRP n 1 217 GLY n 1 218 LEU n 1 219 LYS n 1 220 VAL n 1 221 GLU n 1 222 SER n 1 223 SER n 1 224 GLU n 1 225 SER n 1 226 LEU n 1 227 LYS n 1 228 ASP n 1 229 THR n 1 230 MET n 1 231 TYR n 1 232 VAL n 1 233 PHE n 1 234 ALA n 1 235 THR n 1 236 ALA n 1 237 ASP n 1 238 MET n 1 239 ILE n 1 240 ASN n 1 241 LYS n 1 242 ASP n 1 243 GLY n 1 244 ALA n 1 245 ARG n 1 246 SER n 1 247 GLN n 1 248 GLY n 1 249 CYS n 1 250 ASP n 1 251 VAL n 1 252 GLU n 1 253 ARG n 1 254 GLU n 1 255 THR n 1 256 PRO n 1 257 ARG n 1 258 ASN n 1 259 LEU n 1 260 ILE n 1 261 ALA n 1 262 MET n 1 263 ASP n 1 264 ALA n 1 265 SER n 1 266 PHE n 1 267 PHE n 1 268 ASP n 1 269 TYR n 1 270 VAL n 1 271 PHE n 1 272 VAL n 1 273 SER n 1 274 LYS n 1 275 MET n 1 276 GLY n 1 277 ILE n 1 278 GLY n 1 279 HIS n 1 280 VAL n 1 281 SER n 1 282 SER n 1 283 ASP n 1 284 LEU n 1 285 SER n 1 286 LEU n 1 287 LYS n 1 288 TYR n 1 289 GLY n 1 290 ARG n 1 291 GLU n 1 292 SER n 1 293 LEU n 1 294 PHE n 1 295 HIS n 1 296 GLU n 1 297 LEU n 1 298 GLY n 1 299 CYS n 1 300 ILE n 1 301 ILE n 1 302 ASP n 1 303 MET n 1 304 ILE n 1 305 GLU n 1 306 GLN n 1 307 LYS n 1 308 PHE n 1 309 ASP n 1 310 ILE n 1 311 LEU n 1 312 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 312 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'biovar 126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 294 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BH10B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 316385 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAD24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6EK1 _struct_ref.pdbx_db_accession 6EK1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EK1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 312 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6EK1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 312 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 312 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EK1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.84 _exptl_crystal.description 'Bipyramidal crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;6.8 mg/ml of PfoI in complex with DNA oligoduplex was mixed with reservoir solution 1:1, microseeding was used. NaHepes 0.1M, magnesium formate 0.2M, 18-20% PEG3350 ; _exptl_crystal_grow.pdbx_pH_range 7-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'OSMIC CONFOCAL MIRRORS' _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-05-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 49.262 _reflns.entry_id 6EK1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 45.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17795 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.3 _reflns.pdbx_Rmerge_I_obs 0.112 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.112 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.074 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1470 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.44 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.2 _reflns_shell.pdbx_Rsym_value 0.44 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EK1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.601 _refine.ls_d_res_low 45.219 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17795 _refine.ls_number_reflns_R_free 1710 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.94 _refine.ls_percent_reflns_R_free 9.61 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2233 _refine.ls_R_factor_R_free 0.2740 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2181 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.20 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.41 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2395 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2405 _refine_hist.d_res_high 2.601 _refine_hist.d_res_low 45.219 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2457 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.574 ? 3318 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.425 ? 898 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.022 ? 374 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 426 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6011 2.6776 . . 142 1411 99.00 . . . 0.4140 . 0.2931 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6776 2.7640 . . 164 1331 99.00 . . . 0.3183 . 0.2813 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7640 2.8628 . . 165 1356 99.00 . . . 0.3353 . 0.2657 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8628 2.9774 . . 138 1406 100.00 . . . 0.3395 . 0.2452 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9774 3.1129 . . 124 1351 99.00 . . . 0.2721 . 0.2434 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1129 3.2769 . . 144 1379 99.00 . . . 0.2874 . 0.2512 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2769 3.4822 . . 143 1351 97.00 . . . 0.2985 . 0.2392 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4822 3.7509 . . 147 1308 95.00 . . . 0.2885 . 0.2267 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7509 4.1281 . . 146 1258 92.00 . . . 0.2420 . 0.2133 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1281 4.7249 . . 149 1292 94.00 . . . 0.2129 . 0.1720 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7249 5.9508 . . 120 1310 93.00 . . . 0.2504 . 0.1888 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.9508 45.2257 . . 128 1332 96.00 . . . 0.2488 . 0.1769 . . . . . . . . . . # _struct.entry_id 6EK1 _struct.title 'Crystal structure of Type IIP restriction endonuclease PfoI' _struct.pdbx_descriptor 'restriction endonuclease PfoI (E.C.3.1.21.4)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EK1 _struct_keywords.text 'Restriction endonuclease, PD-(D/E)xK nuclease, Hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? ASP A 26 ? ASP A 16 ASP A 26 1 ? 11 HELX_P HELX_P2 AA2 PHE A 40 ? LEU A 56 ? PHE A 40 LEU A 56 1 ? 17 HELX_P HELX_P3 AA3 ALA A 60 ? SER A 70 ? ALA A 60 SER A 70 1 ? 11 HELX_P HELX_P4 AA4 THR A 71 ? PHE A 77 ? THR A 71 PHE A 77 1 ? 7 HELX_P HELX_P5 AA5 ASP A 80 ? ASP A 90 ? ASP A 80 ASP A 90 1 ? 11 HELX_P HELX_P6 AA6 PHE A 99 ? HIS A 103 ? PHE A 99 HIS A 103 5 ? 5 HELX_P HELX_P7 AA7 SER A 104 ? LYS A 109 ? SER A 104 LYS A 109 1 ? 6 HELX_P HELX_P8 AA8 ASN A 110 ? LEU A 127 ? ASN A 110 LEU A 127 1 ? 18 HELX_P HELX_P9 AA9 PRO A 140 ? LEU A 147 ? PRO A 140 LEU A 147 1 ? 8 HELX_P HELX_P10 AB1 VAL A 193 ? ALA A 207 ? VAL A 193 ALA A 207 1 ? 15 HELX_P HELX_P11 AB2 ASP A 209 ? TRP A 216 ? ASP A 209 TRP A 216 1 ? 8 HELX_P HELX_P12 AB3 GLU A 224 ? THR A 229 ? GLU A 224 THR A 229 5 ? 6 HELX_P HELX_P13 AB4 ARG A 257 ? PHE A 266 ? ARG A 257 PHE A 266 1 ? 10 HELX_P HELX_P14 AB5 GLY A 298 ? ASP A 309 ? GLY A 298 ASP A 309 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 3 ? TYR A 4 ? LYS A 3 TYR A 4 AA1 2 GLY A 30 ? LEU A 31 ? GLY A 30 LEU A 31 AA2 1 VAL A 133 ? LYS A 137 ? VAL A 133 LYS A 137 AA2 2 LEU A 170 ? SER A 174 ? LEU A 170 SER A 174 AA2 3 ALA A 181 ? LYS A 187 ? ALA A 181 LYS A 187 AA2 4 MET A 230 ? THR A 235 ? MET A 230 THR A 235 AA2 5 TYR A 269 ? VAL A 272 ? TYR A 269 VAL A 272 AA2 6 HIS A 295 ? GLU A 296 ? HIS A 295 GLU A 296 AA3 1 THR A 158 ? PRO A 165 ? THR A 158 PRO A 165 AA3 2 THR A 148 ? ILE A 155 ? THR A 148 ILE A 155 AA3 3 LEU A 218 ? LYS A 219 ? LEU A 218 LYS A 219 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 4 ? N TYR A 4 O GLY A 30 ? O GLY A 30 AA2 1 2 N LEU A 134 ? N LEU A 134 O PHE A 173 ? O PHE A 173 AA2 2 3 N LEU A 170 ? N LEU A 170 O ILE A 184 ? O ILE A 184 AA2 3 4 N SER A 185 ? N SER A 185 O ALA A 234 ? O ALA A 234 AA2 4 5 N PHE A 233 ? N PHE A 233 O PHE A 271 ? O PHE A 271 AA2 5 6 N VAL A 270 ? N VAL A 270 O HIS A 295 ? O HIS A 295 AA3 1 2 O ILE A 162 ? O ILE A 162 N ARG A 151 ? N ARG A 151 AA3 2 3 N SER A 150 ? N SER A 150 O LYS A 219 ? O LYS A 219 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EDO _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue EDO A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ALA A 201 ? ALA A 201 . ? 1_555 ? 2 AC1 6 SER A 204 ? SER A 204 . ? 1_555 ? 3 AC1 6 ASP A 205 ? ASP A 205 . ? 1_555 ? 4 AC1 6 LYS A 208 ? LYS A 208 . ? 1_555 ? 5 AC1 6 TYR A 231 ? TYR A 231 . ? 1_555 ? 6 AC1 6 ASP A 268 ? ASP A 268 . ? 1_555 ? # _atom_sites.entry_id 6EK1 _atom_sites.fract_transf_matrix[1][1] 0.020804 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020804 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003750 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LYS 109 109 109 LYS ALA A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 CYS 125 125 125 CYS CYS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 MET 199 199 199 MET MET A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 CYS 212 212 212 CYS CYS A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 TRP 216 216 216 TRP TRP A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 MET 238 238 238 MET MET A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 ASN 240 240 ? ? ? A . n A 1 241 LYS 241 241 ? ? ? A . n A 1 242 ASP 242 242 ? ? ? A . n A 1 243 GLY 243 243 ? ? ? A . n A 1 244 ALA 244 244 ? ? ? A . n A 1 245 ARG 245 245 ? ? ? A . n A 1 246 SER 246 246 246 SER ALA A . n A 1 247 GLN 247 247 247 GLN ALA A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 CYS 249 249 249 CYS CYS A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 SER 265 265 265 SER SER A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 TYR 269 269 269 TYR TYR A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 PHE 271 271 271 PHE PHE A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 MET 275 275 275 MET MET A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 HIS 279 279 279 HIS HIS A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 TYR 288 288 288 TYR TYR A . n A 1 289 GLY 289 289 289 GLY GLY A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 SER 292 292 292 SER SER A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 PHE 294 294 294 PHE PHE A . n A 1 295 HIS 295 295 295 HIS HIS A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 CYS 299 299 299 CYS CYS A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 ILE 301 301 301 ILE ILE A . n A 1 302 ASP 302 302 302 ASP ASP A . n A 1 303 MET 303 303 303 MET MET A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 GLN 306 306 306 GLN GLN A . n A 1 307 LYS 307 307 307 LYS LYS A . n A 1 308 PHE 308 308 308 PHE PHE A . n A 1 309 ASP 309 309 309 ASP ASP A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 LEU 312 312 312 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 401 1 EDO EDO A . C 3 HOH 1 501 6 HOH HOH A . C 3 HOH 2 502 7 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 2 HOH HOH A . C 3 HOH 5 505 5 HOH HOH A . C 3 HOH 6 506 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4210 ? 1 MORE -15 ? 1 'SSA (A^2)' 25610 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_465 y-1,x+1,-z 0.0000000000 1.0000000000 0.0000000000 -48.0670000000 1.0000000000 0.0000000000 0.0000000000 48.0670000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-10 2 'Structure model' 1 1 2019-04-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity 4 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_entity.formula_weight' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.3_1479 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 6.2.6 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.2.19 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 9.2.10 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 39 ? ? 38.35 41.11 2 1 LEU A 56 ? ? -69.06 0.37 3 1 THR A 71 ? ? -145.03 14.48 4 1 ILE A 91 ? ? -113.15 -168.42 5 1 PRO A 93 ? ? -50.30 107.20 6 1 LYS A 156 ? ? 55.53 -107.74 7 1 LEU A 190 ? ? -100.04 -63.44 8 1 LYS A 191 ? ? 37.94 -134.12 9 1 SER A 273 ? ? -87.40 38.95 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 1 CG 2 1 Y 1 A MET 1 ? SD ? A MET 1 SD 3 1 Y 1 A MET 1 ? CE ? A MET 1 CE 4 1 Y 1 A LYS 3 ? CD ? A LYS 3 CD 5 1 Y 1 A LYS 3 ? CE ? A LYS 3 CE 6 1 Y 1 A LYS 3 ? NZ ? A LYS 3 NZ 7 1 Y 1 A LYS 38 ? CG ? A LYS 38 CG 8 1 Y 1 A LYS 38 ? CD ? A LYS 38 CD 9 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 10 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 11 1 Y 1 A LYS 83 ? CG ? A LYS 83 CG 12 1 Y 1 A LYS 83 ? CD ? A LYS 83 CD 13 1 Y 1 A LYS 83 ? CE ? A LYS 83 CE 14 1 Y 1 A LYS 83 ? NZ ? A LYS 83 NZ 15 1 Y 1 A LYS 109 ? CG ? A LYS 109 CG 16 1 Y 1 A LYS 109 ? CD ? A LYS 109 CD 17 1 Y 1 A LYS 109 ? CE ? A LYS 109 CE 18 1 Y 1 A LYS 109 ? NZ ? A LYS 109 NZ 19 1 Y 1 A LYS 191 ? CD ? A LYS 191 CD 20 1 Y 1 A LYS 191 ? CE ? A LYS 191 CE 21 1 Y 1 A LYS 191 ? NZ ? A LYS 191 NZ 22 1 Y 1 A ILE 239 ? CG1 ? A ILE 239 CG1 23 1 Y 1 A ILE 239 ? CG2 ? A ILE 239 CG2 24 1 Y 1 A ILE 239 ? CD1 ? A ILE 239 CD1 25 1 Y 1 A SER 246 ? OG ? A SER 246 OG 26 1 Y 1 A GLN 247 ? CG ? A GLN 247 CG 27 1 Y 1 A GLN 247 ? CD ? A GLN 247 CD 28 1 Y 1 A GLN 247 ? OE1 ? A GLN 247 OE1 29 1 Y 1 A GLN 247 ? NE2 ? A GLN 247 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 240 ? A ASN 240 2 1 Y 1 A LYS 241 ? A LYS 241 3 1 Y 1 A ASP 242 ? A ASP 242 4 1 Y 1 A GLY 243 ? A GLY 243 5 1 Y 1 A ALA 244 ? A ALA 244 6 1 Y 1 A ARG 245 ? A ARG 245 # _pdbx_audit_support.funding_organization 'Research Council of Lithuania' _pdbx_audit_support.country Lithuania _pdbx_audit_support.grant_number MIP-41/2013 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Comfirmed by gel filtration, homology' #