data_6ERS # _entry.id 6ERS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ERS pdb_00006ers 10.2210/pdb6ers/pdb WWPDB D_1200006859 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-02-15 _pdbx_database_PDB_obs_spr.pdb_id 6I2C _pdbx_database_PDB_obs_spr.replace_pdb_id 6ERS _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ERS _pdbx_database_status.recvd_initial_deposition_date 2017-10-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, J.M.' 1 0000-0002-4133-7238 'Heine, A.' 2 ? 'Klebe, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of the Protein-Kinase A catalytic subunit from Criteculus Griseus in complex with compounds RKp182 and Fasudil' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mueller, J.M.' 1 ? primary 'Kirschner, R.' 2 ? primary 'Heine, A.' 3 ? primary 'Geyer, A.' 4 ? primary 'Klebe, G.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6ERS _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.338 _cell.length_a_esd ? _cell.length_b 73.088 _cell.length_b_esd ? _cell.length_c 77.183 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ERS _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cAMP-dependent protein kinase catalytic subunit alpha' 41193.746 1 2.7.11.11 ? ? ? 2 polymer syn 'UPF0418 protein FAM164A' 2003.203 1 ? ? ? 'PKI 5-22 with G17RBS mutation' 3 non-polymer syn '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' 291.369 1 ? ? ? ? 4 non-polymer man beta-D-ribopyranose 150.130 1 ? ? ? ? 5 water nat water 18.015 141 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PKA C-alpha' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GHMGNAAAAKKG(SEP)EQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKI LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRF(SEP)EPHARFYAAQ IVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALG VLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAI YQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFTEF ; ;GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQ KVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYL HSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK FKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; A ? 2 'polypeptide(L)' no no TTYADFIASGRTSRRNAI TTYADFIASGRTSRRNAI B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLY n 1 5 ASN n 1 6 ALA n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 LYS n 1 11 LYS n 1 12 GLY n 1 13 SEP n 1 14 GLU n 1 15 GLN n 1 16 GLU n 1 17 SER n 1 18 VAL n 1 19 LYS n 1 20 GLU n 1 21 PHE n 1 22 LEU n 1 23 ALA n 1 24 LYS n 1 25 ALA n 1 26 LYS n 1 27 GLU n 1 28 GLU n 1 29 PHE n 1 30 LEU n 1 31 LYS n 1 32 LYS n 1 33 TRP n 1 34 GLU n 1 35 SER n 1 36 PRO n 1 37 SER n 1 38 GLN n 1 39 ASN n 1 40 THR n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 ASP n 1 45 HIS n 1 46 PHE n 1 47 ASP n 1 48 ARG n 1 49 ILE n 1 50 LYS n 1 51 THR n 1 52 LEU n 1 53 GLY n 1 54 THR n 1 55 GLY n 1 56 SER n 1 57 PHE n 1 58 GLY n 1 59 ARG n 1 60 VAL n 1 61 MET n 1 62 LEU n 1 63 VAL n 1 64 LYS n 1 65 HIS n 1 66 LYS n 1 67 GLU n 1 68 THR n 1 69 GLY n 1 70 ASN n 1 71 HIS n 1 72 TYR n 1 73 ALA n 1 74 MET n 1 75 LYS n 1 76 ILE n 1 77 LEU n 1 78 ASP n 1 79 LYS n 1 80 GLN n 1 81 LYS n 1 82 VAL n 1 83 VAL n 1 84 LYS n 1 85 LEU n 1 86 LYS n 1 87 GLN n 1 88 ILE n 1 89 GLU n 1 90 HIS n 1 91 THR n 1 92 LEU n 1 93 ASN n 1 94 GLU n 1 95 LYS n 1 96 ARG n 1 97 ILE n 1 98 LEU n 1 99 GLN n 1 100 ALA n 1 101 VAL n 1 102 ASN n 1 103 PHE n 1 104 PRO n 1 105 PHE n 1 106 LEU n 1 107 VAL n 1 108 LYS n 1 109 LEU n 1 110 GLU n 1 111 PHE n 1 112 SER n 1 113 PHE n 1 114 LYS n 1 115 ASP n 1 116 ASN n 1 117 SER n 1 118 ASN n 1 119 LEU n 1 120 TYR n 1 121 MET n 1 122 VAL n 1 123 MET n 1 124 GLU n 1 125 TYR n 1 126 VAL n 1 127 PRO n 1 128 GLY n 1 129 GLY n 1 130 GLU n 1 131 MET n 1 132 PHE n 1 133 SER n 1 134 HIS n 1 135 LEU n 1 136 ARG n 1 137 ARG n 1 138 ILE n 1 139 GLY n 1 140 ARG n 1 141 PHE n 1 142 SEP n 1 143 GLU n 1 144 PRO n 1 145 HIS n 1 146 ALA n 1 147 ARG n 1 148 PHE n 1 149 TYR n 1 150 ALA n 1 151 ALA n 1 152 GLN n 1 153 ILE n 1 154 VAL n 1 155 LEU n 1 156 THR n 1 157 PHE n 1 158 GLU n 1 159 TYR n 1 160 LEU n 1 161 HIS n 1 162 SER n 1 163 LEU n 1 164 ASP n 1 165 LEU n 1 166 ILE n 1 167 TYR n 1 168 ARG n 1 169 ASP n 1 170 LEU n 1 171 LYS n 1 172 PRO n 1 173 GLU n 1 174 ASN n 1 175 LEU n 1 176 LEU n 1 177 ILE n 1 178 ASP n 1 179 GLN n 1 180 GLN n 1 181 GLY n 1 182 TYR n 1 183 ILE n 1 184 GLN n 1 185 VAL n 1 186 THR n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 PHE n 1 191 ALA n 1 192 LYS n 1 193 ARG n 1 194 VAL n 1 195 LYS n 1 196 GLY n 1 197 ARG n 1 198 THR n 1 199 TRP n 1 200 TPO n 1 201 LEU n 1 202 CYS n 1 203 GLY n 1 204 THR n 1 205 PRO n 1 206 GLU n 1 207 TYR n 1 208 LEU n 1 209 ALA n 1 210 PRO n 1 211 GLU n 1 212 ILE n 1 213 ILE n 1 214 LEU n 1 215 SER n 1 216 LYS n 1 217 GLY n 1 218 TYR n 1 219 ASN n 1 220 LYS n 1 221 ALA n 1 222 VAL n 1 223 ASP n 1 224 TRP n 1 225 TRP n 1 226 ALA n 1 227 LEU n 1 228 GLY n 1 229 VAL n 1 230 LEU n 1 231 ILE n 1 232 TYR n 1 233 GLU n 1 234 MET n 1 235 ALA n 1 236 ALA n 1 237 GLY n 1 238 TYR n 1 239 PRO n 1 240 PRO n 1 241 PHE n 1 242 PHE n 1 243 ALA n 1 244 ASP n 1 245 GLN n 1 246 PRO n 1 247 ILE n 1 248 GLN n 1 249 ILE n 1 250 TYR n 1 251 GLU n 1 252 LYS n 1 253 ILE n 1 254 VAL n 1 255 SER n 1 256 GLY n 1 257 LYS n 1 258 VAL n 1 259 ARG n 1 260 PHE n 1 261 PRO n 1 262 SER n 1 263 HIS n 1 264 PHE n 1 265 SER n 1 266 SER n 1 267 ASP n 1 268 LEU n 1 269 LYS n 1 270 ASP n 1 271 LEU n 1 272 LEU n 1 273 ARG n 1 274 ASN n 1 275 LEU n 1 276 LEU n 1 277 GLN n 1 278 VAL n 1 279 ASP n 1 280 LEU n 1 281 THR n 1 282 LYS n 1 283 ARG n 1 284 PHE n 1 285 GLY n 1 286 ASN n 1 287 LEU n 1 288 LYS n 1 289 ASN n 1 290 GLY n 1 291 VAL n 1 292 ASN n 1 293 ASP n 1 294 ILE n 1 295 LYS n 1 296 ASN n 1 297 HIS n 1 298 LYS n 1 299 TRP n 1 300 PHE n 1 301 ALA n 1 302 THR n 1 303 THR n 1 304 ASP n 1 305 TRP n 1 306 ILE n 1 307 ALA n 1 308 ILE n 1 309 TYR n 1 310 GLN n 1 311 ARG n 1 312 LYS n 1 313 VAL n 1 314 GLU n 1 315 ALA n 1 316 PRO n 1 317 PHE n 1 318 ILE n 1 319 PRO n 1 320 LYS n 1 321 PHE n 1 322 LYS n 1 323 GLY n 1 324 PRO n 1 325 GLY n 1 326 ASP n 1 327 THR n 1 328 SER n 1 329 ASN n 1 330 PHE n 1 331 ASP n 1 332 ASP n 1 333 TYR n 1 334 GLU n 1 335 GLU n 1 336 GLU n 1 337 GLU n 1 338 ILE n 1 339 ARG n 1 340 VAL n 1 341 SEP n 1 342 ILE n 1 343 ASN n 1 344 GLU n 1 345 LYS n 1 346 CYS n 1 347 GLY n 1 348 LYS n 1 349 GLU n 1 350 PHE n 1 351 THR n 1 352 GLU n 1 353 PHE n 2 1 THR n 2 2 THR n 2 3 TYR n 2 4 ALA n 2 5 ASP n 2 6 PHE n 2 7 ILE n 2 8 ALA n 2 9 SER n 2 10 GLY n 2 11 ARG n 2 12 THR n 2 13 SER n 2 14 ARG n 2 15 ARG n 2 16 ASN n 2 17 ALA n 2 18 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 353 _entity_src_gen.gene_src_common_name 'Chinese hamster' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PRKACA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue Ovary _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10029 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ Ovary _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 18 _pdbx_entity_src_syn.organism_scientific 'Cricetulus griseus' _pdbx_entity_src_syn.organism_common_name 'Chinese hamster' _pdbx_entity_src_syn.ncbi_taxonomy_id 10029 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KAPCA_CRIGR P25321 ? 1 ;MGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; 1 2 UNP G3HK48_CRIGR G3HK48 ? 2 TTYADFIASGRTGRRNAI 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6ERS A 3 ? 353 ? P25321 1 ? 351 ? 0 350 2 2 6ERS B 1 ? 18 ? G3HK48 6 ? 23 ? 11 28 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ERS GLY A 1 ? UNP P25321 ? ? 'expression tag' -2 1 1 6ERS HIS A 2 ? UNP P25321 ? ? 'expression tag' -1 2 2 6ERS SER B 13 ? UNP G3HK48 GLY 18 'engineered mutation' 23 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M77 non-polymer . '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' 'Fasudil; (5-ISOQUINOLINESULFONYL)HOMOPIPERAZINE' 'C14 H17 N3 O2 S' 291.369 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RIP 'D-saccharide, beta linking' . beta-D-ribopyranose 'beta-D-ribose; D-ribose; ribose; RIBOSE(PYRANOSE FORM)' 'C5 H10 O5' 150.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ERS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;100 mM Mes-Bis-Tris, 75 mM lithium chloride, 1 mM DTT, 0.1 mM sodium EDTA, 0.25 mM Mega 8, 0.7 mM peptidic ligand, 5 mM Fasudil, 16% v/v methanol/water in reservoir ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6ERS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.82 _reflns.d_resolution_low 34.126 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35803 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.49 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.082 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.29 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.82 _reflns_shell.d_res_low 1.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.91 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5705 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.51 _reflns_shell.pdbx_Rsym_value 0.507 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.841 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ERS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.82 _refine.ls_d_res_low 34.126 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35796 _refine.ls_number_reflns_R_free 1790 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.77 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1870 _refine.ls_R_factor_R_free 0.2213 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1852 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.85 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2812 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 141 _refine_hist.number_atoms_total 2979 _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 34.126 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2922 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.996 ? 3970 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.767 ? 1718 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.065 ? 427 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 521 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8194 1.8685 . . 136 2571 99.00 . . . 0.2718 . 0.2268 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8685 1.9235 . . 136 2582 100.00 . . . 0.2389 . 0.2123 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9235 1.9856 . . 135 2564 100.00 . . . 0.2934 . 0.2201 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9856 2.0566 . . 136 2582 100.00 . . . 0.2350 . 0.2069 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0566 2.1389 . . 136 2586 100.00 . . . 0.2357 . 0.2058 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1389 2.2362 . . 136 2600 100.00 . . . 0.2259 . 0.1847 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2362 2.3541 . . 137 2595 100.00 . . . 0.2348 . 0.1824 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3541 2.5015 . . 137 2597 100.00 . . . 0.2255 . 0.1796 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5015 2.6946 . . 137 2617 100.00 . . . 0.2228 . 0.1897 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6946 2.9656 . . 139 2639 100.00 . . . 0.2493 . 0.2014 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9656 3.3944 . . 138 2615 100.00 . . . 0.2348 . 0.1974 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3944 4.2753 . . 141 2687 100.00 . . . 0.2076 . 0.1649 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2753 34.1324 . . 146 2771 99.00 . . . 0.1775 . 0.1646 . . . . . . . . . . # _struct.entry_id 6ERS _struct.title 'Crystal Structure of the Protein-Kinase A catalytic subunit from Criteculus Griseus in complex with compounds RKp182 and Fasudil' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ERS _struct_keywords.text 'Complex, peptidic ligand, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 14 ? SER A 35 ? GLU A 11 SER A 32 1 ? 22 HELX_P HELX_P2 AA2 GLN A 42 ? ASP A 44 ? GLN A 39 ASP A 41 5 ? 3 HELX_P HELX_P3 AA3 LYS A 79 ? LEU A 85 ? LYS A 76 LEU A 82 1 ? 7 HELX_P HELX_P4 AA4 GLN A 87 ? VAL A 101 ? GLN A 84 VAL A 98 1 ? 15 HELX_P HELX_P5 AA5 GLU A 130 ? GLY A 139 ? GLU A 127 GLY A 136 1 ? 10 HELX_P HELX_P6 AA6 SEP A 142 ? LEU A 163 ? SEP A 139 LEU A 160 1 ? 22 HELX_P HELX_P7 AA7 LYS A 171 ? GLU A 173 ? LYS A 168 GLU A 170 5 ? 3 HELX_P HELX_P8 AA8 THR A 204 ? LEU A 208 ? THR A 201 LEU A 205 5 ? 5 HELX_P HELX_P9 AA9 ALA A 209 ? LEU A 214 ? ALA A 206 LEU A 211 1 ? 6 HELX_P HELX_P10 AB1 LYS A 220 ? GLY A 237 ? LYS A 217 GLY A 234 1 ? 18 HELX_P HELX_P11 AB2 GLN A 245 ? GLY A 256 ? GLN A 242 GLY A 253 1 ? 12 HELX_P HELX_P12 AB3 SER A 265 ? LEU A 276 ? SER A 262 LEU A 273 1 ? 12 HELX_P HELX_P13 AB4 VAL A 291 ? ASN A 296 ? VAL A 288 ASN A 293 1 ? 6 HELX_P HELX_P14 AB5 HIS A 297 ? ALA A 301 ? HIS A 294 ALA A 298 5 ? 5 HELX_P HELX_P15 AB6 ASP A 304 ? GLN A 310 ? ASP A 301 GLN A 307 1 ? 7 HELX_P HELX_P16 AB7 GLY A 347 ? THR A 351 ? GLY A 344 THR A 348 5 ? 5 HELX_P HELX_P17 AB8 THR B 2 ? SER B 9 ? THR B 12 SER B 19 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 141 C ? ? ? 1_555 A SEP 142 N ? ? A PHE 138 A SEP 139 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A SEP 142 C ? ? ? 1_555 A GLU 143 N ? ? A SEP 139 A GLU 140 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A TRP 199 C ? ? ? 1_555 A TPO 200 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale4 covale both ? A TPO 200 C ? ? ? 1_555 A LEU 201 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale5 covale both ? A VAL 340 C ? ? ? 1_555 A SEP 341 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A SEP 341 C ? ? ? 1_555 A ILE 342 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale7 covale none ? B SER 13 OG ? ? ? 1_555 D RIP . C5 ? ? B SER 23 B RIP 101 1_555 ? ? ? ? ? ? ? 1.376 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 46 ? GLY A 53 ? PHE A 43 GLY A 50 AA1 2 ARG A 59 ? HIS A 65 ? ARG A 56 HIS A 62 AA1 3 HIS A 71 ? ASP A 78 ? HIS A 68 ASP A 75 AA1 4 ASN A 118 ? GLU A 124 ? ASN A 115 GLU A 121 AA1 5 LEU A 109 ? LYS A 114 ? LEU A 106 LYS A 111 AA2 1 LEU A 165 ? ILE A 166 ? LEU A 162 ILE A 163 AA2 2 LYS A 192 ? ARG A 193 ? LYS A 189 ARG A 190 AA3 1 LEU A 175 ? ILE A 177 ? LEU A 172 ILE A 174 AA3 2 ILE A 183 ? VAL A 185 ? ILE A 180 VAL A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 50 ? N LYS A 47 O LEU A 62 ? O LEU A 59 AA1 2 3 N MET A 61 ? N MET A 58 O MET A 74 ? O MET A 71 AA1 3 4 N ALA A 73 ? N ALA A 70 O MET A 123 ? O MET A 120 AA1 4 5 O VAL A 122 ? O VAL A 119 N PHE A 111 ? N PHE A 108 AA2 1 2 N ILE A 166 ? N ILE A 163 O LYS A 192 ? O LYS A 189 AA3 1 2 N LEU A 176 ? N LEU A 173 O GLN A 184 ? O GLN A 181 # _atom_sites.entry_id 6ERS _atom_sites.fract_transf_matrix[1][1] 0.014422 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013682 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012956 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 GLY 4 1 ? ? ? A . n A 1 5 ASN 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 ALA 7 4 ? ? ? A . n A 1 8 ALA 8 5 ? ? ? A . n A 1 9 ALA 9 6 ? ? ? A . n A 1 10 LYS 10 7 ? ? ? A . n A 1 11 LYS 11 8 ? ? ? A . n A 1 12 GLY 12 9 ? ? ? A . n A 1 13 SEP 13 10 ? ? ? A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 GLN 15 12 12 GLN GLN A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 PHE 21 18 18 PHE PHE A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 LYS 26 23 23 LYS LYS A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 PHE 29 26 26 PHE PHE A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 LYS 31 28 28 LYS LYS A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 TRP 33 30 30 TRP TRP A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 SER 35 32 32 SER SER A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 GLN 38 35 35 GLN GLN A . n A 1 39 ASN 39 36 36 ASN ASN A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 GLN 42 39 39 GLN GLN A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 ASP 44 41 41 ASP ASP A . n A 1 45 HIS 45 42 42 HIS HIS A . n A 1 46 PHE 46 43 43 PHE PHE A . n A 1 47 ASP 47 44 44 ASP ASP A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 THR 51 48 48 THR THR A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 SER 56 53 ? ? ? A . n A 1 57 PHE 57 54 ? ? ? A . n A 1 58 GLY 58 55 55 GLY GLY A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 MET 61 58 58 MET MET A . n A 1 62 LEU 62 59 59 LEU LEU A . n A 1 63 VAL 63 60 60 VAL VAL A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 HIS 65 62 62 HIS HIS A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 THR 68 65 65 THR THR A . n A 1 69 GLY 69 66 66 GLY GLY A . n A 1 70 ASN 70 67 67 ASN ASN A . n A 1 71 HIS 71 68 68 HIS HIS A . n A 1 72 TYR 72 69 69 TYR TYR A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 MET 74 71 71 MET MET A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 ASP 78 75 75 ASP ASP A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 GLN 80 77 77 GLN GLN A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 LYS 86 83 83 LYS LYS A . n A 1 87 GLN 87 84 84 GLN GLN A . n A 1 88 ILE 88 85 85 ILE ILE A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 ASN 93 90 90 ASN ASN A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 LEU 98 95 95 LEU LEU A . n A 1 99 GLN 99 96 96 GLN GLN A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 ASN 102 99 99 ASN ASN A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 PRO 104 101 101 PRO PRO A . n A 1 105 PHE 105 102 102 PHE PHE A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 VAL 107 104 104 VAL VAL A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 SER 112 109 109 SER SER A . n A 1 113 PHE 113 110 110 PHE PHE A . n A 1 114 LYS 114 111 111 LYS LYS A . n A 1 115 ASP 115 112 112 ASP ASP A . n A 1 116 ASN 116 113 113 ASN ASN A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 ASN 118 115 115 ASN ASN A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 TYR 120 117 117 TYR TYR A . n A 1 121 MET 121 118 118 MET MET A . n A 1 122 VAL 122 119 119 VAL VAL A . n A 1 123 MET 123 120 120 MET MET A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 TYR 125 122 122 TYR TYR A . n A 1 126 VAL 126 123 123 VAL VAL A . n A 1 127 PRO 127 124 124 PRO PRO A . n A 1 128 GLY 128 125 125 GLY GLY A . n A 1 129 GLY 129 126 126 GLY GLY A . n A 1 130 GLU 130 127 127 GLU GLU A . n A 1 131 MET 131 128 128 MET MET A . n A 1 132 PHE 132 129 129 PHE PHE A . n A 1 133 SER 133 130 130 SER SER A . n A 1 134 HIS 134 131 131 HIS HIS A . n A 1 135 LEU 135 132 132 LEU LEU A . n A 1 136 ARG 136 133 133 ARG ARG A . n A 1 137 ARG 137 134 134 ARG ARG A . n A 1 138 ILE 138 135 135 ILE ILE A . n A 1 139 GLY 139 136 136 GLY GLY A . n A 1 140 ARG 140 137 137 ARG ARG A . n A 1 141 PHE 141 138 138 PHE PHE A . n A 1 142 SEP 142 139 139 SEP SEP A . n A 1 143 GLU 143 140 140 GLU GLU A . n A 1 144 PRO 144 141 141 PRO PRO A . n A 1 145 HIS 145 142 142 HIS HIS A . n A 1 146 ALA 146 143 143 ALA ALA A . n A 1 147 ARG 147 144 144 ARG ARG A . n A 1 148 PHE 148 145 145 PHE PHE A . n A 1 149 TYR 149 146 146 TYR TYR A . n A 1 150 ALA 150 147 147 ALA ALA A . n A 1 151 ALA 151 148 148 ALA ALA A . n A 1 152 GLN 152 149 149 GLN GLN A . n A 1 153 ILE 153 150 150 ILE ILE A . n A 1 154 VAL 154 151 151 VAL VAL A . n A 1 155 LEU 155 152 152 LEU LEU A . n A 1 156 THR 156 153 153 THR THR A . n A 1 157 PHE 157 154 154 PHE PHE A . n A 1 158 GLU 158 155 155 GLU GLU A . n A 1 159 TYR 159 156 156 TYR TYR A . n A 1 160 LEU 160 157 157 LEU LEU A . n A 1 161 HIS 161 158 158 HIS HIS A . n A 1 162 SER 162 159 159 SER SER A . n A 1 163 LEU 163 160 160 LEU LEU A . n A 1 164 ASP 164 161 161 ASP ASP A . n A 1 165 LEU 165 162 162 LEU LEU A . n A 1 166 ILE 166 163 163 ILE ILE A . n A 1 167 TYR 167 164 164 TYR TYR A . n A 1 168 ARG 168 165 165 ARG ARG A . n A 1 169 ASP 169 166 166 ASP ASP A . n A 1 170 LEU 170 167 167 LEU LEU A . n A 1 171 LYS 171 168 168 LYS LYS A . n A 1 172 PRO 172 169 169 PRO PRO A . n A 1 173 GLU 173 170 170 GLU GLU A . n A 1 174 ASN 174 171 171 ASN ASN A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 ILE 177 174 174 ILE ILE A . n A 1 178 ASP 178 175 175 ASP ASP A . n A 1 179 GLN 179 176 176 GLN GLN A . n A 1 180 GLN 180 177 177 GLN GLN A . n A 1 181 GLY 181 178 178 GLY GLY A . n A 1 182 TYR 182 179 179 TYR TYR A . n A 1 183 ILE 183 180 180 ILE ILE A . n A 1 184 GLN 184 181 181 GLN GLN A . n A 1 185 VAL 185 182 182 VAL VAL A . n A 1 186 THR 186 183 183 THR THR A . n A 1 187 ASP 187 184 184 ASP ASP A . n A 1 188 PHE 188 185 185 PHE PHE A . n A 1 189 GLY 189 186 186 GLY GLY A . n A 1 190 PHE 190 187 187 PHE PHE A . n A 1 191 ALA 191 188 188 ALA ALA A . n A 1 192 LYS 192 189 189 LYS LYS A . n A 1 193 ARG 193 190 190 ARG ARG A . n A 1 194 VAL 194 191 191 VAL VAL A . n A 1 195 LYS 195 192 192 LYS LYS A . n A 1 196 GLY 196 193 193 GLY GLY A . n A 1 197 ARG 197 194 194 ARG ARG A . n A 1 198 THR 198 195 195 THR THR A . n A 1 199 TRP 199 196 196 TRP TRP A . n A 1 200 TPO 200 197 197 TPO TPO A . n A 1 201 LEU 201 198 198 LEU LEU A . n A 1 202 CYS 202 199 199 CYS CYS A . n A 1 203 GLY 203 200 200 GLY GLY A . n A 1 204 THR 204 201 201 THR THR A . n A 1 205 PRO 205 202 202 PRO PRO A . n A 1 206 GLU 206 203 203 GLU GLU A . n A 1 207 TYR 207 204 204 TYR TYR A . n A 1 208 LEU 208 205 205 LEU LEU A . n A 1 209 ALA 209 206 206 ALA ALA A . n A 1 210 PRO 210 207 207 PRO PRO A . n A 1 211 GLU 211 208 208 GLU GLU A . n A 1 212 ILE 212 209 209 ILE ILE A . n A 1 213 ILE 213 210 210 ILE ILE A . n A 1 214 LEU 214 211 211 LEU LEU A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 LYS 216 213 213 LYS LYS A . n A 1 217 GLY 217 214 214 GLY GLY A . n A 1 218 TYR 218 215 215 TYR TYR A . n A 1 219 ASN 219 216 216 ASN ASN A . n A 1 220 LYS 220 217 217 LYS LYS A . n A 1 221 ALA 221 218 218 ALA ALA A . n A 1 222 VAL 222 219 219 VAL VAL A . n A 1 223 ASP 223 220 220 ASP ASP A . n A 1 224 TRP 224 221 221 TRP TRP A . n A 1 225 TRP 225 222 222 TRP TRP A . n A 1 226 ALA 226 223 223 ALA ALA A . n A 1 227 LEU 227 224 224 LEU LEU A . n A 1 228 GLY 228 225 225 GLY GLY A . n A 1 229 VAL 229 226 226 VAL VAL A . n A 1 230 LEU 230 227 227 LEU LEU A . n A 1 231 ILE 231 228 228 ILE ILE A . n A 1 232 TYR 232 229 229 TYR TYR A . n A 1 233 GLU 233 230 230 GLU GLU A . n A 1 234 MET 234 231 231 MET MET A . n A 1 235 ALA 235 232 232 ALA ALA A . n A 1 236 ALA 236 233 233 ALA ALA A . n A 1 237 GLY 237 234 234 GLY GLY A . n A 1 238 TYR 238 235 235 TYR TYR A . n A 1 239 PRO 239 236 236 PRO PRO A . n A 1 240 PRO 240 237 237 PRO PRO A . n A 1 241 PHE 241 238 238 PHE PHE A . n A 1 242 PHE 242 239 239 PHE PHE A . n A 1 243 ALA 243 240 240 ALA ALA A . n A 1 244 ASP 244 241 241 ASP ASP A . n A 1 245 GLN 245 242 242 GLN GLN A . n A 1 246 PRO 246 243 243 PRO PRO A . n A 1 247 ILE 247 244 244 ILE ILE A . n A 1 248 GLN 248 245 245 GLN GLN A . n A 1 249 ILE 249 246 246 ILE ILE A . n A 1 250 TYR 250 247 247 TYR TYR A . n A 1 251 GLU 251 248 248 GLU GLU A . n A 1 252 LYS 252 249 249 LYS LYS A . n A 1 253 ILE 253 250 250 ILE ILE A . n A 1 254 VAL 254 251 251 VAL VAL A . n A 1 255 SER 255 252 252 SER SER A . n A 1 256 GLY 256 253 253 GLY GLY A . n A 1 257 LYS 257 254 254 LYS LYS A . n A 1 258 VAL 258 255 255 VAL VAL A . n A 1 259 ARG 259 256 256 ARG ARG A . n A 1 260 PHE 260 257 257 PHE PHE A . n A 1 261 PRO 261 258 258 PRO PRO A . n A 1 262 SER 262 259 259 SER SER A . n A 1 263 HIS 263 260 260 HIS HIS A . n A 1 264 PHE 264 261 261 PHE PHE A . n A 1 265 SER 265 262 262 SER SER A . n A 1 266 SER 266 263 263 SER SER A . n A 1 267 ASP 267 264 264 ASP ASP A . n A 1 268 LEU 268 265 265 LEU LEU A . n A 1 269 LYS 269 266 266 LYS LYS A . n A 1 270 ASP 270 267 267 ASP ASP A . n A 1 271 LEU 271 268 268 LEU LEU A . n A 1 272 LEU 272 269 269 LEU LEU A . n A 1 273 ARG 273 270 270 ARG ARG A . n A 1 274 ASN 274 271 271 ASN ASN A . n A 1 275 LEU 275 272 272 LEU LEU A . n A 1 276 LEU 276 273 273 LEU LEU A . n A 1 277 GLN 277 274 274 GLN GLN A . n A 1 278 VAL 278 275 275 VAL VAL A . n A 1 279 ASP 279 276 276 ASP ASP A . n A 1 280 LEU 280 277 277 LEU LEU A . n A 1 281 THR 281 278 278 THR THR A . n A 1 282 LYS 282 279 279 LYS LYS A . n A 1 283 ARG 283 280 280 ARG ARG A . n A 1 284 PHE 284 281 281 PHE PHE A . n A 1 285 GLY 285 282 282 GLY GLY A . n A 1 286 ASN 286 283 283 ASN ASN A . n A 1 287 LEU 287 284 284 LEU LEU A . n A 1 288 LYS 288 285 285 LYS LYS A . n A 1 289 ASN 289 286 286 ASN ASN A . n A 1 290 GLY 290 287 287 GLY GLY A . n A 1 291 VAL 291 288 288 VAL VAL A . n A 1 292 ASN 292 289 289 ASN ASN A . n A 1 293 ASP 293 290 290 ASP ASP A . n A 1 294 ILE 294 291 291 ILE ILE A . n A 1 295 LYS 295 292 292 LYS LYS A . n A 1 296 ASN 296 293 293 ASN ASN A . n A 1 297 HIS 297 294 294 HIS HIS A . n A 1 298 LYS 298 295 295 LYS LYS A . n A 1 299 TRP 299 296 296 TRP TRP A . n A 1 300 PHE 300 297 297 PHE PHE A . n A 1 301 ALA 301 298 298 ALA ALA A . n A 1 302 THR 302 299 299 THR THR A . n A 1 303 THR 303 300 300 THR THR A . n A 1 304 ASP 304 301 301 ASP ASP A . n A 1 305 TRP 305 302 302 TRP TRP A . n A 1 306 ILE 306 303 303 ILE ILE A . n A 1 307 ALA 307 304 304 ALA ALA A . n A 1 308 ILE 308 305 305 ILE ILE A . n A 1 309 TYR 309 306 306 TYR TYR A . n A 1 310 GLN 310 307 307 GLN GLN A . n A 1 311 ARG 311 308 308 ARG ARG A . n A 1 312 LYS 312 309 309 LYS LYS A . n A 1 313 VAL 313 310 310 VAL VAL A . n A 1 314 GLU 314 311 311 GLU GLU A . n A 1 315 ALA 315 312 312 ALA ALA A . n A 1 316 PRO 316 313 313 PRO PRO A . n A 1 317 PHE 317 314 314 PHE PHE A . n A 1 318 ILE 318 315 315 ILE ILE A . n A 1 319 PRO 319 316 316 PRO PRO A . n A 1 320 LYS 320 317 317 LYS LYS A . n A 1 321 PHE 321 318 318 PHE PHE A . n A 1 322 LYS 322 319 319 LYS LYS A . n A 1 323 GLY 323 320 320 GLY GLY A . n A 1 324 PRO 324 321 321 PRO PRO A . n A 1 325 GLY 325 322 322 GLY GLY A . n A 1 326 ASP 326 323 323 ASP ASP A . n A 1 327 THR 327 324 324 THR THR A . n A 1 328 SER 328 325 325 SER SER A . n A 1 329 ASN 329 326 326 ASN ASN A . n A 1 330 PHE 330 327 327 PHE PHE A . n A 1 331 ASP 331 328 328 ASP ASP A . n A 1 332 ASP 332 329 329 ASP ASP A . n A 1 333 TYR 333 330 330 TYR TYR A . n A 1 334 GLU 334 331 331 GLU GLU A . n A 1 335 GLU 335 332 332 GLU GLU A . n A 1 336 GLU 336 333 333 GLU GLU A . n A 1 337 GLU 337 334 334 GLU GLU A . n A 1 338 ILE 338 335 335 ILE ILE A . n A 1 339 ARG 339 336 336 ARG ARG A . n A 1 340 VAL 340 337 337 VAL VAL A . n A 1 341 SEP 341 338 338 SEP SEP A . n A 1 342 ILE 342 339 339 ILE ILE A . n A 1 343 ASN 343 340 340 ASN ASN A . n A 1 344 GLU 344 341 341 GLU GLU A . n A 1 345 LYS 345 342 342 LYS LYS A . n A 1 346 CYS 346 343 343 CYS CYS A . n A 1 347 GLY 347 344 344 GLY GLY A . n A 1 348 LYS 348 345 345 LYS LYS A . n A 1 349 GLU 349 346 346 GLU GLU A . n A 1 350 PHE 350 347 347 PHE PHE A . n A 1 351 THR 351 348 348 THR THR A . n A 1 352 GLU 352 349 349 GLU GLU A . n A 1 353 PHE 353 350 350 PHE PHE A . n B 2 1 THR 1 11 11 THR THR B . n B 2 2 THR 2 12 12 THR THR B . n B 2 3 TYR 3 13 13 TYR TYR B . n B 2 4 ALA 4 14 14 ALA ALA B . n B 2 5 ASP 5 15 15 ASP ASP B . n B 2 6 PHE 6 16 16 PHE PHE B . n B 2 7 ILE 7 17 17 ILE ILE B . n B 2 8 ALA 8 18 18 ALA ALA B . n B 2 9 SER 9 19 19 SER SER B . n B 2 10 GLY 10 20 20 GLY GLY B . n B 2 11 ARG 11 21 21 ARG ARG B . n B 2 12 THR 12 22 22 THR THR B . n B 2 13 SER 13 23 23 SER SER B . n B 2 14 ARG 14 24 24 ARG ARG B . n B 2 15 ARG 15 25 25 ARG ARG B . n B 2 16 ASN 16 26 26 ASN ASN B . n B 2 17 ALA 17 27 27 ALA ALA B . n B 2 18 ILE 18 28 28 ILE ILE B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 M77 1 401 1 M77 FAS A . D 4 RIP 1 101 2 RIP RIB B . E 5 HOH 1 501 20 HOH HOH A . E 5 HOH 2 502 91 HOH HOH A . E 5 HOH 3 503 36 HOH HOH A . E 5 HOH 4 504 159 HOH HOH A . E 5 HOH 5 505 80 HOH HOH A . E 5 HOH 6 506 146 HOH HOH A . E 5 HOH 7 507 70 HOH HOH A . E 5 HOH 8 508 126 HOH HOH A . E 5 HOH 9 509 99 HOH HOH A . E 5 HOH 10 510 64 HOH HOH A . E 5 HOH 11 511 163 HOH HOH A . E 5 HOH 12 512 129 HOH HOH A . E 5 HOH 13 513 113 HOH HOH A . E 5 HOH 14 514 68 HOH HOH A . E 5 HOH 15 515 65 HOH HOH A . E 5 HOH 16 516 78 HOH HOH A . E 5 HOH 17 517 24 HOH HOH A . E 5 HOH 18 518 75 HOH HOH A . E 5 HOH 19 519 39 HOH HOH A . E 5 HOH 20 520 76 HOH HOH A . E 5 HOH 21 521 69 HOH HOH A . E 5 HOH 22 522 13 HOH HOH A . E 5 HOH 23 523 37 HOH HOH A . E 5 HOH 24 524 47 HOH HOH A . E 5 HOH 25 525 11 HOH HOH A . E 5 HOH 26 526 121 HOH HOH A . E 5 HOH 27 527 145 HOH HOH A . E 5 HOH 28 528 17 HOH HOH A . E 5 HOH 29 529 112 HOH HOH A . E 5 HOH 30 530 19 HOH HOH A . E 5 HOH 31 531 60 HOH HOH A . E 5 HOH 32 532 73 HOH HOH A . E 5 HOH 33 533 12 HOH HOH A . E 5 HOH 34 534 92 HOH HOH A . E 5 HOH 35 535 3 HOH HOH A . E 5 HOH 36 536 22 HOH HOH A . E 5 HOH 37 537 165 HOH HOH A . E 5 HOH 38 538 57 HOH HOH A . E 5 HOH 39 539 8 HOH HOH A . E 5 HOH 40 540 114 HOH HOH A . E 5 HOH 41 541 79 HOH HOH A . E 5 HOH 42 542 155 HOH HOH A . E 5 HOH 43 543 162 HOH HOH A . E 5 HOH 44 544 122 HOH HOH A . E 5 HOH 45 545 53 HOH HOH A . E 5 HOH 46 546 116 HOH HOH A . E 5 HOH 47 547 154 HOH HOH A . E 5 HOH 48 548 9 HOH HOH A . E 5 HOH 49 549 85 HOH HOH A . E 5 HOH 50 550 51 HOH HOH A . E 5 HOH 51 551 83 HOH HOH A . E 5 HOH 52 552 119 HOH HOH A . E 5 HOH 53 553 44 HOH HOH A . E 5 HOH 54 554 123 HOH HOH A . E 5 HOH 55 555 55 HOH HOH A . E 5 HOH 56 556 54 HOH HOH A . E 5 HOH 57 557 100 HOH HOH A . E 5 HOH 58 558 84 HOH HOH A . E 5 HOH 59 559 58 HOH HOH A . E 5 HOH 60 560 5 HOH HOH A . E 5 HOH 61 561 105 HOH HOH A . E 5 HOH 62 562 161 HOH HOH A . E 5 HOH 63 563 21 HOH HOH A . E 5 HOH 64 564 45 HOH HOH A . E 5 HOH 65 565 29 HOH HOH A . E 5 HOH 66 566 52 HOH HOH A . E 5 HOH 67 567 98 HOH HOH A . E 5 HOH 68 568 50 HOH HOH A . E 5 HOH 69 569 56 HOH HOH A . E 5 HOH 70 570 23 HOH HOH A . E 5 HOH 71 571 164 HOH HOH A . E 5 HOH 72 572 136 HOH HOH A . E 5 HOH 73 573 130 HOH HOH A . E 5 HOH 74 574 94 HOH HOH A . E 5 HOH 75 575 102 HOH HOH A . E 5 HOH 76 576 107 HOH HOH A . E 5 HOH 77 577 148 HOH HOH A . E 5 HOH 78 578 4 HOH HOH A . E 5 HOH 79 579 28 HOH HOH A . E 5 HOH 80 580 139 HOH HOH A . E 5 HOH 81 581 41 HOH HOH A . E 5 HOH 82 582 27 HOH HOH A . E 5 HOH 83 583 143 HOH HOH A . E 5 HOH 84 584 108 HOH HOH A . E 5 HOH 85 585 131 HOH HOH A . E 5 HOH 86 586 134 HOH HOH A . E 5 HOH 87 587 141 HOH HOH A . E 5 HOH 88 588 35 HOH HOH A . E 5 HOH 89 589 128 HOH HOH A . E 5 HOH 90 590 40 HOH HOH A . E 5 HOH 91 591 43 HOH HOH A . E 5 HOH 92 592 67 HOH HOH A . E 5 HOH 93 593 16 HOH HOH A . E 5 HOH 94 594 77 HOH HOH A . E 5 HOH 95 595 38 HOH HOH A . E 5 HOH 96 596 18 HOH HOH A . E 5 HOH 97 597 81 HOH HOH A . E 5 HOH 98 598 97 HOH HOH A . E 5 HOH 99 599 160 HOH HOH A . E 5 HOH 100 600 88 HOH HOH A . E 5 HOH 101 601 42 HOH HOH A . E 5 HOH 102 602 72 HOH HOH A . E 5 HOH 103 603 151 HOH HOH A . E 5 HOH 104 604 96 HOH HOH A . E 5 HOH 105 605 10 HOH HOH A . E 5 HOH 106 606 7 HOH HOH A . E 5 HOH 107 607 147 HOH HOH A . E 5 HOH 108 608 30 HOH HOH A . E 5 HOH 109 609 26 HOH HOH A . E 5 HOH 110 610 118 HOH HOH A . E 5 HOH 111 611 125 HOH HOH A . E 5 HOH 112 612 127 HOH HOH A . E 5 HOH 113 613 74 HOH HOH A . E 5 HOH 114 614 158 HOH HOH A . E 5 HOH 115 615 33 HOH HOH A . E 5 HOH 116 616 111 HOH HOH A . E 5 HOH 117 617 110 HOH HOH A . E 5 HOH 118 618 156 HOH HOH A . E 5 HOH 119 619 115 HOH HOH A . E 5 HOH 120 620 32 HOH HOH A . E 5 HOH 121 621 124 HOH HOH A . E 5 HOH 122 622 66 HOH HOH A . E 5 HOH 123 623 93 HOH HOH A . E 5 HOH 124 624 90 HOH HOH A . E 5 HOH 125 625 137 HOH HOH A . E 5 HOH 126 626 117 HOH HOH A . E 5 HOH 127 627 31 HOH HOH A . E 5 HOH 128 628 87 HOH HOH A . F 5 HOH 1 201 140 HOH HOH B . F 5 HOH 2 202 14 HOH HOH B . F 5 HOH 3 203 144 HOH HOH B . F 5 HOH 4 204 89 HOH HOH B . F 5 HOH 5 205 109 HOH HOH B . F 5 HOH 6 206 25 HOH HOH B . F 5 HOH 7 207 152 HOH HOH B . F 5 HOH 8 208 149 HOH HOH B . F 5 HOH 9 209 150 HOH HOH B . F 5 HOH 10 210 95 HOH HOH B . F 5 HOH 11 211 157 HOH HOH B . F 5 HOH 12 212 153 HOH HOH B . F 5 HOH 13 213 15 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SEP 142 A SEP 139 ? SER 'modified residue' 2 A TPO 200 A TPO 197 ? THR 'modified residue' 3 A SEP 341 A SEP 338 ? SER 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2460 ? 1 MORE 3 ? 1 'SSA (A^2)' 15580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-31 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2023-02-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? 3 3 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' Advisory 5 3 'Structure model' 'Database references' 6 3 'Structure model' Other 7 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' entity 3 2 'Structure model' pdbx_chem_comp_identifier 4 2 'Structure model' pdbx_entity_nonpoly 5 2 'Structure model' struct_site 6 2 'Structure model' struct_site_gen 7 3 'Structure model' chem_comp 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_database_PDB_obs_spr 10 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.name' 2 2 'Structure model' '_chem_comp.pdbx_synonyms' 3 2 'Structure model' '_chem_comp.type' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_pdbx_entity_nonpoly.name' 6 3 'Structure model' '_chem_comp.pdbx_synonyms' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_pdbx_database_status.status_code' 10 3 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 17.5124 19.6293 3.6373 0.1479 0.2155 0.1863 -0.0423 0.0226 0.0076 0.6979 0.2377 0.6114 -0.3186 -0.0902 -0.1156 -0.0712 0.1452 -0.0548 -0.1027 -0.0146 -0.0519 -0.1351 0.1324 0.0001 'X-RAY DIFFRACTION' 2 ? refined 11.2306 16.7028 10.8445 0.0884 0.1298 0.1247 -0.0010 -0.0107 -0.0146 0.6092 0.5649 0.4605 -0.1389 -0.1698 -0.0078 -0.0290 0.0537 -0.1069 0.0231 -0.0168 0.0623 -0.0217 0.0366 -0.0015 'X-RAY DIFFRACTION' 3 ? refined 5.6148 19.3749 27.3436 0.1870 0.1317 0.1368 0.0072 0.0397 -0.0158 1.3750 0.9809 0.3766 0.2105 -0.1160 -0.1230 0.0338 -0.2439 0.0438 0.1760 -0.0226 0.1713 -0.0589 0.0796 0.0046 'X-RAY DIFFRACTION' 4 ? refined 12.3304 12.9245 7.3499 0.1188 0.1922 0.2076 -0.0467 0.0056 0.0356 0.2605 0.6469 0.9022 0.0327 -0.3178 0.5379 -0.0386 -0.0071 -0.1021 -0.0318 0.0347 0.1289 0.1044 -0.0348 -0.0001 'X-RAY DIFFRACTION' 5 ? refined -6.7553 2.8839 28.8350 0.2073 0.1845 0.3242 0.0052 0.0612 0.0420 0.0312 0.0102 0.0337 -0.0020 0.0265 0.0090 0.0414 -0.2075 -0.2904 0.0451 0.0673 0.1814 -0.1095 0.0774 -0.0002 'X-RAY DIFFRACTION' 6 ? refined -3.8584 11.5226 17.5146 0.2243 0.1427 0.2990 0.0205 0.0084 0.0079 0.0120 0.0216 0.0233 -0.0162 -0.0083 0.0093 0.0441 0.0392 -0.1927 -0.3009 -0.0168 0.2746 -0.1525 -0.0250 0.0001 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 11 through 67 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 68 through 160 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 161 through 297 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 298 through 350 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 11 through 19 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 20 through 28 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 23 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O5 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 RIP _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 165 ? ? 76.22 -0.73 2 1 LEU A 273 ? ? -82.01 48.57 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 11 ? CG ? A GLU 14 CG 2 1 Y 1 A GLU 11 ? CD ? A GLU 14 CD 3 1 Y 1 A GLU 11 ? OE1 ? A GLU 14 OE1 4 1 Y 1 A GLU 11 ? OE2 ? A GLU 14 OE2 5 1 Y 1 A GLN 12 ? CG ? A GLN 15 CG 6 1 Y 1 A GLN 12 ? CD ? A GLN 15 CD 7 1 Y 1 A GLN 12 ? OE1 ? A GLN 15 OE1 8 1 Y 1 A GLN 12 ? NE2 ? A GLN 15 NE2 9 1 Y 1 A GLU 13 ? OE1 ? A GLU 16 OE1 10 1 Y 1 A GLU 13 ? OE2 ? A GLU 16 OE2 11 1 Y 1 A SER 14 ? OG ? A SER 17 OG 12 1 Y 1 A LYS 16 ? CG ? A LYS 19 CG 13 1 Y 1 A LYS 16 ? CD ? A LYS 19 CD 14 1 Y 1 A LYS 16 ? CE ? A LYS 19 CE 15 1 Y 1 A LYS 16 ? NZ ? A LYS 19 NZ 16 1 Y 1 A GLU 17 ? CG ? A GLU 20 CG 17 1 Y 1 A GLU 17 ? CD ? A GLU 20 CD 18 1 Y 1 A GLU 17 ? OE1 ? A GLU 20 OE1 19 1 Y 1 A GLU 17 ? OE2 ? A GLU 20 OE2 20 1 Y 1 A LYS 21 ? CD ? A LYS 24 CD 21 1 Y 1 A LYS 21 ? CE ? A LYS 24 CE 22 1 Y 1 A LYS 21 ? NZ ? A LYS 24 NZ 23 1 Y 1 A LYS 23 ? CE ? A LYS 26 CE 24 1 Y 1 A LYS 23 ? NZ ? A LYS 26 NZ 25 1 Y 1 A GLU 24 ? CG ? A GLU 27 CG 26 1 Y 1 A GLU 24 ? CD ? A GLU 27 CD 27 1 Y 1 A GLU 24 ? OE1 ? A GLU 27 OE1 28 1 Y 1 A GLU 24 ? OE2 ? A GLU 27 OE2 29 1 Y 1 A LYS 28 ? CD ? A LYS 31 CD 30 1 Y 1 A LYS 28 ? CE ? A LYS 31 CE 31 1 Y 1 A LYS 28 ? NZ ? A LYS 31 NZ 32 1 Y 1 A ARG 45 ? CG ? A ARG 48 CG 33 1 Y 1 A ARG 45 ? CD ? A ARG 48 CD 34 1 Y 1 A ARG 45 ? NE ? A ARG 48 NE 35 1 Y 1 A ARG 45 ? CZ ? A ARG 48 CZ 36 1 Y 1 A ARG 45 ? NH1 ? A ARG 48 NH1 37 1 Y 1 A ARG 45 ? NH2 ? A ARG 48 NH2 38 1 Y 1 A LYS 61 ? NZ ? A LYS 64 NZ 39 1 Y 1 A LYS 63 ? NZ ? A LYS 66 NZ 40 1 Y 1 A GLU 64 ? CG ? A GLU 67 CG 41 1 Y 1 A GLU 64 ? CD ? A GLU 67 CD 42 1 Y 1 A GLU 64 ? OE1 ? A GLU 67 OE1 43 1 Y 1 A GLU 64 ? OE2 ? A GLU 67 OE2 44 1 Y 1 A LYS 78 ? CG ? A LYS 81 CG 45 1 Y 1 A LYS 78 ? CD ? A LYS 81 CD 46 1 Y 1 A LYS 78 ? CE ? A LYS 81 CE 47 1 Y 1 A LYS 78 ? NZ ? A LYS 81 NZ 48 1 Y 1 A LYS 81 ? CG ? A LYS 84 CG 49 1 Y 1 A LYS 81 ? CD ? A LYS 84 CD 50 1 Y 1 A LYS 81 ? CE ? A LYS 84 CE 51 1 Y 1 A LYS 81 ? NZ ? A LYS 84 NZ 52 1 Y 1 A LYS 105 ? CD ? A LYS 108 CD 53 1 Y 1 A LYS 105 ? CE ? A LYS 108 CE 54 1 Y 1 A LYS 105 ? NZ ? A LYS 108 NZ 55 1 Y 1 A GLN 177 ? CG ? A GLN 180 CG 56 1 Y 1 A GLN 177 ? CD ? A GLN 180 CD 57 1 Y 1 A GLN 177 ? OE1 ? A GLN 180 OE1 58 1 Y 1 A GLN 177 ? NE2 ? A GLN 180 NE2 59 1 Y 1 A LYS 192 ? CG ? A LYS 195 CG 60 1 Y 1 A LYS 192 ? CD ? A LYS 195 CD 61 1 Y 1 A LYS 192 ? CE ? A LYS 195 CE 62 1 Y 1 A LYS 192 ? NZ ? A LYS 195 NZ 63 1 Y 1 A LYS 213 ? CD ? A LYS 216 CD 64 1 Y 1 A LYS 213 ? CE ? A LYS 216 CE 65 1 Y 1 A LYS 213 ? NZ ? A LYS 216 NZ 66 1 Y 1 A LYS 217 ? NZ ? A LYS 220 NZ 67 1 Y 1 A ILE 244 ? CG1 ? A ILE 247 CG1 68 1 Y 1 A ILE 244 ? CG2 ? A ILE 247 CG2 69 1 Y 1 A ILE 244 ? CD1 ? A ILE 247 CD1 70 1 Y 1 A GLU 248 ? CG ? A GLU 251 CG 71 1 Y 1 A GLU 248 ? CD ? A GLU 251 CD 72 1 Y 1 A GLU 248 ? OE1 ? A GLU 251 OE1 73 1 Y 1 A GLU 248 ? OE2 ? A GLU 251 OE2 74 1 Y 1 A ARG 256 ? CG ? A ARG 259 CG 75 1 Y 1 A ARG 256 ? CD ? A ARG 259 CD 76 1 Y 1 A ARG 256 ? NE ? A ARG 259 NE 77 1 Y 1 A ARG 256 ? CZ ? A ARG 259 CZ 78 1 Y 1 A ARG 256 ? NH1 ? A ARG 259 NH1 79 1 Y 1 A ARG 256 ? NH2 ? A ARG 259 NH2 80 1 Y 1 A LYS 279 ? CG ? A LYS 282 CG 81 1 Y 1 A LYS 279 ? CD ? A LYS 282 CD 82 1 Y 1 A LYS 279 ? CE ? A LYS 282 CE 83 1 Y 1 A LYS 279 ? NZ ? A LYS 282 NZ 84 1 Y 1 A LYS 285 ? CG ? A LYS 288 CG 85 1 Y 1 A LYS 285 ? CD ? A LYS 288 CD 86 1 Y 1 A LYS 285 ? CE ? A LYS 288 CE 87 1 Y 1 A LYS 285 ? NZ ? A LYS 288 NZ 88 1 Y 1 A LYS 295 ? CD ? A LYS 298 CD 89 1 Y 1 A LYS 295 ? CE ? A LYS 298 CE 90 1 Y 1 A LYS 295 ? NZ ? A LYS 298 NZ 91 1 Y 1 A LYS 309 ? CE ? A LYS 312 CE 92 1 Y 1 A LYS 309 ? NZ ? A LYS 312 NZ 93 1 Y 1 A GLU 311 ? CD ? A GLU 314 CD 94 1 Y 1 A GLU 311 ? OE1 ? A GLU 314 OE1 95 1 Y 1 A GLU 311 ? OE2 ? A GLU 314 OE2 96 1 Y 1 A LYS 317 ? CG ? A LYS 320 CG 97 1 Y 1 A LYS 317 ? CD ? A LYS 320 CD 98 1 Y 1 A LYS 317 ? CE ? A LYS 320 CE 99 1 Y 1 A LYS 317 ? NZ ? A LYS 320 NZ 100 1 Y 1 A PHE 318 ? CG ? A PHE 321 CG 101 1 Y 1 A PHE 318 ? CD1 ? A PHE 321 CD1 102 1 Y 1 A PHE 318 ? CD2 ? A PHE 321 CD2 103 1 Y 1 A PHE 318 ? CE1 ? A PHE 321 CE1 104 1 Y 1 A PHE 318 ? CE2 ? A PHE 321 CE2 105 1 Y 1 A PHE 318 ? CZ ? A PHE 321 CZ 106 1 Y 1 A LYS 319 ? CG ? A LYS 322 CG 107 1 Y 1 A LYS 319 ? CD ? A LYS 322 CD 108 1 Y 1 A LYS 319 ? CE ? A LYS 322 CE 109 1 Y 1 A LYS 319 ? NZ ? A LYS 322 NZ 110 1 Y 1 A GLU 331 ? CG ? A GLU 334 CG 111 1 Y 1 A GLU 331 ? CD ? A GLU 334 CD 112 1 Y 1 A GLU 331 ? OE1 ? A GLU 334 OE1 113 1 Y 1 A GLU 331 ? OE2 ? A GLU 334 OE2 114 1 Y 1 A GLU 333 ? CG ? A GLU 336 CG 115 1 Y 1 A GLU 333 ? CD ? A GLU 336 CD 116 1 Y 1 A GLU 333 ? OE1 ? A GLU 336 OE1 117 1 Y 1 A GLU 333 ? OE2 ? A GLU 336 OE2 118 1 Y 1 A GLU 334 ? CG ? A GLU 337 CG 119 1 Y 1 A GLU 334 ? CD ? A GLU 337 CD 120 1 Y 1 A GLU 334 ? OE1 ? A GLU 337 OE1 121 1 Y 1 A GLU 334 ? OE2 ? A GLU 337 OE2 122 1 Y 1 A ILE 335 ? CG1 ? A ILE 338 CG1 123 1 Y 1 A ILE 335 ? CG2 ? A ILE 338 CG2 124 1 Y 1 A ILE 335 ? CD1 ? A ILE 338 CD1 125 1 Y 1 A ILE 339 ? CG1 ? A ILE 342 CG1 126 1 Y 1 A ILE 339 ? CG2 ? A ILE 342 CG2 127 1 Y 1 A ILE 339 ? CD1 ? A ILE 342 CD1 128 1 Y 1 A LYS 345 ? CD ? A LYS 348 CD 129 1 Y 1 A LYS 345 ? CE ? A LYS 348 CE 130 1 Y 1 A LYS 345 ? NZ ? A LYS 348 NZ 131 1 N 1 B RIP 101 ? O1 ? D RIP 1 O1 132 1 N 1 B RIP 101 ? O2 ? D RIP 1 O2 133 1 N 1 B RIP 101 ? O3 ? D RIP 1 O3 134 1 N 1 B RIP 101 ? O4 ? D RIP 1 O4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A HIS -1 ? A HIS 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A GLY 1 ? A GLY 4 5 1 Y 1 A ASN 2 ? A ASN 5 6 1 Y 1 A ALA 3 ? A ALA 6 7 1 Y 1 A ALA 4 ? A ALA 7 8 1 Y 1 A ALA 5 ? A ALA 8 9 1 Y 1 A ALA 6 ? A ALA 9 10 1 Y 1 A LYS 7 ? A LYS 10 11 1 Y 1 A LYS 8 ? A LYS 11 12 1 Y 1 A GLY 9 ? A GLY 12 13 1 Y 1 A SEP 10 ? A SEP 13 14 1 Y 1 A SER 53 ? A SER 56 15 1 Y 1 A PHE 54 ? A PHE 57 # _pdbx_audit_support.funding_organization 'Loewe Corporation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier RIP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DRibpb RIP 'COMMON NAME' GMML 1.0 b-D-ribopyranose RIP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Ribp RIP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Rib # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RIP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RIP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' M77 4 beta-D-ribopyranose RIP 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #