data_6ERT # _entry.id 6ERT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6ERT WWPDB D_1200007153 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ERT _pdbx_database_status.recvd_initial_deposition_date 2017-10-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, J.M.' 1 0000-0002-4133-7238 'Heine, A.' 2 ? 'Klebe, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Conceptional Design of Self-Assembling Bisubstrate-like Inhibitors of Protein Kinase A Resulting in a Boronic Acid Glutamate Linkage ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.8b02364 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mueller, J.M.' 1 ? primary 'Kirschner, R.' 2 ? primary 'Geyer, A.' 3 ? primary 'Klebe, G.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6ERT _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.848 _cell.length_a_esd ? _cell.length_b 73.265 _cell.length_b_esd ? _cell.length_c 77.084 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ERT _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cAMP-dependent protein kinase catalytic subunit alpha' 41193.746 1 2.7.11.11 ? ? ? 2 polymer syn 'cAMP-dependent protein kinase inhibitor' 1945.163 1 ? ? ? 'PKI 5-22 with R18BAR mutation. The non natural amino acid is disordered' 3 non-polymer syn '[2-[(4-isoquinolin-5-ylsulfonyl-1,4-diazepan-1-yl)methyl]phenyl]-tris(oxidanyl)boranuide' 442.316 1 ? ? ? ? 4 water nat water 18.015 139 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PKA C-alpha' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GHMGNAAAAKKG(SEP)EQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKI LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRF(SEP)EPHARFYAAQ IVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALG VLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAI YQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFTEF ; ;GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQ KVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYL HSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK FKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; A ? 2 'polypeptide(L)' no no TTYADFIASGRTGKRNAI TTYADFIASGRTGKRNAI D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLY n 1 5 ASN n 1 6 ALA n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 LYS n 1 11 LYS n 1 12 GLY n 1 13 SEP n 1 14 GLU n 1 15 GLN n 1 16 GLU n 1 17 SER n 1 18 VAL n 1 19 LYS n 1 20 GLU n 1 21 PHE n 1 22 LEU n 1 23 ALA n 1 24 LYS n 1 25 ALA n 1 26 LYS n 1 27 GLU n 1 28 GLU n 1 29 PHE n 1 30 LEU n 1 31 LYS n 1 32 LYS n 1 33 TRP n 1 34 GLU n 1 35 SER n 1 36 PRO n 1 37 SER n 1 38 GLN n 1 39 ASN n 1 40 THR n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 ASP n 1 45 HIS n 1 46 PHE n 1 47 ASP n 1 48 ARG n 1 49 ILE n 1 50 LYS n 1 51 THR n 1 52 LEU n 1 53 GLY n 1 54 THR n 1 55 GLY n 1 56 SER n 1 57 PHE n 1 58 GLY n 1 59 ARG n 1 60 VAL n 1 61 MET n 1 62 LEU n 1 63 VAL n 1 64 LYS n 1 65 HIS n 1 66 LYS n 1 67 GLU n 1 68 THR n 1 69 GLY n 1 70 ASN n 1 71 HIS n 1 72 TYR n 1 73 ALA n 1 74 MET n 1 75 LYS n 1 76 ILE n 1 77 LEU n 1 78 ASP n 1 79 LYS n 1 80 GLN n 1 81 LYS n 1 82 VAL n 1 83 VAL n 1 84 LYS n 1 85 LEU n 1 86 LYS n 1 87 GLN n 1 88 ILE n 1 89 GLU n 1 90 HIS n 1 91 THR n 1 92 LEU n 1 93 ASN n 1 94 GLU n 1 95 LYS n 1 96 ARG n 1 97 ILE n 1 98 LEU n 1 99 GLN n 1 100 ALA n 1 101 VAL n 1 102 ASN n 1 103 PHE n 1 104 PRO n 1 105 PHE n 1 106 LEU n 1 107 VAL n 1 108 LYS n 1 109 LEU n 1 110 GLU n 1 111 PHE n 1 112 SER n 1 113 PHE n 1 114 LYS n 1 115 ASP n 1 116 ASN n 1 117 SER n 1 118 ASN n 1 119 LEU n 1 120 TYR n 1 121 MET n 1 122 VAL n 1 123 MET n 1 124 GLU n 1 125 TYR n 1 126 VAL n 1 127 PRO n 1 128 GLY n 1 129 GLY n 1 130 GLU n 1 131 MET n 1 132 PHE n 1 133 SER n 1 134 HIS n 1 135 LEU n 1 136 ARG n 1 137 ARG n 1 138 ILE n 1 139 GLY n 1 140 ARG n 1 141 PHE n 1 142 SEP n 1 143 GLU n 1 144 PRO n 1 145 HIS n 1 146 ALA n 1 147 ARG n 1 148 PHE n 1 149 TYR n 1 150 ALA n 1 151 ALA n 1 152 GLN n 1 153 ILE n 1 154 VAL n 1 155 LEU n 1 156 THR n 1 157 PHE n 1 158 GLU n 1 159 TYR n 1 160 LEU n 1 161 HIS n 1 162 SER n 1 163 LEU n 1 164 ASP n 1 165 LEU n 1 166 ILE n 1 167 TYR n 1 168 ARG n 1 169 ASP n 1 170 LEU n 1 171 LYS n 1 172 PRO n 1 173 GLU n 1 174 ASN n 1 175 LEU n 1 176 LEU n 1 177 ILE n 1 178 ASP n 1 179 GLN n 1 180 GLN n 1 181 GLY n 1 182 TYR n 1 183 ILE n 1 184 GLN n 1 185 VAL n 1 186 THR n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 PHE n 1 191 ALA n 1 192 LYS n 1 193 ARG n 1 194 VAL n 1 195 LYS n 1 196 GLY n 1 197 ARG n 1 198 THR n 1 199 TRP n 1 200 TPO n 1 201 LEU n 1 202 CYS n 1 203 GLY n 1 204 THR n 1 205 PRO n 1 206 GLU n 1 207 TYR n 1 208 LEU n 1 209 ALA n 1 210 PRO n 1 211 GLU n 1 212 ILE n 1 213 ILE n 1 214 LEU n 1 215 SER n 1 216 LYS n 1 217 GLY n 1 218 TYR n 1 219 ASN n 1 220 LYS n 1 221 ALA n 1 222 VAL n 1 223 ASP n 1 224 TRP n 1 225 TRP n 1 226 ALA n 1 227 LEU n 1 228 GLY n 1 229 VAL n 1 230 LEU n 1 231 ILE n 1 232 TYR n 1 233 GLU n 1 234 MET n 1 235 ALA n 1 236 ALA n 1 237 GLY n 1 238 TYR n 1 239 PRO n 1 240 PRO n 1 241 PHE n 1 242 PHE n 1 243 ALA n 1 244 ASP n 1 245 GLN n 1 246 PRO n 1 247 ILE n 1 248 GLN n 1 249 ILE n 1 250 TYR n 1 251 GLU n 1 252 LYS n 1 253 ILE n 1 254 VAL n 1 255 SER n 1 256 GLY n 1 257 LYS n 1 258 VAL n 1 259 ARG n 1 260 PHE n 1 261 PRO n 1 262 SER n 1 263 HIS n 1 264 PHE n 1 265 SER n 1 266 SER n 1 267 ASP n 1 268 LEU n 1 269 LYS n 1 270 ASP n 1 271 LEU n 1 272 LEU n 1 273 ARG n 1 274 ASN n 1 275 LEU n 1 276 LEU n 1 277 GLN n 1 278 VAL n 1 279 ASP n 1 280 LEU n 1 281 THR n 1 282 LYS n 1 283 ARG n 1 284 PHE n 1 285 GLY n 1 286 ASN n 1 287 LEU n 1 288 LYS n 1 289 ASN n 1 290 GLY n 1 291 VAL n 1 292 ASN n 1 293 ASP n 1 294 ILE n 1 295 LYS n 1 296 ASN n 1 297 HIS n 1 298 LYS n 1 299 TRP n 1 300 PHE n 1 301 ALA n 1 302 THR n 1 303 THR n 1 304 ASP n 1 305 TRP n 1 306 ILE n 1 307 ALA n 1 308 ILE n 1 309 TYR n 1 310 GLN n 1 311 ARG n 1 312 LYS n 1 313 VAL n 1 314 GLU n 1 315 ALA n 1 316 PRO n 1 317 PHE n 1 318 ILE n 1 319 PRO n 1 320 LYS n 1 321 PHE n 1 322 LYS n 1 323 GLY n 1 324 PRO n 1 325 GLY n 1 326 ASP n 1 327 THR n 1 328 SER n 1 329 ASN n 1 330 PHE n 1 331 ASP n 1 332 ASP n 1 333 TYR n 1 334 GLU n 1 335 GLU n 1 336 GLU n 1 337 GLU n 1 338 ILE n 1 339 ARG n 1 340 VAL n 1 341 SEP n 1 342 ILE n 1 343 ASN n 1 344 GLU n 1 345 LYS n 1 346 CYS n 1 347 GLY n 1 348 LYS n 1 349 GLU n 1 350 PHE n 1 351 THR n 1 352 GLU n 1 353 PHE n 2 1 THR n 2 2 THR n 2 3 TYR n 2 4 ALA n 2 5 ASP n 2 6 PHE n 2 7 ILE n 2 8 ALA n 2 9 SER n 2 10 GLY n 2 11 ARG n 2 12 THR n 2 13 GLY n 2 14 LYS n 2 15 ARG n 2 16 ASN n 2 17 ALA n 2 18 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 353 _entity_src_gen.gene_src_common_name 'Chinese hamster' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PRKACA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue Ovary _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10029 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ Ovary _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Gold pLysS AG' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 18 _pdbx_entity_src_syn.organism_scientific 'Cricetulus griseus' _pdbx_entity_src_syn.organism_common_name 'Chinese hamster' _pdbx_entity_src_syn.ncbi_taxonomy_id 10029 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KAPCA_CRIGR P25321 ? 1 ;MGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; 1 2 UNP A0A061IH64_CRIGR A0A061IH64 ? 2 TTYADFIASGRTGRRNAI 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6ERT A 3 ? 353 ? P25321 1 ? 351 ? 0 350 2 2 6ERT D 1 ? 18 ? A0A061IH64 6 ? 23 ? 8 25 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ERT GLY A 1 ? UNP P25321 ? ? 'expression tag' -2 1 1 6ERT HIS A 2 ? UNP P25321 ? ? 'expression tag' -1 2 2 6ERT LYS D 14 ? UNP A0A061IH64 ARG 19 'engineered mutation' 21 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BVZ non-polymer . '[2-[(4-isoquinolin-5-ylsulfonyl-1,4-diazepan-1-yl)methyl]phenyl]-tris(oxidanyl)boranuide' ? 'C21 H25 B N3 O5 S -1' 442.316 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ERT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;100 mM Mes-Bis-Tris, 75 mM lithium chloride, 1 mM DTT, 0.1 mM sodium EDTA, 0.25 mM Mega 8, 0.7 mM peptidic ligand, 5 mM RKp117, 17% v/v methanol/water in reservoir ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6ERT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 38.542 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36578 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.33 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.04 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.97 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5718 _reflns_shell.percent_possible_all 97.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.42 _reflns_shell.pdbx_Rsym_value 0.503 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.874 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ERT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 38.542 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36575 _refine.ls_number_reflns_R_free 1828 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.85 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1859 _refine.ls_R_factor_R_free 0.2185 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1842 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.27 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2778 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 139 _refine_hist.number_atoms_total 2947 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 38.542 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 2904 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.976 ? 3955 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.304 ? 1699 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 421 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 529 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7968 1.8454 . . 130 2497 95.00 . . . 0.2643 . 0.2360 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8454 1.8997 . . 141 2672 100.00 . . . 0.3188 . 0.2267 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8997 1.9610 . . 139 2654 100.00 . . . 0.2999 . 0.2263 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9610 2.0311 . . 142 2679 100.00 . . . 0.2789 . 0.2161 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0311 2.1124 . . 139 2655 100.00 . . . 0.2569 . 0.2134 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1124 2.2085 . . 140 2662 100.00 . . . 0.2415 . 0.2048 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2085 2.3249 . . 141 2670 100.00 . . . 0.2500 . 0.1915 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3249 2.4706 . . 142 2692 100.00 . . . 0.2176 . 0.1883 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4706 2.6613 . . 141 2687 100.00 . . . 0.2133 . 0.1845 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6613 2.9290 . . 140 2666 99.00 . . . 0.2228 . 0.1918 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9290 3.3527 . . 143 2710 99.00 . . . 0.1934 . 0.1941 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3527 4.2232 . . 142 2697 98.00 . . . 0.2119 . 0.1617 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2232 38.5509 . . 148 2806 97.00 . . . 0.1835 . 0.1611 . . . . . . . . . . # _struct.entry_id 6ERT _struct.title 'Crystal Structure of the Protein-Kinase A catalytic subunit from Criteculus Griseus in complex with compounds RKp193 and RKp117' _struct.pdbx_descriptor 'cAMP-dependent protein kinase catalytic subunit alpha (E.C.2.7.11.11), cAMP-dependent protein kinase inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ERT _struct_keywords.text 'Complex, peptidic ligand, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 16 ? SER A 35 ? GLU A 13 SER A 32 1 ? 20 HELX_P HELX_P2 AA2 GLN A 42 ? ASP A 44 ? GLN A 39 ASP A 41 5 ? 3 HELX_P HELX_P3 AA3 LYS A 79 ? LEU A 85 ? LYS A 76 LEU A 82 1 ? 7 HELX_P HELX_P4 AA4 GLN A 87 ? VAL A 101 ? GLN A 84 VAL A 98 1 ? 15 HELX_P HELX_P5 AA5 GLU A 130 ? GLY A 139 ? GLU A 127 GLY A 136 1 ? 10 HELX_P HELX_P6 AA6 SEP A 142 ? LEU A 163 ? SEP A 139 LEU A 160 1 ? 22 HELX_P HELX_P7 AA7 LYS A 171 ? GLU A 173 ? LYS A 168 GLU A 170 5 ? 3 HELX_P HELX_P8 AA8 THR A 204 ? LEU A 208 ? THR A 201 LEU A 205 5 ? 5 HELX_P HELX_P9 AA9 ALA A 209 ? LEU A 214 ? ALA A 206 LEU A 211 1 ? 6 HELX_P HELX_P10 AB1 LYS A 220 ? GLY A 237 ? LYS A 217 GLY A 234 1 ? 18 HELX_P HELX_P11 AB2 GLN A 245 ? GLY A 256 ? GLN A 242 GLY A 253 1 ? 12 HELX_P HELX_P12 AB3 SER A 265 ? LEU A 276 ? SER A 262 LEU A 273 1 ? 12 HELX_P HELX_P13 AB4 VAL A 291 ? ASN A 296 ? VAL A 288 ASN A 293 1 ? 6 HELX_P HELX_P14 AB5 HIS A 297 ? ALA A 301 ? HIS A 294 ALA A 298 5 ? 5 HELX_P HELX_P15 AB6 ASP A 304 ? GLN A 310 ? ASP A 301 GLN A 307 1 ? 7 HELX_P HELX_P16 AB7 GLY A 347 ? THR A 351 ? GLY A 344 THR A 348 5 ? 5 HELX_P HELX_P17 AB8 THR B 2 ? GLY B 10 ? THR D 9 GLY D 17 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale one ? A GLU 130 OE2 ? ? ? 1_555 C BVZ . B26 ? ? A GLU 127 A BVZ 401 1_555 ? ? ? ? ? ? ? 1.520 ? covale2 covale both ? A PHE 141 C ? ? ? 1_555 A SEP 142 N ? ? A PHE 138 A SEP 139 1_555 ? ? ? ? ? ? ? 1.342 ? covale3 covale both ? A SEP 142 C ? ? ? 1_555 A GLU 143 N ? ? A SEP 139 A GLU 140 1_555 ? ? ? ? ? ? ? 1.341 ? covale4 covale both ? A TRP 199 C ? ? ? 1_555 A TPO 200 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.321 ? covale5 covale both ? A TPO 200 C ? ? ? 1_555 A LEU 201 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.335 ? covale6 covale both ? A VAL 340 C ? ? ? 1_555 A SEP 341 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale both ? A SEP 341 C ? ? ? 1_555 A ILE 342 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 46 ? GLY A 53 ? PHE A 43 GLY A 50 AA1 2 GLY A 58 ? HIS A 65 ? GLY A 55 HIS A 62 AA1 3 HIS A 71 ? ASP A 78 ? HIS A 68 ASP A 75 AA1 4 ASN A 118 ? GLU A 124 ? ASN A 115 GLU A 121 AA1 5 LEU A 109 ? LYS A 114 ? LEU A 106 LYS A 111 AA2 1 LEU A 165 ? ILE A 166 ? LEU A 162 ILE A 163 AA2 2 LYS A 192 ? ARG A 193 ? LYS A 189 ARG A 190 AA3 1 LEU A 175 ? ILE A 177 ? LEU A 172 ILE A 174 AA3 2 ILE A 183 ? VAL A 185 ? ILE A 180 VAL A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 52 ? N LEU A 49 O VAL A 60 ? O VAL A 57 AA1 2 3 N MET A 61 ? N MET A 58 O MET A 74 ? O MET A 71 AA1 3 4 N LYS A 75 ? N LYS A 72 O MET A 121 ? O MET A 118 AA1 4 5 O TYR A 120 ? O TYR A 117 N PHE A 113 ? N PHE A 110 AA2 1 2 N ILE A 166 ? N ILE A 163 O LYS A 192 ? O LYS A 189 AA3 1 2 N LEU A 176 ? N LEU A 173 O GLN A 184 ? O GLN A 181 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BVZ _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue BVZ A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 VAL A 60 ? VAL A 57 . ? 1_555 ? 2 AC1 15 ALA A 73 ? ALA A 70 . ? 1_555 ? 3 AC1 15 MET A 123 ? MET A 120 . ? 1_555 ? 4 AC1 15 GLU A 124 ? GLU A 121 . ? 1_555 ? 5 AC1 15 TYR A 125 ? TYR A 122 . ? 1_555 ? 6 AC1 15 VAL A 126 ? VAL A 123 . ? 1_555 ? 7 AC1 15 GLU A 130 ? GLU A 127 . ? 1_555 ? 8 AC1 15 GLU A 173 ? GLU A 170 . ? 1_555 ? 9 AC1 15 ASN A 174 ? ASN A 171 . ? 1_555 ? 10 AC1 15 LEU A 176 ? LEU A 173 . ? 1_555 ? 11 AC1 15 THR A 186 ? THR A 183 . ? 1_555 ? 12 AC1 15 ASP A 187 ? ASP A 184 . ? 1_555 ? 13 AC1 15 PHE A 330 ? PHE A 327 . ? 1_555 ? 14 AC1 15 LYS B 14 ? LYS D 21 . ? 1_555 ? 15 AC1 15 ARG B 15 ? ARG D 22 . ? 1_555 ? # _atom_sites.entry_id 6ERT _atom_sites.fract_transf_matrix[1][1] 0.014525 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013649 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012973 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol B C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 GLY 4 1 ? ? ? A . n A 1 5 ASN 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 ALA 7 4 ? ? ? A . n A 1 8 ALA 8 5 ? ? ? A . n A 1 9 ALA 9 6 ? ? ? A . n A 1 10 LYS 10 7 ? ? ? A . n A 1 11 LYS 11 8 ? ? ? A . n A 1 12 GLY 12 9 ? ? ? A . n A 1 13 SEP 13 10 ? ? ? A . n A 1 14 GLU 14 11 ? ? ? A . n A 1 15 GLN 15 12 ? ? ? A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 PHE 21 18 18 PHE PHE A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 LYS 26 23 23 LYS LYS A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 PHE 29 26 26 PHE PHE A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 LYS 31 28 28 LYS LYS A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 TRP 33 30 30 TRP TRP A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 SER 35 32 32 SER SER A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 GLN 38 35 35 GLN GLN A . n A 1 39 ASN 39 36 36 ASN ASN A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 GLN 42 39 39 GLN GLN A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 ASP 44 41 41 ASP ASP A . n A 1 45 HIS 45 42 42 HIS HIS A . n A 1 46 PHE 46 43 43 PHE PHE A . n A 1 47 ASP 47 44 44 ASP ASP A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 THR 51 48 48 THR THR A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 SER 56 53 53 SER SER A . n A 1 57 PHE 57 54 54 PHE PHE A . n A 1 58 GLY 58 55 55 GLY GLY A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 MET 61 58 58 MET MET A . n A 1 62 LEU 62 59 59 LEU LEU A . n A 1 63 VAL 63 60 60 VAL VAL A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 HIS 65 62 62 HIS HIS A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 THR 68 65 65 THR THR A . n A 1 69 GLY 69 66 66 GLY GLY A . n A 1 70 ASN 70 67 67 ASN ASN A . n A 1 71 HIS 71 68 68 HIS HIS A . n A 1 72 TYR 72 69 69 TYR TYR A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 MET 74 71 71 MET MET A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 ASP 78 75 75 ASP ASP A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 GLN 80 77 77 GLN GLN A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 LYS 86 83 83 LYS LYS A . n A 1 87 GLN 87 84 84 GLN GLN A . n A 1 88 ILE 88 85 85 ILE ILE A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 ASN 93 90 90 ASN ASN A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 LEU 98 95 95 LEU LEU A . n A 1 99 GLN 99 96 96 GLN GLN A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 ASN 102 99 99 ASN ASN A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 PRO 104 101 101 PRO PRO A . n A 1 105 PHE 105 102 102 PHE PHE A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 VAL 107 104 104 VAL VAL A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 SER 112 109 109 SER SER A . n A 1 113 PHE 113 110 110 PHE PHE A . n A 1 114 LYS 114 111 111 LYS LYS A . n A 1 115 ASP 115 112 112 ASP ASP A . n A 1 116 ASN 116 113 113 ASN ASN A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 ASN 118 115 115 ASN ASN A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 TYR 120 117 117 TYR TYR A . n A 1 121 MET 121 118 118 MET MET A . n A 1 122 VAL 122 119 119 VAL VAL A . n A 1 123 MET 123 120 120 MET MET A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 TYR 125 122 122 TYR TYR A . n A 1 126 VAL 126 123 123 VAL VAL A . n A 1 127 PRO 127 124 124 PRO PRO A . n A 1 128 GLY 128 125 125 GLY GLY A . n A 1 129 GLY 129 126 126 GLY GLY A . n A 1 130 GLU 130 127 127 GLU GLU A . n A 1 131 MET 131 128 128 MET MET A . n A 1 132 PHE 132 129 129 PHE PHE A . n A 1 133 SER 133 130 130 SER SER A . n A 1 134 HIS 134 131 131 HIS HIS A . n A 1 135 LEU 135 132 132 LEU LEU A . n A 1 136 ARG 136 133 133 ARG ARG A . n A 1 137 ARG 137 134 134 ARG ARG A . n A 1 138 ILE 138 135 135 ILE ILE A . n A 1 139 GLY 139 136 136 GLY GLY A . n A 1 140 ARG 140 137 137 ARG ARG A . n A 1 141 PHE 141 138 138 PHE PHE A . n A 1 142 SEP 142 139 139 SEP SEP A . n A 1 143 GLU 143 140 140 GLU GLU A . n A 1 144 PRO 144 141 141 PRO PRO A . n A 1 145 HIS 145 142 142 HIS HIS A . n A 1 146 ALA 146 143 143 ALA ALA A . n A 1 147 ARG 147 144 144 ARG ARG A . n A 1 148 PHE 148 145 145 PHE PHE A . n A 1 149 TYR 149 146 146 TYR TYR A . n A 1 150 ALA 150 147 147 ALA ALA A . n A 1 151 ALA 151 148 148 ALA ALA A . n A 1 152 GLN 152 149 149 GLN GLN A . n A 1 153 ILE 153 150 150 ILE ILE A . n A 1 154 VAL 154 151 151 VAL VAL A . n A 1 155 LEU 155 152 152 LEU LEU A . n A 1 156 THR 156 153 153 THR THR A . n A 1 157 PHE 157 154 154 PHE PHE A . n A 1 158 GLU 158 155 155 GLU GLU A . n A 1 159 TYR 159 156 156 TYR TYR A . n A 1 160 LEU 160 157 157 LEU LEU A . n A 1 161 HIS 161 158 158 HIS HIS A . n A 1 162 SER 162 159 159 SER SER A . n A 1 163 LEU 163 160 160 LEU LEU A . n A 1 164 ASP 164 161 161 ASP ASP A . n A 1 165 LEU 165 162 162 LEU LEU A . n A 1 166 ILE 166 163 163 ILE ILE A . n A 1 167 TYR 167 164 164 TYR TYR A . n A 1 168 ARG 168 165 165 ARG ARG A . n A 1 169 ASP 169 166 166 ASP ASP A . n A 1 170 LEU 170 167 167 LEU LEU A . n A 1 171 LYS 171 168 168 LYS LYS A . n A 1 172 PRO 172 169 169 PRO PRO A . n A 1 173 GLU 173 170 170 GLU GLU A . n A 1 174 ASN 174 171 171 ASN ASN A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 ILE 177 174 174 ILE ILE A . n A 1 178 ASP 178 175 175 ASP ASP A . n A 1 179 GLN 179 176 176 GLN GLN A . n A 1 180 GLN 180 177 177 GLN GLN A . n A 1 181 GLY 181 178 178 GLY GLY A . n A 1 182 TYR 182 179 179 TYR TYR A . n A 1 183 ILE 183 180 180 ILE ILE A . n A 1 184 GLN 184 181 181 GLN GLN A . n A 1 185 VAL 185 182 182 VAL VAL A . n A 1 186 THR 186 183 183 THR THR A . n A 1 187 ASP 187 184 184 ASP ASP A . n A 1 188 PHE 188 185 185 PHE PHE A . n A 1 189 GLY 189 186 186 GLY GLY A . n A 1 190 PHE 190 187 187 PHE PHE A . n A 1 191 ALA 191 188 188 ALA ALA A . n A 1 192 LYS 192 189 189 LYS LYS A . n A 1 193 ARG 193 190 190 ARG ARG A . n A 1 194 VAL 194 191 191 VAL VAL A . n A 1 195 LYS 195 192 192 LYS LYS A . n A 1 196 GLY 196 193 193 GLY GLY A . n A 1 197 ARG 197 194 194 ARG ARG A . n A 1 198 THR 198 195 195 THR THR A . n A 1 199 TRP 199 196 196 TRP TRP A . n A 1 200 TPO 200 197 197 TPO TPO A . n A 1 201 LEU 201 198 198 LEU LEU A . n A 1 202 CYS 202 199 199 CYS CYS A . n A 1 203 GLY 203 200 200 GLY GLY A . n A 1 204 THR 204 201 201 THR THR A . n A 1 205 PRO 205 202 202 PRO PRO A . n A 1 206 GLU 206 203 203 GLU GLU A . n A 1 207 TYR 207 204 204 TYR TYR A . n A 1 208 LEU 208 205 205 LEU LEU A . n A 1 209 ALA 209 206 206 ALA ALA A . n A 1 210 PRO 210 207 207 PRO PRO A . n A 1 211 GLU 211 208 208 GLU GLU A . n A 1 212 ILE 212 209 209 ILE ILE A . n A 1 213 ILE 213 210 210 ILE ILE A . n A 1 214 LEU 214 211 211 LEU LEU A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 LYS 216 213 213 LYS LYS A . n A 1 217 GLY 217 214 214 GLY GLY A . n A 1 218 TYR 218 215 215 TYR TYR A . n A 1 219 ASN 219 216 216 ASN ASN A . n A 1 220 LYS 220 217 217 LYS LYS A . n A 1 221 ALA 221 218 218 ALA ALA A . n A 1 222 VAL 222 219 219 VAL VAL A . n A 1 223 ASP 223 220 220 ASP ASP A . n A 1 224 TRP 224 221 221 TRP TRP A . n A 1 225 TRP 225 222 222 TRP TRP A . n A 1 226 ALA 226 223 223 ALA ALA A . n A 1 227 LEU 227 224 224 LEU LEU A . n A 1 228 GLY 228 225 225 GLY GLY A . n A 1 229 VAL 229 226 226 VAL VAL A . n A 1 230 LEU 230 227 227 LEU LEU A . n A 1 231 ILE 231 228 228 ILE ILE A . n A 1 232 TYR 232 229 229 TYR TYR A . n A 1 233 GLU 233 230 230 GLU GLU A . n A 1 234 MET 234 231 231 MET MET A . n A 1 235 ALA 235 232 232 ALA ALA A . n A 1 236 ALA 236 233 233 ALA ALA A . n A 1 237 GLY 237 234 234 GLY GLY A . n A 1 238 TYR 238 235 235 TYR TYR A . n A 1 239 PRO 239 236 236 PRO PRO A . n A 1 240 PRO 240 237 237 PRO PRO A . n A 1 241 PHE 241 238 238 PHE PHE A . n A 1 242 PHE 242 239 239 PHE PHE A . n A 1 243 ALA 243 240 240 ALA ALA A . n A 1 244 ASP 244 241 241 ASP ASP A . n A 1 245 GLN 245 242 242 GLN GLN A . n A 1 246 PRO 246 243 243 PRO PRO A . n A 1 247 ILE 247 244 244 ILE ILE A . n A 1 248 GLN 248 245 245 GLN GLN A . n A 1 249 ILE 249 246 246 ILE ILE A . n A 1 250 TYR 250 247 247 TYR TYR A . n A 1 251 GLU 251 248 248 GLU GLU A . n A 1 252 LYS 252 249 249 LYS LYS A . n A 1 253 ILE 253 250 250 ILE ILE A . n A 1 254 VAL 254 251 251 VAL VAL A . n A 1 255 SER 255 252 252 SER SER A . n A 1 256 GLY 256 253 253 GLY GLY A . n A 1 257 LYS 257 254 254 LYS LYS A . n A 1 258 VAL 258 255 255 VAL VAL A . n A 1 259 ARG 259 256 256 ARG ARG A . n A 1 260 PHE 260 257 257 PHE PHE A . n A 1 261 PRO 261 258 258 PRO PRO A . n A 1 262 SER 262 259 259 SER SER A . n A 1 263 HIS 263 260 260 HIS HIS A . n A 1 264 PHE 264 261 261 PHE PHE A . n A 1 265 SER 265 262 262 SER SER A . n A 1 266 SER 266 263 263 SER SER A . n A 1 267 ASP 267 264 264 ASP ASP A . n A 1 268 LEU 268 265 265 LEU LEU A . n A 1 269 LYS 269 266 266 LYS LYS A . n A 1 270 ASP 270 267 267 ASP ASP A . n A 1 271 LEU 271 268 268 LEU LEU A . n A 1 272 LEU 272 269 269 LEU LEU A . n A 1 273 ARG 273 270 270 ARG ARG A . n A 1 274 ASN 274 271 271 ASN ASN A . n A 1 275 LEU 275 272 272 LEU LEU A . n A 1 276 LEU 276 273 273 LEU LEU A . n A 1 277 GLN 277 274 274 GLN GLN A . n A 1 278 VAL 278 275 275 VAL VAL A . n A 1 279 ASP 279 276 276 ASP ASP A . n A 1 280 LEU 280 277 277 LEU LEU A . n A 1 281 THR 281 278 278 THR THR A . n A 1 282 LYS 282 279 279 LYS LYS A . n A 1 283 ARG 283 280 280 ARG ARG A . n A 1 284 PHE 284 281 281 PHE PHE A . n A 1 285 GLY 285 282 282 GLY GLY A . n A 1 286 ASN 286 283 283 ASN ASN A . n A 1 287 LEU 287 284 284 LEU LEU A . n A 1 288 LYS 288 285 285 LYS LYS A . n A 1 289 ASN 289 286 286 ASN ASN A . n A 1 290 GLY 290 287 287 GLY GLY A . n A 1 291 VAL 291 288 288 VAL VAL A . n A 1 292 ASN 292 289 289 ASN ASN A . n A 1 293 ASP 293 290 290 ASP ASP A . n A 1 294 ILE 294 291 291 ILE ILE A . n A 1 295 LYS 295 292 292 LYS LYS A . n A 1 296 ASN 296 293 293 ASN ASN A . n A 1 297 HIS 297 294 294 HIS HIS A . n A 1 298 LYS 298 295 295 LYS LYS A . n A 1 299 TRP 299 296 296 TRP TRP A . n A 1 300 PHE 300 297 297 PHE PHE A . n A 1 301 ALA 301 298 298 ALA ALA A . n A 1 302 THR 302 299 299 THR THR A . n A 1 303 THR 303 300 300 THR THR A . n A 1 304 ASP 304 301 301 ASP ASP A . n A 1 305 TRP 305 302 302 TRP TRP A . n A 1 306 ILE 306 303 303 ILE ILE A . n A 1 307 ALA 307 304 304 ALA ALA A . n A 1 308 ILE 308 305 305 ILE ILE A . n A 1 309 TYR 309 306 306 TYR TYR A . n A 1 310 GLN 310 307 307 GLN GLN A . n A 1 311 ARG 311 308 308 ARG ARG A . n A 1 312 LYS 312 309 309 LYS LYS A . n A 1 313 VAL 313 310 310 VAL VAL A . n A 1 314 GLU 314 311 311 GLU GLU A . n A 1 315 ALA 315 312 312 ALA ALA A . n A 1 316 PRO 316 313 313 PRO PRO A . n A 1 317 PHE 317 314 314 PHE PHE A . n A 1 318 ILE 318 315 315 ILE ILE A . n A 1 319 PRO 319 316 316 PRO PRO A . n A 1 320 LYS 320 317 317 LYS LYS A . n A 1 321 PHE 321 318 318 PHE PHE A . n A 1 322 LYS 322 319 319 LYS LYS A . n A 1 323 GLY 323 320 320 GLY GLY A . n A 1 324 PRO 324 321 321 PRO PRO A . n A 1 325 GLY 325 322 322 GLY GLY A . n A 1 326 ASP 326 323 323 ASP ASP A . n A 1 327 THR 327 324 324 THR THR A . n A 1 328 SER 328 325 325 SER SER A . n A 1 329 ASN 329 326 326 ASN ASN A . n A 1 330 PHE 330 327 327 PHE PHE A . n A 1 331 ASP 331 328 328 ASP ASP A . n A 1 332 ASP 332 329 329 ASP ASP A . n A 1 333 TYR 333 330 330 TYR TYR A . n A 1 334 GLU 334 331 331 GLU GLU A . n A 1 335 GLU 335 332 332 GLU GLU A . n A 1 336 GLU 336 333 333 GLU GLU A . n A 1 337 GLU 337 334 334 GLU GLU A . n A 1 338 ILE 338 335 335 ILE ILE A . n A 1 339 ARG 339 336 336 ARG ARG A . n A 1 340 VAL 340 337 337 VAL VAL A . n A 1 341 SEP 341 338 338 SEP SEP A . n A 1 342 ILE 342 339 339 ILE ILE A . n A 1 343 ASN 343 340 340 ASN ASN A . n A 1 344 GLU 344 341 341 GLU GLU A . n A 1 345 LYS 345 342 342 LYS LYS A . n A 1 346 CYS 346 343 343 CYS CYS A . n A 1 347 GLY 347 344 344 GLY GLY A . n A 1 348 LYS 348 345 345 LYS LYS A . n A 1 349 GLU 349 346 346 GLU GLU A . n A 1 350 PHE 350 347 347 PHE PHE A . n A 1 351 THR 351 348 348 THR THR A . n A 1 352 GLU 352 349 349 GLU GLU A . n A 1 353 PHE 353 350 350 PHE PHE A . n B 2 1 THR 1 8 8 THR THR D . n B 2 2 THR 2 9 9 THR THR D . n B 2 3 TYR 3 10 10 TYR TYR D . n B 2 4 ALA 4 11 11 ALA ALA D . n B 2 5 ASP 5 12 12 ASP ASP D . n B 2 6 PHE 6 13 13 PHE PHE D . n B 2 7 ILE 7 14 14 ILE ILE D . n B 2 8 ALA 8 15 15 ALA ALA D . n B 2 9 SER 9 16 16 SER SER D . n B 2 10 GLY 10 17 17 GLY GLY D . n B 2 11 ARG 11 18 18 ARG ARG D . n B 2 12 THR 12 19 19 THR THR D . n B 2 13 GLY 13 20 20 GLY GLY D . n B 2 14 LYS 14 21 21 LYS LYS D . n B 2 15 ARG 15 22 22 ARG ARG D . n B 2 16 ASN 16 23 23 ASN ASN D . n B 2 17 ALA 17 24 24 ALA ALA D . n B 2 18 ILE 18 25 25 ILE ILE D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 BVZ 1 401 1 BVZ XXX A . D 4 HOH 1 501 142 HOH HOH A . D 4 HOH 2 502 67 HOH HOH A . D 4 HOH 3 503 9 HOH HOH A . D 4 HOH 4 504 63 HOH HOH A . D 4 HOH 5 505 39 HOH HOH A . D 4 HOH 6 506 143 HOH HOH A . D 4 HOH 7 507 41 HOH HOH A . D 4 HOH 8 508 77 HOH HOH A . D 4 HOH 9 509 5 HOH HOH A . D 4 HOH 10 510 147 HOH HOH A . D 4 HOH 11 511 145 HOH HOH A . D 4 HOH 12 512 43 HOH HOH A . D 4 HOH 13 513 11 HOH HOH A . D 4 HOH 14 514 42 HOH HOH A . D 4 HOH 15 515 116 HOH HOH A . D 4 HOH 16 516 36 HOH HOH A . D 4 HOH 17 517 59 HOH HOH A . D 4 HOH 18 518 44 HOH HOH A . D 4 HOH 19 519 87 HOH HOH A . D 4 HOH 20 520 136 HOH HOH A . D 4 HOH 21 521 2 HOH HOH A . D 4 HOH 22 522 3 HOH HOH A . D 4 HOH 23 523 26 HOH HOH A . D 4 HOH 24 524 14 HOH HOH A . D 4 HOH 25 525 149 HOH HOH A . D 4 HOH 26 526 4 HOH HOH A . D 4 HOH 27 527 28 HOH HOH A . D 4 HOH 28 528 34 HOH HOH A . D 4 HOH 29 529 134 HOH HOH A . D 4 HOH 30 530 27 HOH HOH A . D 4 HOH 31 531 164 HOH HOH A . D 4 HOH 32 532 12 HOH HOH A . D 4 HOH 33 533 90 HOH HOH A . D 4 HOH 34 534 128 HOH HOH A . D 4 HOH 35 535 10 HOH HOH A . D 4 HOH 36 536 151 HOH HOH A . D 4 HOH 37 537 16 HOH HOH A . D 4 HOH 38 538 20 HOH HOH A . D 4 HOH 39 539 21 HOH HOH A . D 4 HOH 40 540 85 HOH HOH A . D 4 HOH 41 541 157 HOH HOH A . D 4 HOH 42 542 15 HOH HOH A . D 4 HOH 43 543 72 HOH HOH A . D 4 HOH 44 544 154 HOH HOH A . D 4 HOH 45 545 56 HOH HOH A . D 4 HOH 46 546 102 HOH HOH A . D 4 HOH 47 547 139 HOH HOH A . D 4 HOH 48 548 82 HOH HOH A . D 4 HOH 49 549 153 HOH HOH A . D 4 HOH 50 550 50 HOH HOH A . D 4 HOH 51 551 6 HOH HOH A . D 4 HOH 52 552 75 HOH HOH A . D 4 HOH 53 553 86 HOH HOH A . D 4 HOH 54 554 64 HOH HOH A . D 4 HOH 55 555 52 HOH HOH A . D 4 HOH 56 556 71 HOH HOH A . D 4 HOH 57 557 8 HOH HOH A . D 4 HOH 58 558 13 HOH HOH A . D 4 HOH 59 559 62 HOH HOH A . D 4 HOH 60 560 94 HOH HOH A . D 4 HOH 61 561 79 HOH HOH A . D 4 HOH 62 562 40 HOH HOH A . D 4 HOH 63 563 30 HOH HOH A . D 4 HOH 64 564 115 HOH HOH A . D 4 HOH 65 565 22 HOH HOH A . D 4 HOH 66 566 99 HOH HOH A . D 4 HOH 67 567 125 HOH HOH A . D 4 HOH 68 568 25 HOH HOH A . D 4 HOH 69 569 76 HOH HOH A . D 4 HOH 70 570 100 HOH HOH A . D 4 HOH 71 571 60 HOH HOH A . D 4 HOH 72 572 18 HOH HOH A . D 4 HOH 73 573 131 HOH HOH A . D 4 HOH 74 574 32 HOH HOH A . D 4 HOH 75 575 155 HOH HOH A . D 4 HOH 76 576 31 HOH HOH A . D 4 HOH 77 577 37 HOH HOH A . D 4 HOH 78 578 38 HOH HOH A . D 4 HOH 79 579 156 HOH HOH A . D 4 HOH 80 580 78 HOH HOH A . D 4 HOH 81 581 89 HOH HOH A . D 4 HOH 82 582 33 HOH HOH A . D 4 HOH 83 583 70 HOH HOH A . D 4 HOH 84 584 49 HOH HOH A . D 4 HOH 85 585 58 HOH HOH A . D 4 HOH 86 586 48 HOH HOH A . D 4 HOH 87 587 137 HOH HOH A . D 4 HOH 88 588 1 HOH HOH A . D 4 HOH 89 589 129 HOH HOH A . D 4 HOH 90 590 141 HOH HOH A . D 4 HOH 91 591 130 HOH HOH A . D 4 HOH 92 592 46 HOH HOH A . D 4 HOH 93 593 69 HOH HOH A . D 4 HOH 94 594 29 HOH HOH A . D 4 HOH 95 595 53 HOH HOH A . D 4 HOH 96 596 122 HOH HOH A . D 4 HOH 97 597 165 HOH HOH A . D 4 HOH 98 598 47 HOH HOH A . D 4 HOH 99 599 74 HOH HOH A . D 4 HOH 100 600 138 HOH HOH A . D 4 HOH 101 601 144 HOH HOH A . D 4 HOH 102 602 118 HOH HOH A . D 4 HOH 103 603 152 HOH HOH A . D 4 HOH 104 604 158 HOH HOH A . D 4 HOH 105 605 101 HOH HOH A . D 4 HOH 106 606 104 HOH HOH A . D 4 HOH 107 607 159 HOH HOH A . D 4 HOH 108 608 81 HOH HOH A . D 4 HOH 109 609 119 HOH HOH A . D 4 HOH 110 610 80 HOH HOH A . D 4 HOH 111 611 103 HOH HOH A . D 4 HOH 112 612 65 HOH HOH A . D 4 HOH 113 613 163 HOH HOH A . D 4 HOH 114 614 35 HOH HOH A . D 4 HOH 115 615 112 HOH HOH A . D 4 HOH 116 616 123 HOH HOH A . D 4 HOH 117 617 150 HOH HOH A . D 4 HOH 118 618 148 HOH HOH A . D 4 HOH 119 619 84 HOH HOH A . D 4 HOH 120 620 23 HOH HOH A . D 4 HOH 121 621 160 HOH HOH A . D 4 HOH 122 622 88 HOH HOH A . D 4 HOH 123 623 114 HOH HOH A . D 4 HOH 124 624 162 HOH HOH A . D 4 HOH 125 625 73 HOH HOH A . D 4 HOH 126 626 93 HOH HOH A . E 4 HOH 1 101 126 HOH HOH D . E 4 HOH 2 102 7 HOH HOH D . E 4 HOH 3 103 132 HOH HOH D . E 4 HOH 4 104 17 HOH HOH D . E 4 HOH 5 105 133 HOH HOH D . E 4 HOH 6 106 161 HOH HOH D . E 4 HOH 7 107 105 HOH HOH D . E 4 HOH 8 108 113 HOH HOH D . E 4 HOH 9 109 135 HOH HOH D . E 4 HOH 10 110 127 HOH HOH D . E 4 HOH 11 111 140 HOH HOH D . E 4 HOH 12 112 166 HOH HOH D . E 4 HOH 13 113 146 HOH HOH D . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SEP 142 A SEP 139 ? SER 'modified residue' 2 A TPO 200 A TPO 197 ? THR 'modified residue' 3 A SEP 341 A SEP 338 ? SER 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1530 ? 1 MORE -5 ? 1 'SSA (A^2)' 15420 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-31 2 'Structure model' 1 1 2019-05-15 3 'Structure model' 2 0 2019-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Non-polymer description' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' pdbx_entity_nonpoly # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_chem_comp.formula' 9 3 'Structure model' '_chem_comp.name' 10 3 'Structure model' '_entity.pdbx_description' 11 3 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 24.1178 30.7999 15.4325 0.3380 0.3758 0.3364 -0.1284 -0.0401 0.1388 1.2470 0.7224 0.4551 -0.9525 -0.1456 0.0977 -0.1816 -0.2144 0.3254 -0.2454 0.0521 -0.3645 -0.0994 0.3269 0.1531 'X-RAY DIFFRACTION' 2 ? refined 11.6073 16.0547 -3.8559 0.3221 0.3320 0.2319 -0.0221 0.0736 -0.0301 0.3786 0.1812 0.1222 -0.1927 0.1431 -0.1476 0.0583 0.0342 0.0726 -0.3231 -0.0212 0.2177 -0.1296 0.0552 -0.0002 'X-RAY DIFFRACTION' 3 ? refined 9.5491 14.1130 -2.5717 0.2222 0.3296 0.2158 0.0384 -0.0394 -0.0807 1.2466 0.5274 0.9872 0.7986 -0.4690 -0.3192 -0.1687 0.0048 -0.1344 -0.2642 0.0165 0.1525 0.0843 -0.1452 -0.4775 'X-RAY DIFFRACTION' 4 ? refined 12.3294 16.2315 12.8988 0.0907 0.1515 0.1162 0.0129 -0.0104 -0.0096 0.7358 0.4937 0.6433 -0.0904 0.2955 0.1347 0.0273 0.1325 -0.1138 0.0154 -0.0366 0.0366 -0.0262 0.2162 0.0019 'X-RAY DIFFRACTION' 5 ? refined 8.9984 21.1984 17.0535 0.1898 0.1430 0.2021 0.0363 -0.0139 0.0041 0.7208 0.3221 0.1455 0.4654 -0.0352 0.0403 -0.0279 0.0535 0.1507 -0.2295 -0.0709 0.0928 -0.0430 0.0826 -0.0121 'X-RAY DIFFRACTION' 6 ? refined 2.7104 20.9286 26.5195 0.2230 0.1595 0.2274 0.0198 0.0086 -0.0099 0.4147 0.1979 0.2151 0.1365 0.1390 -0.1035 -0.0317 -0.1567 0.0742 0.1093 -0.0050 0.2381 -0.1023 -0.0526 -0.0000 'X-RAY DIFFRACTION' 7 ? refined -6.9835 14.8646 28.5452 0.2253 0.2434 0.4491 0.0457 0.0296 -0.0251 0.9080 0.2486 0.2855 0.0544 -0.2478 -0.2489 0.0783 -0.2967 -0.2094 0.0462 -0.0690 1.0222 -0.0495 -0.2837 -0.0393 'X-RAY DIFFRACTION' 8 ? refined 13.9987 15.6647 33.3095 0.2577 0.2333 0.1586 -0.0150 0.0058 -0.0047 1.3613 1.1205 1.0552 0.0446 0.6465 -0.6027 -0.0365 -0.4858 -0.0089 0.4511 -0.0168 -0.1547 -0.1946 0.2115 -0.0617 'X-RAY DIFFRACTION' 9 ? refined 5.7136 13.9696 -2.2736 0.2523 0.3511 0.3020 0.0026 -0.0351 -0.0073 0.2126 0.3724 0.7137 -0.0270 0.0251 0.5134 -0.0500 0.1479 -0.1042 -0.2172 0.0855 0.1976 0.0577 -0.0203 -0.0001 'X-RAY DIFFRACTION' 10 ? refined -6.9266 2.8374 28.9652 0.2316 0.2005 0.3730 -0.0250 0.0629 -0.0063 0.0525 0.0254 0.0211 -0.0100 0.0209 0.0005 -0.0778 -0.1120 -0.1221 0.1825 0.2349 0.0817 -0.3126 -0.0887 -0.0002 'X-RAY DIFFRACTION' 11 ? refined -4.3561 12.1269 17.9668 0.2799 0.1862 0.3922 0.0460 -0.0457 0.0054 0.0474 0.2513 0.3400 0.0931 0.1013 0.2918 0.0873 0.0642 -0.2004 -0.1900 -0.0057 0.2408 -0.3728 -0.2619 0.0032 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 13 through 31 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 32 through 54 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 55 through 81 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 82 through 160 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 161 through 198 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 199 through 233 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 234 through 252 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 253 through 316 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 317 through 350 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 8 through 16 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 17 through 25 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 144 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 144 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 144 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.10 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.20 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 51 ? ? -105.73 -162.83 2 1 LYS A 319 ? ? -97.85 49.97 3 1 ARG D 18 ? ? -109.88 46.99 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 13 ? CG ? A GLU 16 CG 2 1 Y 1 A GLU 13 ? CD ? A GLU 16 CD 3 1 Y 1 A GLU 13 ? OE1 ? A GLU 16 OE1 4 1 Y 1 A GLU 13 ? OE2 ? A GLU 16 OE2 5 1 Y 1 A SER 14 ? OG ? A SER 17 OG 6 1 Y 1 A LYS 16 ? CG ? A LYS 19 CG 7 1 Y 1 A LYS 16 ? CD ? A LYS 19 CD 8 1 Y 1 A LYS 16 ? CE ? A LYS 19 CE 9 1 Y 1 A LYS 16 ? NZ ? A LYS 19 NZ 10 1 Y 1 A GLU 17 ? CG ? A GLU 20 CG 11 1 Y 1 A GLU 17 ? CD ? A GLU 20 CD 12 1 Y 1 A GLU 17 ? OE1 ? A GLU 20 OE1 13 1 Y 1 A GLU 17 ? OE2 ? A GLU 20 OE2 14 1 Y 1 A LYS 21 ? CD ? A LYS 24 CD 15 1 Y 1 A LYS 21 ? CE ? A LYS 24 CE 16 1 Y 1 A LYS 21 ? NZ ? A LYS 24 NZ 17 1 Y 1 A LYS 23 ? CE ? A LYS 26 CE 18 1 Y 1 A LYS 23 ? NZ ? A LYS 26 NZ 19 1 Y 1 A GLU 24 ? CG ? A GLU 27 CG 20 1 Y 1 A GLU 24 ? CD ? A GLU 27 CD 21 1 Y 1 A GLU 24 ? OE1 ? A GLU 27 OE1 22 1 Y 1 A GLU 24 ? OE2 ? A GLU 27 OE2 23 1 Y 1 A LYS 28 ? CG ? A LYS 31 CG 24 1 Y 1 A LYS 28 ? CD ? A LYS 31 CD 25 1 Y 1 A LYS 28 ? CE ? A LYS 31 CE 26 1 Y 1 A LYS 28 ? NZ ? A LYS 31 NZ 27 1 Y 1 A LYS 29 ? NZ ? A LYS 32 NZ 28 1 Y 1 A ARG 45 ? CG ? A ARG 48 CG 29 1 Y 1 A ARG 45 ? CD ? A ARG 48 CD 30 1 Y 1 A ARG 45 ? NE ? A ARG 48 NE 31 1 Y 1 A ARG 45 ? CZ ? A ARG 48 CZ 32 1 Y 1 A ARG 45 ? NH1 ? A ARG 48 NH1 33 1 Y 1 A ARG 45 ? NH2 ? A ARG 48 NH2 34 1 Y 1 A THR 51 ? OG1 ? A THR 54 OG1 35 1 Y 1 A THR 51 ? CG2 ? A THR 54 CG2 36 1 Y 1 A SER 53 ? OG ? A SER 56 OG 37 1 Y 1 A LYS 63 ? NZ ? A LYS 66 NZ 38 1 Y 1 A GLU 64 ? CG ? A GLU 67 CG 39 1 Y 1 A GLU 64 ? CD ? A GLU 67 CD 40 1 Y 1 A GLU 64 ? OE1 ? A GLU 67 OE1 41 1 Y 1 A GLU 64 ? OE2 ? A GLU 67 OE2 42 1 Y 1 A LYS 78 ? CD ? A LYS 81 CD 43 1 Y 1 A LYS 78 ? CE ? A LYS 81 CE 44 1 Y 1 A LYS 78 ? NZ ? A LYS 81 NZ 45 1 Y 1 A LYS 81 ? CG ? A LYS 84 CG 46 1 Y 1 A LYS 81 ? CD ? A LYS 84 CD 47 1 Y 1 A LYS 81 ? CE ? A LYS 84 CE 48 1 Y 1 A LYS 81 ? NZ ? A LYS 84 NZ 49 1 Y 1 A LYS 83 ? CG ? A LYS 86 CG 50 1 Y 1 A LYS 83 ? CD ? A LYS 86 CD 51 1 Y 1 A LYS 83 ? CE ? A LYS 86 CE 52 1 Y 1 A LYS 83 ? NZ ? A LYS 86 NZ 53 1 Y 1 A LYS 105 ? CD ? A LYS 108 CD 54 1 Y 1 A LYS 105 ? CE ? A LYS 108 CE 55 1 Y 1 A LYS 105 ? NZ ? A LYS 108 NZ 56 1 Y 1 A ILE 135 ? CG1 ? A ILE 138 CG1 57 1 Y 1 A ILE 135 ? CD1 ? A ILE 138 CD1 58 1 Y 1 A GLN 176 ? CG ? A GLN 179 CG 59 1 Y 1 A GLN 176 ? CD ? A GLN 179 CD 60 1 Y 1 A GLN 176 ? OE1 ? A GLN 179 OE1 61 1 Y 1 A GLN 176 ? NE2 ? A GLN 179 NE2 62 1 Y 1 A ARG 190 ? NE ? A ARG 193 NE 63 1 Y 1 A ARG 190 ? CZ ? A ARG 193 CZ 64 1 Y 1 A ARG 190 ? NH1 ? A ARG 193 NH1 65 1 Y 1 A ARG 190 ? NH2 ? A ARG 193 NH2 66 1 Y 1 A VAL 191 ? CG1 ? A VAL 194 CG1 67 1 Y 1 A VAL 191 ? CG2 ? A VAL 194 CG2 68 1 Y 1 A LYS 192 ? CG ? A LYS 195 CG 69 1 Y 1 A LYS 192 ? CD ? A LYS 195 CD 70 1 Y 1 A LYS 192 ? CE ? A LYS 195 CE 71 1 Y 1 A LYS 192 ? NZ ? A LYS 195 NZ 72 1 Y 1 A LYS 213 ? CD ? A LYS 216 CD 73 1 Y 1 A LYS 213 ? CE ? A LYS 216 CE 74 1 Y 1 A LYS 213 ? NZ ? A LYS 216 NZ 75 1 Y 1 A LYS 217 ? CE ? A LYS 220 CE 76 1 Y 1 A LYS 217 ? NZ ? A LYS 220 NZ 77 1 Y 1 A ILE 244 ? CG1 ? A ILE 247 CG1 78 1 Y 1 A ILE 244 ? CG2 ? A ILE 247 CG2 79 1 Y 1 A ILE 244 ? CD1 ? A ILE 247 CD1 80 1 Y 1 A GLU 248 ? CG ? A GLU 251 CG 81 1 Y 1 A GLU 248 ? CD ? A GLU 251 CD 82 1 Y 1 A GLU 248 ? OE1 ? A GLU 251 OE1 83 1 Y 1 A GLU 248 ? OE2 ? A GLU 251 OE2 84 1 Y 1 A LYS 249 ? CE ? A LYS 252 CE 85 1 Y 1 A LYS 249 ? NZ ? A LYS 252 NZ 86 1 Y 1 A VAL 255 ? CG1 ? A VAL 258 CG1 87 1 Y 1 A VAL 255 ? CG2 ? A VAL 258 CG2 88 1 Y 1 A ARG 256 ? CG ? A ARG 259 CG 89 1 Y 1 A ARG 256 ? CD ? A ARG 259 CD 90 1 Y 1 A ARG 256 ? NE ? A ARG 259 NE 91 1 Y 1 A ARG 256 ? CZ ? A ARG 259 CZ 92 1 Y 1 A ARG 256 ? NH1 ? A ARG 259 NH1 93 1 Y 1 A ARG 256 ? NH2 ? A ARG 259 NH2 94 1 Y 1 A LYS 279 ? CG ? A LYS 282 CG 95 1 Y 1 A LYS 279 ? CD ? A LYS 282 CD 96 1 Y 1 A LYS 279 ? CE ? A LYS 282 CE 97 1 Y 1 A LYS 279 ? NZ ? A LYS 282 NZ 98 1 Y 1 A LYS 285 ? CG ? A LYS 288 CG 99 1 Y 1 A LYS 285 ? CD ? A LYS 288 CD 100 1 Y 1 A LYS 285 ? CE ? A LYS 288 CE 101 1 Y 1 A LYS 285 ? NZ ? A LYS 288 NZ 102 1 Y 1 A VAL 288 ? CG1 ? A VAL 291 CG1 103 1 Y 1 A VAL 288 ? CG2 ? A VAL 291 CG2 104 1 Y 1 A LYS 295 ? NZ ? A LYS 298 NZ 105 1 Y 1 A ILE 303 ? CD1 ? A ILE 306 CD1 106 1 Y 1 A LYS 309 ? CE ? A LYS 312 CE 107 1 Y 1 A LYS 309 ? NZ ? A LYS 312 NZ 108 1 Y 1 A GLU 311 ? CG ? A GLU 314 CG 109 1 Y 1 A GLU 311 ? CD ? A GLU 314 CD 110 1 Y 1 A GLU 311 ? OE1 ? A GLU 314 OE1 111 1 Y 1 A GLU 311 ? OE2 ? A GLU 314 OE2 112 1 Y 1 A LYS 317 ? CG ? A LYS 320 CG 113 1 Y 1 A LYS 317 ? CD ? A LYS 320 CD 114 1 Y 1 A LYS 317 ? CE ? A LYS 320 CE 115 1 Y 1 A LYS 317 ? NZ ? A LYS 320 NZ 116 1 Y 1 A PHE 318 ? CG ? A PHE 321 CG 117 1 Y 1 A PHE 318 ? CD1 ? A PHE 321 CD1 118 1 Y 1 A PHE 318 ? CD2 ? A PHE 321 CD2 119 1 Y 1 A PHE 318 ? CE1 ? A PHE 321 CE1 120 1 Y 1 A PHE 318 ? CE2 ? A PHE 321 CE2 121 1 Y 1 A PHE 318 ? CZ ? A PHE 321 CZ 122 1 Y 1 A LYS 319 ? CG ? A LYS 322 CG 123 1 Y 1 A LYS 319 ? CD ? A LYS 322 CD 124 1 Y 1 A LYS 319 ? CE ? A LYS 322 CE 125 1 Y 1 A LYS 319 ? NZ ? A LYS 322 NZ 126 1 Y 1 A GLU 331 ? CG ? A GLU 334 CG 127 1 Y 1 A GLU 331 ? CD ? A GLU 334 CD 128 1 Y 1 A GLU 331 ? OE1 ? A GLU 334 OE1 129 1 Y 1 A GLU 331 ? OE2 ? A GLU 334 OE2 130 1 Y 1 A GLU 333 ? CG ? A GLU 336 CG 131 1 Y 1 A GLU 333 ? CD ? A GLU 336 CD 132 1 Y 1 A GLU 333 ? OE1 ? A GLU 336 OE1 133 1 Y 1 A GLU 333 ? OE2 ? A GLU 336 OE2 134 1 Y 1 A GLU 334 ? CG ? A GLU 337 CG 135 1 Y 1 A GLU 334 ? CD ? A GLU 337 CD 136 1 Y 1 A GLU 334 ? OE1 ? A GLU 337 OE1 137 1 Y 1 A GLU 334 ? OE2 ? A GLU 337 OE2 138 1 Y 1 A ILE 335 ? CG1 ? A ILE 338 CG1 139 1 Y 1 A ILE 335 ? CD1 ? A ILE 338 CD1 140 1 Y 1 A ARG 336 ? CG ? A ARG 339 CG 141 1 Y 1 A ARG 336 ? CD ? A ARG 339 CD 142 1 Y 1 A ARG 336 ? NE ? A ARG 339 NE 143 1 Y 1 A ARG 336 ? CZ ? A ARG 339 CZ 144 1 Y 1 A ARG 336 ? NH1 ? A ARG 339 NH1 145 1 Y 1 A ARG 336 ? NH2 ? A ARG 339 NH2 146 1 Y 1 A ILE 339 ? CG1 ? A ILE 342 CG1 147 1 Y 1 A ILE 339 ? CG2 ? A ILE 342 CG2 148 1 Y 1 A ILE 339 ? CD1 ? A ILE 342 CD1 149 1 Y 1 A LYS 342 ? NZ ? A LYS 345 NZ 150 1 Y 1 A LYS 345 ? CG ? A LYS 348 CG 151 1 Y 1 A LYS 345 ? CD ? A LYS 348 CD 152 1 Y 1 A LYS 345 ? CE ? A LYS 348 CE 153 1 Y 1 A LYS 345 ? NZ ? A LYS 348 NZ 154 1 Y 1 A GLU 349 ? OE1 ? A GLU 352 OE1 155 1 Y 1 A GLU 349 ? OE2 ? A GLU 352 OE2 156 1 Y 1 D LYS 21 ? CG ? B LYS 14 CG 157 1 Y 1 D LYS 21 ? CD ? B LYS 14 CD 158 1 Y 1 D LYS 21 ? CE ? B LYS 14 CE 159 1 Y 1 D LYS 21 ? NZ ? B LYS 14 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A HIS -1 ? A HIS 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A GLY 1 ? A GLY 4 5 1 Y 1 A ASN 2 ? A ASN 5 6 1 Y 1 A ALA 3 ? A ALA 6 7 1 Y 1 A ALA 4 ? A ALA 7 8 1 Y 1 A ALA 5 ? A ALA 8 9 1 Y 1 A ALA 6 ? A ALA 9 10 1 Y 1 A LYS 7 ? A LYS 10 11 1 Y 1 A LYS 8 ? A LYS 11 12 1 Y 1 A GLY 9 ? A GLY 12 13 1 Y 1 A SEP 10 ? A SEP 13 14 1 Y 1 A GLU 11 ? A GLU 14 15 1 Y 1 A GLN 12 ? A GLN 15 # _pdbx_audit_support.funding_organization 'Loewe Corporation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BVZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BVZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '[2-[(4-isoquinolin-5-ylsulfonyl-1,4-diazepan-1-yl)methyl]phenyl]-tris(oxidanyl)boranuide' BVZ 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #