data_6EVL # _entry.id 6EVL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EVL pdb_00006evl 10.2210/pdb6evl/pdb WWPDB D_1200007296 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-12 2 'Structure model' 1 1 2018-10-31 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EVL _pdbx_database_status.recvd_initial_deposition_date 2017-11-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Murthy, A.V.' 1 ? 'Sulu, R.' 2 ? 'Koski, M.K.' 3 ? 'Wierenga, R.K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1692 _citation.page_last 1703 _citation.title ;Structural enzymology binding studies of the peptide-substrate-binding domain of human collagen prolyl 4-hydroxylase (type-II): High affinity peptides have a PxGP sequence motif. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3450 _citation.pdbx_database_id_PubMed 30168208 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Murthy, A.V.' 1 ? primary 'Sulu, R.' 2 ? primary 'Koski, M.K.' 3 ? primary 'Tu, H.' 4 ? primary 'Anantharajan, J.' 5 ? primary 'Sah-Teli, S.K.' 6 ? primary 'Myllyharju, J.' 7 ? primary 'Wierenga, R.K.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Prolyl 4-hydroxylase subunit alpha-2' 11920.266 1 1.14.11.2 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 4 non-polymer syn GLYCINE 75.067 2 ? ? ? ? 5 water nat water 18.015 122 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '4-PH alpha-2,Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLS LDPSHERAGGNLRYFEQLLEEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLS LDPSHERAGGNLRYFEQLLEEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'DIMETHYL SULFOXIDE' DMS 4 GLYCINE GLY 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 LEU n 1 10 SER n 1 11 VAL n 1 12 ASP n 1 13 ASP n 1 14 CYS n 1 15 PHE n 1 16 GLY n 1 17 MET n 1 18 GLY n 1 19 ARG n 1 20 SER n 1 21 ALA n 1 22 TYR n 1 23 ASN n 1 24 GLU n 1 25 GLY n 1 26 ASP n 1 27 TYR n 1 28 TYR n 1 29 HIS n 1 30 THR n 1 31 VAL n 1 32 LEU n 1 33 TRP n 1 34 MET n 1 35 GLU n 1 36 GLN n 1 37 VAL n 1 38 LEU n 1 39 LYS n 1 40 GLN n 1 41 LEU n 1 42 ASP n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 GLU n 1 47 ALA n 1 48 THR n 1 49 THR n 1 50 THR n 1 51 LYS n 1 52 SER n 1 53 GLN n 1 54 VAL n 1 55 LEU n 1 56 ASP n 1 57 TYR n 1 58 LEU n 1 59 SER n 1 60 TYR n 1 61 ALA n 1 62 VAL n 1 63 PHE n 1 64 GLN n 1 65 LEU n 1 66 GLY n 1 67 ASP n 1 68 LEU n 1 69 HIS n 1 70 ARG n 1 71 ALA n 1 72 LEU n 1 73 GLU n 1 74 LEU n 1 75 THR n 1 76 ARG n 1 77 ARG n 1 78 LEU n 1 79 LEU n 1 80 SER n 1 81 LEU n 1 82 ASP n 1 83 PRO n 1 84 SER n 1 85 HIS n 1 86 GLU n 1 87 ARG n 1 88 ALA n 1 89 GLY n 1 90 GLY n 1 91 ASN n 1 92 LEU n 1 93 ARG n 1 94 TYR n 1 95 PHE n 1 96 GLU n 1 97 GLN n 1 98 LEU n 1 99 LEU n 1 100 GLU n 1 101 GLU n 1 102 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'P4HA2, UNQ290/PRO330' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta (DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET22b(+)' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 137 ? ? ? A . n A 1 2 HIS 2 138 ? ? ? A . n A 1 3 HIS 3 139 ? ? ? A . n A 1 4 HIS 4 140 ? ? ? A . n A 1 5 HIS 5 141 ? ? ? A . n A 1 6 HIS 6 142 ? ? ? A . n A 1 7 HIS 7 143 ? ? ? A . n A 1 8 MET 8 144 144 MET MET A . n A 1 9 LEU 9 145 145 LEU LEU A . n A 1 10 SER 10 146 146 SER SER A . n A 1 11 VAL 11 147 147 VAL VAL A . n A 1 12 ASP 12 148 148 ASP ASP A . n A 1 13 ASP 13 149 149 ASP ASP A . n A 1 14 CYS 14 150 150 CYS CYS A . n A 1 15 PHE 15 151 151 PHE PHE A . n A 1 16 GLY 16 152 152 GLY GLY A . n A 1 17 MET 17 153 153 MET MET A . n A 1 18 GLY 18 154 154 GLY GLY A . n A 1 19 ARG 19 155 155 ARG ARG A . n A 1 20 SER 20 156 156 SER SER A . n A 1 21 ALA 21 157 157 ALA ALA A . n A 1 22 TYR 22 158 158 TYR TYR A . n A 1 23 ASN 23 159 159 ASN ASN A . n A 1 24 GLU 24 160 160 GLU GLU A . n A 1 25 GLY 25 161 161 GLY GLY A . n A 1 26 ASP 26 162 162 ASP ASP A . n A 1 27 TYR 27 163 163 TYR TYR A . n A 1 28 TYR 28 164 164 TYR TYR A . n A 1 29 HIS 29 165 165 HIS HIS A . n A 1 30 THR 30 166 166 THR THR A . n A 1 31 VAL 31 167 167 VAL VAL A . n A 1 32 LEU 32 168 168 LEU LEU A . n A 1 33 TRP 33 169 169 TRP TRP A . n A 1 34 MET 34 170 170 MET MET A . n A 1 35 GLU 35 171 171 GLU GLU A . n A 1 36 GLN 36 172 172 GLN GLN A . n A 1 37 VAL 37 173 173 VAL VAL A . n A 1 38 LEU 38 174 174 LEU LEU A . n A 1 39 LYS 39 175 175 LYS LYS A . n A 1 40 GLN 40 176 176 GLN GLN A . n A 1 41 LEU 41 177 177 LEU LEU A . n A 1 42 ASP 42 178 178 ASP ASP A . n A 1 43 ALA 43 179 179 ALA ALA A . n A 1 44 GLY 44 180 180 GLY GLY A . n A 1 45 GLU 45 181 181 GLU GLU A . n A 1 46 GLU 46 182 182 GLU GLU A . n A 1 47 ALA 47 183 183 ALA ALA A . n A 1 48 THR 48 184 184 THR THR A . n A 1 49 THR 49 185 185 THR THR A . n A 1 50 THR 50 186 186 THR THR A . n A 1 51 LYS 51 187 187 LYS LYS A . n A 1 52 SER 52 188 188 SER SER A . n A 1 53 GLN 53 189 189 GLN GLN A . n A 1 54 VAL 54 190 190 VAL VAL A . n A 1 55 LEU 55 191 191 LEU LEU A . n A 1 56 ASP 56 192 192 ASP ASP A . n A 1 57 TYR 57 193 193 TYR TYR A . n A 1 58 LEU 58 194 194 LEU LEU A . n A 1 59 SER 59 195 195 SER SER A . n A 1 60 TYR 60 196 196 TYR TYR A . n A 1 61 ALA 61 197 197 ALA ALA A . n A 1 62 VAL 62 198 198 VAL VAL A . n A 1 63 PHE 63 199 199 PHE PHE A . n A 1 64 GLN 64 200 200 GLN GLN A . n A 1 65 LEU 65 201 201 LEU LEU A . n A 1 66 GLY 66 202 202 GLY GLY A . n A 1 67 ASP 67 203 203 ASP ASP A . n A 1 68 LEU 68 204 204 LEU LEU A . n A 1 69 HIS 69 205 205 HIS HIS A . n A 1 70 ARG 70 206 206 ARG ARG A . n A 1 71 ALA 71 207 207 ALA ALA A . n A 1 72 LEU 72 208 208 LEU LEU A . n A 1 73 GLU 73 209 209 GLU GLU A . n A 1 74 LEU 74 210 210 LEU LEU A . n A 1 75 THR 75 211 211 THR THR A . n A 1 76 ARG 76 212 212 ARG ARG A . n A 1 77 ARG 77 213 213 ARG ARG A . n A 1 78 LEU 78 214 214 LEU LEU A . n A 1 79 LEU 79 215 215 LEU LEU A . n A 1 80 SER 80 216 216 SER SER A . n A 1 81 LEU 81 217 217 LEU LEU A . n A 1 82 ASP 82 218 218 ASP ASP A . n A 1 83 PRO 83 219 219 PRO PRO A . n A 1 84 SER 84 220 220 SER SER A . n A 1 85 HIS 85 221 221 HIS HIS A . n A 1 86 GLU 86 222 222 GLU GLU A . n A 1 87 ARG 87 223 223 ARG ARG A . n A 1 88 ALA 88 224 224 ALA ALA A . n A 1 89 GLY 89 225 225 GLY GLY A . n A 1 90 GLY 90 226 226 GLY GLY A . n A 1 91 ASN 91 227 227 ASN ASN A . n A 1 92 LEU 92 228 228 LEU LEU A . n A 1 93 ARG 93 229 229 ARG ARG A . n A 1 94 TYR 94 230 230 TYR TYR A . n A 1 95 PHE 95 231 231 PHE PHE A . n A 1 96 GLU 96 232 232 GLU GLU A . n A 1 97 GLN 97 233 233 GLN GLN A . n A 1 98 LEU 98 234 234 LEU LEU A . n A 1 99 LEU 99 235 235 LEU LEU A . n A 1 100 GLU 100 236 236 GLU GLU A . n A 1 101 GLU 101 237 237 GLU GLU A . n A 1 102 GLU 102 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 3 DMS 1 302 1 DMS DMS A . D 4 GLY 1 303 1 GLY GLY A . E 4 GLY 1 304 2 GLY GLY A . F 5 HOH 1 401 56 HOH HOH A . F 5 HOH 2 402 110 HOH HOH A . F 5 HOH 3 403 109 HOH HOH A . F 5 HOH 4 404 121 HOH HOH A . F 5 HOH 5 405 33 HOH HOH A . F 5 HOH 6 406 86 HOH HOH A . F 5 HOH 7 407 101 HOH HOH A . F 5 HOH 8 408 36 HOH HOH A . F 5 HOH 9 409 114 HOH HOH A . F 5 HOH 10 410 66 HOH HOH A . F 5 HOH 11 411 97 HOH HOH A . F 5 HOH 12 412 7 HOH HOH A . F 5 HOH 13 413 112 HOH HOH A . F 5 HOH 14 414 122 HOH HOH A . F 5 HOH 15 415 31 HOH HOH A . F 5 HOH 16 416 62 HOH HOH A . F 5 HOH 17 417 1 HOH HOH A . F 5 HOH 18 418 17 HOH HOH A . F 5 HOH 19 419 32 HOH HOH A . F 5 HOH 20 420 120 HOH HOH A . F 5 HOH 21 421 39 HOH HOH A . F 5 HOH 22 422 75 HOH HOH A . F 5 HOH 23 423 16 HOH HOH A . F 5 HOH 24 424 21 HOH HOH A . F 5 HOH 25 425 30 HOH HOH A . F 5 HOH 26 426 24 HOH HOH A . F 5 HOH 27 427 11 HOH HOH A . F 5 HOH 28 428 22 HOH HOH A . F 5 HOH 29 429 51 HOH HOH A . F 5 HOH 30 430 8 HOH HOH A . F 5 HOH 31 431 6 HOH HOH A . F 5 HOH 32 432 95 HOH HOH A . F 5 HOH 33 433 107 HOH HOH A . F 5 HOH 34 434 4 HOH HOH A . F 5 HOH 35 435 25 HOH HOH A . F 5 HOH 36 436 38 HOH HOH A . F 5 HOH 37 437 96 HOH HOH A . F 5 HOH 38 438 72 HOH HOH A . F 5 HOH 39 439 27 HOH HOH A . F 5 HOH 40 440 74 HOH HOH A . F 5 HOH 41 441 23 HOH HOH A . F 5 HOH 42 442 63 HOH HOH A . F 5 HOH 43 443 67 HOH HOH A . F 5 HOH 44 444 13 HOH HOH A . F 5 HOH 45 445 5 HOH HOH A . F 5 HOH 46 446 94 HOH HOH A . F 5 HOH 47 447 106 HOH HOH A . F 5 HOH 48 448 115 HOH HOH A . F 5 HOH 49 449 54 HOH HOH A . F 5 HOH 50 450 26 HOH HOH A . F 5 HOH 51 451 99 HOH HOH A . F 5 HOH 52 452 111 HOH HOH A . F 5 HOH 53 453 87 HOH HOH A . F 5 HOH 54 454 20 HOH HOH A . F 5 HOH 55 455 41 HOH HOH A . F 5 HOH 56 456 28 HOH HOH A . F 5 HOH 57 457 2 HOH HOH A . F 5 HOH 58 458 49 HOH HOH A . F 5 HOH 59 459 42 HOH HOH A . F 5 HOH 60 460 57 HOH HOH A . F 5 HOH 61 461 77 HOH HOH A . F 5 HOH 62 462 108 HOH HOH A . F 5 HOH 63 463 52 HOH HOH A . F 5 HOH 64 464 29 HOH HOH A . F 5 HOH 65 465 10 HOH HOH A . F 5 HOH 66 466 40 HOH HOH A . F 5 HOH 67 467 14 HOH HOH A . F 5 HOH 68 468 15 HOH HOH A . F 5 HOH 69 469 9 HOH HOH A . F 5 HOH 70 470 64 HOH HOH A . F 5 HOH 71 471 80 HOH HOH A . F 5 HOH 72 472 59 HOH HOH A . F 5 HOH 73 473 12 HOH HOH A . F 5 HOH 74 474 116 HOH HOH A . F 5 HOH 75 475 3 HOH HOH A . F 5 HOH 76 476 100 HOH HOH A . F 5 HOH 77 477 82 HOH HOH A . F 5 HOH 78 478 85 HOH HOH A . F 5 HOH 79 479 19 HOH HOH A . F 5 HOH 80 480 69 HOH HOH A . F 5 HOH 81 481 79 HOH HOH A . F 5 HOH 82 482 93 HOH HOH A . F 5 HOH 83 483 104 HOH HOH A . F 5 HOH 84 484 88 HOH HOH A . F 5 HOH 85 485 45 HOH HOH A . F 5 HOH 86 486 117 HOH HOH A . F 5 HOH 87 487 53 HOH HOH A . F 5 HOH 88 488 102 HOH HOH A . F 5 HOH 89 489 90 HOH HOH A . F 5 HOH 90 490 118 HOH HOH A . F 5 HOH 91 491 34 HOH HOH A . F 5 HOH 92 492 83 HOH HOH A . F 5 HOH 93 493 89 HOH HOH A . F 5 HOH 94 494 98 HOH HOH A . F 5 HOH 95 495 65 HOH HOH A . F 5 HOH 96 496 91 HOH HOH A . F 5 HOH 97 497 55 HOH HOH A . F 5 HOH 98 498 73 HOH HOH A . F 5 HOH 99 499 103 HOH HOH A . F 5 HOH 100 500 58 HOH HOH A . F 5 HOH 101 501 70 HOH HOH A . F 5 HOH 102 502 81 HOH HOH A . F 5 HOH 103 503 113 HOH HOH A . F 5 HOH 104 504 18 HOH HOH A . F 5 HOH 105 505 119 HOH HOH A . F 5 HOH 106 506 76 HOH HOH A . F 5 HOH 107 507 92 HOH HOH A . F 5 HOH 108 508 35 HOH HOH A . F 5 HOH 109 509 61 HOH HOH A . F 5 HOH 110 510 44 HOH HOH A . F 5 HOH 111 511 84 HOH HOH A . F 5 HOH 112 512 43 HOH HOH A . F 5 HOH 113 513 37 HOH HOH A . F 5 HOH 114 514 50 HOH HOH A . F 5 HOH 115 515 68 HOH HOH A . F 5 HOH 116 516 48 HOH HOH A . F 5 HOH 117 517 60 HOH HOH A . F 5 HOH 118 518 47 HOH HOH A . F 5 HOH 119 519 71 HOH HOH A . F 5 HOH 120 520 78 HOH HOH A . F 5 HOH 121 521 105 HOH HOH A . F 5 HOH 122 522 46 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XPREP ? ? ? 'Proteum 2 package' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SADABS ? ? ? 'Proteum 2 package' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6EVL _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.449 _cell.length_a_esd ? _cell.length_b 55.449 _cell.length_b_esd ? _cell.length_c 71.705 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EVL _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EVL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.03 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.45 M ammonium sulphate, 10% DMSO, 100 mM MOPS, pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'HELIOS MX MIRRORS' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Nonius Kappa CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER AXS MICROSTAR' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6EVL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.87 _reflns.d_resolution_low 48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10985 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.3 _reflns.pdbx_Rmerge_I_obs 0.139 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.87 _reflns_shell.d_res_low 1.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 523 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.629 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.298 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EVL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.870 _refine.ls_d_res_low 48.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10951 _refine.ls_number_reflns_R_free 2071 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.65 _refine.ls_percent_reflns_R_free 10.18 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1861 _refine.ls_R_factor_R_free 0.2243 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1818 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB code 2V5F' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.95 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 760 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 122 _refine_hist.number_atoms_total 901 _refine_hist.d_res_high 1.870 _refine_hist.d_res_low 48.0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 834 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.759 ? 1131 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 7.554 ? 663 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 119 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 147 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8700 1.9135 . . 137 1221 97.00 . . . 0.3986 . 0.3314 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9135 1.9614 . . 134 1199 100.00 . . . 0.3682 . 0.2833 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9614 2.0144 . . 137 1236 100.00 . . . 0.2660 . 0.2722 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0144 2.0737 . . 136 1189 100.00 . . . 0.2403 . 0.2495 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0737 2.1406 . . 140 1240 100.00 . . . 0.2655 . 0.2168 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1406 2.2171 . . 148 1228 100.00 . . . 0.2771 . 0.2087 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2171 2.3059 . . 138 1216 100.00 . . . 0.2364 . 0.1898 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3059 2.4109 . . 135 1235 100.00 . . . 0.2210 . 0.1647 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4109 2.5379 . . 130 1213 100.00 . . . 0.2130 . 0.1661 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5379 2.6969 . . 142 1204 100.00 . . . 0.2259 . 0.1663 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6969 2.9052 . . 126 1245 100.00 . . . 0.1980 . 0.1584 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9052 3.1975 . . 140 1210 100.00 . . . 0.2443 . 0.1505 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1975 3.6600 . . 138 1237 100.00 . . . 0.1991 . 0.1480 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6600 4.6106 . . 142 1206 100.00 . . . 0.1536 . 0.1198 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6106 48.0361 . . 148 1198 98.00 . . . 0.1723 . 0.1627 . . . . . . . . . . # _struct.entry_id 6EVL _struct.title 'Crystal structure of an unlignaded peptide-substrate-binding domain of human type II collagen prolyl 4-hydroxylase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EVL _struct_keywords.text 'tetratricopeptide repeat, collagen synthesis, prolyl 4-hydroxylase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P4HA2_HUMAN _struct_ref.pdbx_db_accession O15460 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHER AGGNLRYFEQLLEEE ; _struct_ref.pdbx_align_begin 163 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EVL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15460 _struct_ref_seq.db_align_beg 163 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 257 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 144 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EVL MET A 1 ? UNP O15460 ? ? 'initiating methionine' 137 1 1 6EVL HIS A 2 ? UNP O15460 ? ? 'expression tag' 138 2 1 6EVL HIS A 3 ? UNP O15460 ? ? 'expression tag' 139 3 1 6EVL HIS A 4 ? UNP O15460 ? ? 'expression tag' 140 4 1 6EVL HIS A 5 ? UNP O15460 ? ? 'expression tag' 141 5 1 6EVL HIS A 6 ? UNP O15460 ? ? 'expression tag' 142 6 1 6EVL HIS A 7 ? UNP O15460 ? ? 'expression tag' 143 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE -10 ? 1 'SSA (A^2)' 5610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? GLU A 24 ? SER A 146 GLU A 160 1 ? 15 HELX_P HELX_P2 AA2 ASP A 26 ? ALA A 43 ? ASP A 162 ALA A 179 1 ? 18 HELX_P HELX_P3 AA3 THR A 50 ? LEU A 65 ? THR A 186 LEU A 201 1 ? 16 HELX_P HELX_P4 AA4 ASP A 67 ? ASP A 82 ? ASP A 203 ASP A 218 1 ? 16 HELX_P HELX_P5 AA5 HIS A 85 ? GLU A 100 ? HIS A 221 GLU A 236 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 4 'binding site for residue SO4 A 301' AC2 Software A DMS 302 ? 3 'binding site for residue DMS A 302' AC3 Software A GLY 303 ? 5 'binding site for residue GLY A 303' AC4 Software A GLY 304 ? 4 'binding site for residue GLY A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 70 ? ARG A 206 . ? 1_555 ? 2 AC1 4 GLU A 73 ? GLU A 209 . ? 1_555 ? 3 AC1 4 ARG A 77 ? ARG A 213 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 410 . ? 1_555 ? 5 AC2 3 TRP A 33 ? TRP A 169 . ? 1_555 ? 6 AC2 3 PRO A 83 ? PRO A 219 . ? 6_664 ? 7 AC2 3 HOH F . ? HOH A 452 . ? 1_555 ? 8 AC3 5 TYR A 22 ? TYR A 158 . ? 1_555 ? 9 AC3 5 ASP A 56 ? ASP A 192 . ? 1_555 ? 10 AC3 5 TYR A 57 ? TYR A 193 . ? 1_555 ? 11 AC3 5 LEU A 99 ? LEU A 235 . ? 3_655 ? 12 AC3 5 HOH F . ? HOH A 465 . ? 1_555 ? 13 AC4 4 TYR A 60 ? TYR A 196 . ? 1_555 ? 14 AC4 4 ASN A 91 ? ASN A 227 . ? 1_555 ? 15 AC4 4 HOH F . ? HOH A 403 . ? 1_555 ? 16 AC4 4 HOH F . ? HOH A 429 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 171 ? ? O A HOH 401 ? ? 2.01 2 1 O A HOH 437 ? ? O A HOH 480 ? ? 2.02 3 1 OD2 A ASP 149 ? ? O A HOH 402 ? ? 2.09 4 1 O A HOH 488 ? ? O A HOH 503 ? ? 2.10 5 1 O A HOH 488 ? ? O A HOH 512 ? ? 2.13 6 1 O A GLY 304 ? ? O A HOH 403 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 483 ? ? 1_555 O A HOH 499 ? ? 3_655 2.06 2 1 O A HOH 478 ? ? 1_555 O A HOH 514 ? ? 3_655 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 218 ? ? -154.38 65.09 2 1 GLU A 236 ? ? -119.63 61.26 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 515 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 137 ? A MET 1 2 1 Y 1 A HIS 138 ? A HIS 2 3 1 Y 1 A HIS 139 ? A HIS 3 4 1 Y 1 A HIS 140 ? A HIS 4 5 1 Y 1 A HIS 141 ? A HIS 5 6 1 Y 1 A HIS 142 ? A HIS 6 7 1 Y 1 A HIS 143 ? A HIS 7 8 1 Y 1 A GLU 238 ? A GLU 102 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DMS S S N N 88 DMS O O N N 89 DMS C1 C N N 90 DMS C2 C N N 91 DMS H11 H N N 92 DMS H12 H N N 93 DMS H13 H N N 94 DMS H21 H N N 95 DMS H22 H N N 96 DMS H23 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 LEU N N N N 171 LEU CA C N S 172 LEU C C N N 173 LEU O O N N 174 LEU CB C N N 175 LEU CG C N N 176 LEU CD1 C N N 177 LEU CD2 C N N 178 LEU OXT O N N 179 LEU H H N N 180 LEU H2 H N N 181 LEU HA H N N 182 LEU HB2 H N N 183 LEU HB3 H N N 184 LEU HG H N N 185 LEU HD11 H N N 186 LEU HD12 H N N 187 LEU HD13 H N N 188 LEU HD21 H N N 189 LEU HD22 H N N 190 LEU HD23 H N N 191 LEU HXT H N N 192 LYS N N N N 193 LYS CA C N S 194 LYS C C N N 195 LYS O O N N 196 LYS CB C N N 197 LYS CG C N N 198 LYS CD C N N 199 LYS CE C N N 200 LYS NZ N N N 201 LYS OXT O N N 202 LYS H H N N 203 LYS H2 H N N 204 LYS HA H N N 205 LYS HB2 H N N 206 LYS HB3 H N N 207 LYS HG2 H N N 208 LYS HG3 H N N 209 LYS HD2 H N N 210 LYS HD3 H N N 211 LYS HE2 H N N 212 LYS HE3 H N N 213 LYS HZ1 H N N 214 LYS HZ2 H N N 215 LYS HZ3 H N N 216 LYS HXT H N N 217 MET N N N N 218 MET CA C N S 219 MET C C N N 220 MET O O N N 221 MET CB C N N 222 MET CG C N N 223 MET SD S N N 224 MET CE C N N 225 MET OXT O N N 226 MET H H N N 227 MET H2 H N N 228 MET HA H N N 229 MET HB2 H N N 230 MET HB3 H N N 231 MET HG2 H N N 232 MET HG3 H N N 233 MET HE1 H N N 234 MET HE2 H N N 235 MET HE3 H N N 236 MET HXT H N N 237 PHE N N N N 238 PHE CA C N S 239 PHE C C N N 240 PHE O O N N 241 PHE CB C N N 242 PHE CG C Y N 243 PHE CD1 C Y N 244 PHE CD2 C Y N 245 PHE CE1 C Y N 246 PHE CE2 C Y N 247 PHE CZ C Y N 248 PHE OXT O N N 249 PHE H H N N 250 PHE H2 H N N 251 PHE HA H N N 252 PHE HB2 H N N 253 PHE HB3 H N N 254 PHE HD1 H N N 255 PHE HD2 H N N 256 PHE HE1 H N N 257 PHE HE2 H N N 258 PHE HZ H N N 259 PHE HXT H N N 260 PRO N N N N 261 PRO CA C N S 262 PRO C C N N 263 PRO O O N N 264 PRO CB C N N 265 PRO CG C N N 266 PRO CD C N N 267 PRO OXT O N N 268 PRO H H N N 269 PRO HA H N N 270 PRO HB2 H N N 271 PRO HB3 H N N 272 PRO HG2 H N N 273 PRO HG3 H N N 274 PRO HD2 H N N 275 PRO HD3 H N N 276 PRO HXT H N N 277 SER N N N N 278 SER CA C N S 279 SER C C N N 280 SER O O N N 281 SER CB C N N 282 SER OG O N N 283 SER OXT O N N 284 SER H H N N 285 SER H2 H N N 286 SER HA H N N 287 SER HB2 H N N 288 SER HB3 H N N 289 SER HG H N N 290 SER HXT H N N 291 SO4 S S N N 292 SO4 O1 O N N 293 SO4 O2 O N N 294 SO4 O3 O N N 295 SO4 O4 O N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TRP N N N N 314 TRP CA C N S 315 TRP C C N N 316 TRP O O N N 317 TRP CB C N N 318 TRP CG C Y N 319 TRP CD1 C Y N 320 TRP CD2 C Y N 321 TRP NE1 N Y N 322 TRP CE2 C Y N 323 TRP CE3 C Y N 324 TRP CZ2 C Y N 325 TRP CZ3 C Y N 326 TRP CH2 C Y N 327 TRP OXT O N N 328 TRP H H N N 329 TRP H2 H N N 330 TRP HA H N N 331 TRP HB2 H N N 332 TRP HB3 H N N 333 TRP HD1 H N N 334 TRP HE1 H N N 335 TRP HE3 H N N 336 TRP HZ2 H N N 337 TRP HZ3 H N N 338 TRP HH2 H N N 339 TRP HXT H N N 340 TYR N N N N 341 TYR CA C N S 342 TYR C C N N 343 TYR O O N N 344 TYR CB C N N 345 TYR CG C Y N 346 TYR CD1 C Y N 347 TYR CD2 C Y N 348 TYR CE1 C Y N 349 TYR CE2 C Y N 350 TYR CZ C Y N 351 TYR OH O N N 352 TYR OXT O N N 353 TYR H H N N 354 TYR H2 H N N 355 TYR HA H N N 356 TYR HB2 H N N 357 TYR HB3 H N N 358 TYR HD1 H N N 359 TYR HD2 H N N 360 TYR HE1 H N N 361 TYR HE2 H N N 362 TYR HH H N N 363 TYR HXT H N N 364 VAL N N N N 365 VAL CA C N S 366 VAL C C N N 367 VAL O O N N 368 VAL CB C N N 369 VAL CG1 C N N 370 VAL CG2 C N N 371 VAL OXT O N N 372 VAL H H N N 373 VAL H2 H N N 374 VAL HA H N N 375 VAL HB H N N 376 VAL HG11 H N N 377 VAL HG12 H N N 378 VAL HG13 H N N 379 VAL HG21 H N N 380 VAL HG22 H N N 381 VAL HG23 H N N 382 VAL HXT H N N 383 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DMS S O doub N N 83 DMS S C1 sing N N 84 DMS S C2 sing N N 85 DMS C1 H11 sing N N 86 DMS C1 H12 sing N N 87 DMS C1 H13 sing N N 88 DMS C2 H21 sing N N 89 DMS C2 H22 sing N N 90 DMS C2 H23 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 LEU N CA sing N N 161 LEU N H sing N N 162 LEU N H2 sing N N 163 LEU CA C sing N N 164 LEU CA CB sing N N 165 LEU CA HA sing N N 166 LEU C O doub N N 167 LEU C OXT sing N N 168 LEU CB CG sing N N 169 LEU CB HB2 sing N N 170 LEU CB HB3 sing N N 171 LEU CG CD1 sing N N 172 LEU CG CD2 sing N N 173 LEU CG HG sing N N 174 LEU CD1 HD11 sing N N 175 LEU CD1 HD12 sing N N 176 LEU CD1 HD13 sing N N 177 LEU CD2 HD21 sing N N 178 LEU CD2 HD22 sing N N 179 LEU CD2 HD23 sing N N 180 LEU OXT HXT sing N N 181 LYS N CA sing N N 182 LYS N H sing N N 183 LYS N H2 sing N N 184 LYS CA C sing N N 185 LYS CA CB sing N N 186 LYS CA HA sing N N 187 LYS C O doub N N 188 LYS C OXT sing N N 189 LYS CB CG sing N N 190 LYS CB HB2 sing N N 191 LYS CB HB3 sing N N 192 LYS CG CD sing N N 193 LYS CG HG2 sing N N 194 LYS CG HG3 sing N N 195 LYS CD CE sing N N 196 LYS CD HD2 sing N N 197 LYS CD HD3 sing N N 198 LYS CE NZ sing N N 199 LYS CE HE2 sing N N 200 LYS CE HE3 sing N N 201 LYS NZ HZ1 sing N N 202 LYS NZ HZ2 sing N N 203 LYS NZ HZ3 sing N N 204 LYS OXT HXT sing N N 205 MET N CA sing N N 206 MET N H sing N N 207 MET N H2 sing N N 208 MET CA C sing N N 209 MET CA CB sing N N 210 MET CA HA sing N N 211 MET C O doub N N 212 MET C OXT sing N N 213 MET CB CG sing N N 214 MET CB HB2 sing N N 215 MET CB HB3 sing N N 216 MET CG SD sing N N 217 MET CG HG2 sing N N 218 MET CG HG3 sing N N 219 MET SD CE sing N N 220 MET CE HE1 sing N N 221 MET CE HE2 sing N N 222 MET CE HE3 sing N N 223 MET OXT HXT sing N N 224 PHE N CA sing N N 225 PHE N H sing N N 226 PHE N H2 sing N N 227 PHE CA C sing N N 228 PHE CA CB sing N N 229 PHE CA HA sing N N 230 PHE C O doub N N 231 PHE C OXT sing N N 232 PHE CB CG sing N N 233 PHE CB HB2 sing N N 234 PHE CB HB3 sing N N 235 PHE CG CD1 doub Y N 236 PHE CG CD2 sing Y N 237 PHE CD1 CE1 sing Y N 238 PHE CD1 HD1 sing N N 239 PHE CD2 CE2 doub Y N 240 PHE CD2 HD2 sing N N 241 PHE CE1 CZ doub Y N 242 PHE CE1 HE1 sing N N 243 PHE CE2 CZ sing Y N 244 PHE CE2 HE2 sing N N 245 PHE CZ HZ sing N N 246 PHE OXT HXT sing N N 247 PRO N CA sing N N 248 PRO N CD sing N N 249 PRO N H sing N N 250 PRO CA C sing N N 251 PRO CA CB sing N N 252 PRO CA HA sing N N 253 PRO C O doub N N 254 PRO C OXT sing N N 255 PRO CB CG sing N N 256 PRO CB HB2 sing N N 257 PRO CB HB3 sing N N 258 PRO CG CD sing N N 259 PRO CG HG2 sing N N 260 PRO CG HG3 sing N N 261 PRO CD HD2 sing N N 262 PRO CD HD3 sing N N 263 PRO OXT HXT sing N N 264 SER N CA sing N N 265 SER N H sing N N 266 SER N H2 sing N N 267 SER CA C sing N N 268 SER CA CB sing N N 269 SER CA HA sing N N 270 SER C O doub N N 271 SER C OXT sing N N 272 SER CB OG sing N N 273 SER CB HB2 sing N N 274 SER CB HB3 sing N N 275 SER OG HG sing N N 276 SER OXT HXT sing N N 277 SO4 S O1 doub N N 278 SO4 S O2 doub N N 279 SO4 S O3 sing N N 280 SO4 S O4 sing N N 281 THR N CA sing N N 282 THR N H sing N N 283 THR N H2 sing N N 284 THR CA C sing N N 285 THR CA CB sing N N 286 THR CA HA sing N N 287 THR C O doub N N 288 THR C OXT sing N N 289 THR CB OG1 sing N N 290 THR CB CG2 sing N N 291 THR CB HB sing N N 292 THR OG1 HG1 sing N N 293 THR CG2 HG21 sing N N 294 THR CG2 HG22 sing N N 295 THR CG2 HG23 sing N N 296 THR OXT HXT sing N N 297 TRP N CA sing N N 298 TRP N H sing N N 299 TRP N H2 sing N N 300 TRP CA C sing N N 301 TRP CA CB sing N N 302 TRP CA HA sing N N 303 TRP C O doub N N 304 TRP C OXT sing N N 305 TRP CB CG sing N N 306 TRP CB HB2 sing N N 307 TRP CB HB3 sing N N 308 TRP CG CD1 doub Y N 309 TRP CG CD2 sing Y N 310 TRP CD1 NE1 sing Y N 311 TRP CD1 HD1 sing N N 312 TRP CD2 CE2 doub Y N 313 TRP CD2 CE3 sing Y N 314 TRP NE1 CE2 sing Y N 315 TRP NE1 HE1 sing N N 316 TRP CE2 CZ2 sing Y N 317 TRP CE3 CZ3 doub Y N 318 TRP CE3 HE3 sing N N 319 TRP CZ2 CH2 doub Y N 320 TRP CZ2 HZ2 sing N N 321 TRP CZ3 CH2 sing Y N 322 TRP CZ3 HZ3 sing N N 323 TRP CH2 HH2 sing N N 324 TRP OXT HXT sing N N 325 TYR N CA sing N N 326 TYR N H sing N N 327 TYR N H2 sing N N 328 TYR CA C sing N N 329 TYR CA CB sing N N 330 TYR CA HA sing N N 331 TYR C O doub N N 332 TYR C OXT sing N N 333 TYR CB CG sing N N 334 TYR CB HB2 sing N N 335 TYR CB HB3 sing N N 336 TYR CG CD1 doub Y N 337 TYR CG CD2 sing Y N 338 TYR CD1 CE1 sing Y N 339 TYR CD1 HD1 sing N N 340 TYR CD2 CE2 doub Y N 341 TYR CD2 HD2 sing N N 342 TYR CE1 CZ doub Y N 343 TYR CE1 HE1 sing N N 344 TYR CE2 CZ sing Y N 345 TYR CE2 HE2 sing N N 346 TYR CZ OH sing N N 347 TYR OH HH sing N N 348 TYR OXT HXT sing N N 349 VAL N CA sing N N 350 VAL N H sing N N 351 VAL N H2 sing N N 352 VAL CA C sing N N 353 VAL CA CB sing N N 354 VAL CA HA sing N N 355 VAL C O doub N N 356 VAL C OXT sing N N 357 VAL CB CG1 sing N N 358 VAL CB CG2 sing N N 359 VAL CB HB sing N N 360 VAL CG1 HG11 sing N N 361 VAL CG1 HG12 sing N N 362 VAL CG1 HG13 sing N N 363 VAL CG2 HG21 sing N N 364 VAL CG2 HG22 sing N N 365 VAL CG2 HG23 sing N N 366 VAL OXT HXT sing N N 367 # _pdbx_audit_support.funding_organization 'Sigrid Juselius Foundation' _pdbx_audit_support.country Finland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2V5F _pdbx_initial_refinement_model.details 'PDB code 2V5F' # _atom_sites.entry_id 6EVL _atom_sites.fract_transf_matrix[1][1] 0.018035 _atom_sites.fract_transf_matrix[1][2] 0.010412 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020825 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013946 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_