data_6EXZ # _entry.id 6EXZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EXZ pdb_00006exz 10.2210/pdb6exz/pdb WWPDB D_1200007398 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-21 2 'Structure model' 1 1 2019-11-13 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_database_2.pdbx_DOI' 12 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EXZ _pdbx_database_status.recvd_initial_deposition_date 2017-11-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mohamad, N.' 1 0000-0002-0009-1358 'Bravo, J.' 2 0000-0001-6695-2846 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo Rep.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1469-3178 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e47964 _citation.page_last e47964 _citation.title 'Mip6 binds directly to the Mex67 UBA domain to maintain low levels of Msn2/4 stress-dependent mRNAs.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embr.201947964 _citation.pdbx_database_id_PubMed 31680439 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martin-Exposito, M.' 1 0000-0002-0852-009X primary 'Gas, M.E.' 2 ? primary 'Mohamad, N.' 3 ? primary 'Nuno-Cabanes, C.' 4 ? primary 'Tejada-Colon, A.' 5 ? primary 'Pascual-Garcia, P.' 6 ? primary 'de la Fuente, L.' 7 ? primary 'Chaves-Arquero, B.' 8 0000-0002-2761-2336 primary 'Merran, J.' 9 ? primary 'Corden, J.' 10 ? primary 'Conesa, A.' 11 ? primary 'Perez-Canadillas, J.M.' 12 ? primary 'Bravo, J.' 13 ? primary 'Rodriguez-Navarro, S.' 14 0000-0001-7472-3111 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'mRNA export factor MEX67' 8287.521 1 ? ? ? ? 2 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MVMAPTLQLPPDVQSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF _entity_poly.pdbx_seq_one_letter_code_can MVMAPTLQLPPDVQSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 MET n 1 4 ALA n 1 5 PRO n 1 6 THR n 1 7 LEU n 1 8 GLN n 1 9 LEU n 1 10 PRO n 1 11 PRO n 1 12 ASP n 1 13 VAL n 1 14 GLN n 1 15 SER n 1 16 ARG n 1 17 LEU n 1 18 ASN n 1 19 PRO n 1 20 VAL n 1 21 GLN n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 LEU n 1 26 ASN n 1 27 LYS n 1 28 LEU n 1 29 HIS n 1 30 LEU n 1 31 GLU n 1 32 THR n 1 33 LYS n 1 34 LEU n 1 35 ASN n 1 36 ALA n 1 37 GLU n 1 38 TYR n 1 39 THR n 1 40 PHE n 1 41 MET n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 GLN n 1 46 SER n 1 47 ASN n 1 48 TRP n 1 49 ASN n 1 50 TYR n 1 51 GLU n 1 52 VAL n 1 53 ALA n 1 54 ILE n 1 55 LYS n 1 56 GLY n 1 57 PHE n 1 58 GLN n 1 59 SER n 1 60 SER n 1 61 MET n 1 62 ASN n 1 63 GLY n 1 64 ILE n 1 65 PRO n 1 66 ARG n 1 67 GLU n 1 68 ALA n 1 69 PHE n 1 70 VAL n 1 71 GLN n 1 72 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MEX67, YPL169C, P2520' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 528 ? ? ? A . n A 1 2 VAL 2 529 ? ? ? A . n A 1 3 MET 3 530 530 MET MET A . n A 1 4 ALA 4 531 531 ALA ALA A . n A 1 5 PRO 5 532 532 PRO PRO A . n A 1 6 THR 6 533 533 THR THR A . n A 1 7 LEU 7 534 534 LEU LEU A . n A 1 8 GLN 8 535 535 GLN GLN A . n A 1 9 LEU 9 536 536 LEU LEU A . n A 1 10 PRO 10 537 537 PRO PRO A . n A 1 11 PRO 11 538 538 PRO PRO A . n A 1 12 ASP 12 539 539 ASP ASP A . n A 1 13 VAL 13 540 540 VAL VAL A . n A 1 14 GLN 14 541 541 GLN GLN A . n A 1 15 SER 15 542 542 SER SER A . n A 1 16 ARG 16 543 543 ARG ARG A . n A 1 17 LEU 17 544 544 LEU LEU A . n A 1 18 ASN 18 545 545 ASN ASN A . n A 1 19 PRO 19 546 546 PRO PRO A . n A 1 20 VAL 20 547 547 VAL VAL A . n A 1 21 GLN 21 548 548 GLN GLN A . n A 1 22 LEU 22 549 549 LEU LEU A . n A 1 23 GLU 23 550 550 GLU GLU A . n A 1 24 LEU 24 551 551 LEU LEU A . n A 1 25 LEU 25 552 552 LEU LEU A . n A 1 26 ASN 26 553 553 ASN ASN A . n A 1 27 LYS 27 554 554 LYS LYS A . n A 1 28 LEU 28 555 555 LEU LEU A . n A 1 29 HIS 29 556 556 HIS HIS A . n A 1 30 LEU 30 557 557 LEU LEU A . n A 1 31 GLU 31 558 558 GLU GLU A . n A 1 32 THR 32 559 559 THR THR A . n A 1 33 LYS 33 560 560 LYS LYS A . n A 1 34 LEU 34 561 561 LEU LEU A . n A 1 35 ASN 35 562 562 ASN ASN A . n A 1 36 ALA 36 563 563 ALA ALA A . n A 1 37 GLU 37 564 564 GLU GLU A . n A 1 38 TYR 38 565 565 TYR TYR A . n A 1 39 THR 39 566 566 THR THR A . n A 1 40 PHE 40 567 567 PHE PHE A . n A 1 41 MET 41 568 568 MET MET A . n A 1 42 LEU 42 569 569 LEU LEU A . n A 1 43 ALA 43 570 570 ALA ALA A . n A 1 44 GLU 44 571 571 GLU GLU A . n A 1 45 GLN 45 572 572 GLN GLN A . n A 1 46 SER 46 573 573 SER SER A . n A 1 47 ASN 47 574 574 ASN ASN A . n A 1 48 TRP 48 575 575 TRP TRP A . n A 1 49 ASN 49 576 576 ASN ASN A . n A 1 50 TYR 50 577 577 TYR TYR A . n A 1 51 GLU 51 578 578 GLU GLU A . n A 1 52 VAL 52 579 579 VAL VAL A . n A 1 53 ALA 53 580 580 ALA ALA A . n A 1 54 ILE 54 581 581 ILE ILE A . n A 1 55 LYS 55 582 582 LYS LYS A . n A 1 56 GLY 56 583 583 GLY GLY A . n A 1 57 PHE 57 584 584 PHE PHE A . n A 1 58 GLN 58 585 585 GLN GLN A . n A 1 59 SER 59 586 586 SER SER A . n A 1 60 SER 60 587 587 SER SER A . n A 1 61 MET 61 588 588 MET MET A . n A 1 62 ASN 62 589 589 ASN ASN A . n A 1 63 GLY 63 590 590 GLY GLY A . n A 1 64 ILE 64 591 591 ILE ILE A . n A 1 65 PRO 65 592 592 PRO PRO A . n A 1 66 ARG 66 593 593 ARG ARG A . n A 1 67 GLU 67 594 594 GLU GLU A . n A 1 68 ALA 68 595 595 ALA ALA A . n A 1 69 PHE 69 596 596 PHE PHE A . n A 1 70 VAL 70 597 597 VAL VAL A . n A 1 71 GLN 71 598 598 GLN GLN A . n A 1 72 PHE 72 599 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 601 1 FMT FMT A . C 3 HOH 1 701 15 HOH HOH A . C 3 HOH 2 702 16 HOH HOH A . C 3 HOH 3 703 4 HOH HOH A . C 3 HOH 4 704 2 HOH HOH A . C 3 HOH 5 705 1 HOH HOH A . C 3 HOH 6 706 8 HOH HOH A . C 3 HOH 7 707 6 HOH HOH A . C 3 HOH 8 708 3 HOH HOH A . C 3 HOH 9 709 17 HOH HOH A . C 3 HOH 10 710 7 HOH HOH A . C 3 HOH 11 711 10 HOH HOH A . C 3 HOH 12 712 5 HOH HOH A . C 3 HOH 13 713 12 HOH HOH A . C 3 HOH 14 714 13 HOH HOH A . C 3 HOH 15 715 14 HOH HOH A . C 3 HOH 16 716 18 HOH HOH A . C 3 HOH 17 717 9 HOH HOH A . C 3 HOH 18 718 11 HOH HOH A . C 3 HOH 19 719 19 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6EXZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.419 _cell.length_a_esd ? _cell.length_b 71.419 _cell.length_b_esd ? _cell.length_c 20.343 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EXZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EXZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '35% Tacsimate pH 7' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6EXZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.3 _reflns.d_resolution_low 30.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14960 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19 _reflns.pdbx_Rmerge_I_obs 0.04496 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.04623 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.30 _reflns_shell.d_res_low 1.35 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EXZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.300 _refine.ls_d_res_low 30.925 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14957 _refine.ls_number_reflns_R_free 765 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1714 _refine.ls_R_factor_R_free 0.2067 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1696 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1OAI _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.95 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 555 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 577 _refine_hist.d_res_high 1.300 _refine_hist.d_res_low 30.925 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 569 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.203 ? 771 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.819 ? 215 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.067 ? 86 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 101 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3001 1.4005 . . 166 2790 100.00 . . . 0.3147 . 0.2510 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4005 1.5415 . . 153 2800 100.00 . . . 0.2693 . 0.1941 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5415 1.7645 . . 151 2809 100.00 . . . 0.2230 . 0.1594 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7645 2.2230 . . 167 2836 100.00 . . . 0.2183 . 0.1857 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2230 30.9341 . . 128 2957 100.00 . . . 0.1859 . 0.1599 . . . . . . . . . . # _struct.entry_id 6EXZ _struct.title 'Crystal structure of Mex67 C-term' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EXZ _struct_keywords.text 'mRNA export, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MEX67_YEAST _struct_ref.pdbx_db_accession Q99257 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVMAPTLQLPPDVQSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF _struct_ref.pdbx_align_begin 528 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EXZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99257 _struct_ref_seq.db_align_beg 528 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 599 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 528 _struct_ref_seq.pdbx_auth_seq_align_end 599 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 110 ? 1 MORE -0 ? 1 'SSA (A^2)' 4820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 4 ? LEU A 9 ? ALA A 531 LEU A 536 1 ? 6 HELX_P HELX_P2 AA2 PRO A 10 ? SER A 15 ? PRO A 537 SER A 542 1 ? 6 HELX_P HELX_P3 AA3 ASN A 18 ? LYS A 33 ? ASN A 545 LYS A 560 1 ? 16 HELX_P HELX_P4 AA4 ASN A 35 ? SER A 46 ? ASN A 562 SER A 573 1 ? 12 HELX_P HELX_P5 AA5 ASN A 49 ? SER A 60 ? ASN A 576 SER A 587 1 ? 12 HELX_P HELX_P6 AA6 MET A 61 ? ILE A 64 ? MET A 588 ILE A 591 5 ? 4 HELX_P HELX_P7 AA7 PRO A 65 ? VAL A 70 ? PRO A 592 VAL A 597 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FMT _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue FMT A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 16 ? ARG A 543 . ? 3_444 ? 2 AC1 3 PRO A 19 ? PRO A 546 . ? 6_555 ? 3 AC1 3 ARG A 66 ? ARG A 593 . ? 1_555 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 528 ? A MET 1 2 1 Y 1 A VAL 529 ? A VAL 2 3 1 Y 1 A PHE 599 ? A PHE 72 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FMT C C N N 74 FMT O1 O N N 75 FMT O2 O N N 76 FMT H H N N 77 FMT HO2 H N N 78 GLN N N N N 79 GLN CA C N S 80 GLN C C N N 81 GLN O O N N 82 GLN CB C N N 83 GLN CG C N N 84 GLN CD C N N 85 GLN OE1 O N N 86 GLN NE2 N N N 87 GLN OXT O N N 88 GLN H H N N 89 GLN H2 H N N 90 GLN HA H N N 91 GLN HB2 H N N 92 GLN HB3 H N N 93 GLN HG2 H N N 94 GLN HG3 H N N 95 GLN HE21 H N N 96 GLN HE22 H N N 97 GLN HXT H N N 98 GLU N N N N 99 GLU CA C N S 100 GLU C C N N 101 GLU O O N N 102 GLU CB C N N 103 GLU CG C N N 104 GLU CD C N N 105 GLU OE1 O N N 106 GLU OE2 O N N 107 GLU OXT O N N 108 GLU H H N N 109 GLU H2 H N N 110 GLU HA H N N 111 GLU HB2 H N N 112 GLU HB3 H N N 113 GLU HG2 H N N 114 GLU HG3 H N N 115 GLU HE2 H N N 116 GLU HXT H N N 117 GLY N N N N 118 GLY CA C N N 119 GLY C C N N 120 GLY O O N N 121 GLY OXT O N N 122 GLY H H N N 123 GLY H2 H N N 124 GLY HA2 H N N 125 GLY HA3 H N N 126 GLY HXT H N N 127 HIS N N N N 128 HIS CA C N S 129 HIS C C N N 130 HIS O O N N 131 HIS CB C N N 132 HIS CG C Y N 133 HIS ND1 N Y N 134 HIS CD2 C Y N 135 HIS CE1 C Y N 136 HIS NE2 N Y N 137 HIS OXT O N N 138 HIS H H N N 139 HIS H2 H N N 140 HIS HA H N N 141 HIS HB2 H N N 142 HIS HB3 H N N 143 HIS HD1 H N N 144 HIS HD2 H N N 145 HIS HE1 H N N 146 HIS HE2 H N N 147 HIS HXT H N N 148 HOH O O N N 149 HOH H1 H N N 150 HOH H2 H N N 151 ILE N N N N 152 ILE CA C N S 153 ILE C C N N 154 ILE O O N N 155 ILE CB C N S 156 ILE CG1 C N N 157 ILE CG2 C N N 158 ILE CD1 C N N 159 ILE OXT O N N 160 ILE H H N N 161 ILE H2 H N N 162 ILE HA H N N 163 ILE HB H N N 164 ILE HG12 H N N 165 ILE HG13 H N N 166 ILE HG21 H N N 167 ILE HG22 H N N 168 ILE HG23 H N N 169 ILE HD11 H N N 170 ILE HD12 H N N 171 ILE HD13 H N N 172 ILE HXT H N N 173 LEU N N N N 174 LEU CA C N S 175 LEU C C N N 176 LEU O O N N 177 LEU CB C N N 178 LEU CG C N N 179 LEU CD1 C N N 180 LEU CD2 C N N 181 LEU OXT O N N 182 LEU H H N N 183 LEU H2 H N N 184 LEU HA H N N 185 LEU HB2 H N N 186 LEU HB3 H N N 187 LEU HG H N N 188 LEU HD11 H N N 189 LEU HD12 H N N 190 LEU HD13 H N N 191 LEU HD21 H N N 192 LEU HD22 H N N 193 LEU HD23 H N N 194 LEU HXT H N N 195 LYS N N N N 196 LYS CA C N S 197 LYS C C N N 198 LYS O O N N 199 LYS CB C N N 200 LYS CG C N N 201 LYS CD C N N 202 LYS CE C N N 203 LYS NZ N N N 204 LYS OXT O N N 205 LYS H H N N 206 LYS H2 H N N 207 LYS HA H N N 208 LYS HB2 H N N 209 LYS HB3 H N N 210 LYS HG2 H N N 211 LYS HG3 H N N 212 LYS HD2 H N N 213 LYS HD3 H N N 214 LYS HE2 H N N 215 LYS HE3 H N N 216 LYS HZ1 H N N 217 LYS HZ2 H N N 218 LYS HZ3 H N N 219 LYS HXT H N N 220 MET N N N N 221 MET CA C N S 222 MET C C N N 223 MET O O N N 224 MET CB C N N 225 MET CG C N N 226 MET SD S N N 227 MET CE C N N 228 MET OXT O N N 229 MET H H N N 230 MET H2 H N N 231 MET HA H N N 232 MET HB2 H N N 233 MET HB3 H N N 234 MET HG2 H N N 235 MET HG3 H N N 236 MET HE1 H N N 237 MET HE2 H N N 238 MET HE3 H N N 239 MET HXT H N N 240 PHE N N N N 241 PHE CA C N S 242 PHE C C N N 243 PHE O O N N 244 PHE CB C N N 245 PHE CG C Y N 246 PHE CD1 C Y N 247 PHE CD2 C Y N 248 PHE CE1 C Y N 249 PHE CE2 C Y N 250 PHE CZ C Y N 251 PHE OXT O N N 252 PHE H H N N 253 PHE H2 H N N 254 PHE HA H N N 255 PHE HB2 H N N 256 PHE HB3 H N N 257 PHE HD1 H N N 258 PHE HD2 H N N 259 PHE HE1 H N N 260 PHE HE2 H N N 261 PHE HZ H N N 262 PHE HXT H N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 FMT C O1 doub N N 70 FMT C O2 sing N N 71 FMT C H sing N N 72 FMT O2 HO2 sing N N 73 GLN N CA sing N N 74 GLN N H sing N N 75 GLN N H2 sing N N 76 GLN CA C sing N N 77 GLN CA CB sing N N 78 GLN CA HA sing N N 79 GLN C O doub N N 80 GLN C OXT sing N N 81 GLN CB CG sing N N 82 GLN CB HB2 sing N N 83 GLN CB HB3 sing N N 84 GLN CG CD sing N N 85 GLN CG HG2 sing N N 86 GLN CG HG3 sing N N 87 GLN CD OE1 doub N N 88 GLN CD NE2 sing N N 89 GLN NE2 HE21 sing N N 90 GLN NE2 HE22 sing N N 91 GLN OXT HXT sing N N 92 GLU N CA sing N N 93 GLU N H sing N N 94 GLU N H2 sing N N 95 GLU CA C sing N N 96 GLU CA CB sing N N 97 GLU CA HA sing N N 98 GLU C O doub N N 99 GLU C OXT sing N N 100 GLU CB CG sing N N 101 GLU CB HB2 sing N N 102 GLU CB HB3 sing N N 103 GLU CG CD sing N N 104 GLU CG HG2 sing N N 105 GLU CG HG3 sing N N 106 GLU CD OE1 doub N N 107 GLU CD OE2 sing N N 108 GLU OE2 HE2 sing N N 109 GLU OXT HXT sing N N 110 GLY N CA sing N N 111 GLY N H sing N N 112 GLY N H2 sing N N 113 GLY CA C sing N N 114 GLY CA HA2 sing N N 115 GLY CA HA3 sing N N 116 GLY C O doub N N 117 GLY C OXT sing N N 118 GLY OXT HXT sing N N 119 HIS N CA sing N N 120 HIS N H sing N N 121 HIS N H2 sing N N 122 HIS CA C sing N N 123 HIS CA CB sing N N 124 HIS CA HA sing N N 125 HIS C O doub N N 126 HIS C OXT sing N N 127 HIS CB CG sing N N 128 HIS CB HB2 sing N N 129 HIS CB HB3 sing N N 130 HIS CG ND1 sing Y N 131 HIS CG CD2 doub Y N 132 HIS ND1 CE1 doub Y N 133 HIS ND1 HD1 sing N N 134 HIS CD2 NE2 sing Y N 135 HIS CD2 HD2 sing N N 136 HIS CE1 NE2 sing Y N 137 HIS CE1 HE1 sing N N 138 HIS NE2 HE2 sing N N 139 HIS OXT HXT sing N N 140 HOH O H1 sing N N 141 HOH O H2 sing N N 142 ILE N CA sing N N 143 ILE N H sing N N 144 ILE N H2 sing N N 145 ILE CA C sing N N 146 ILE CA CB sing N N 147 ILE CA HA sing N N 148 ILE C O doub N N 149 ILE C OXT sing N N 150 ILE CB CG1 sing N N 151 ILE CB CG2 sing N N 152 ILE CB HB sing N N 153 ILE CG1 CD1 sing N N 154 ILE CG1 HG12 sing N N 155 ILE CG1 HG13 sing N N 156 ILE CG2 HG21 sing N N 157 ILE CG2 HG22 sing N N 158 ILE CG2 HG23 sing N N 159 ILE CD1 HD11 sing N N 160 ILE CD1 HD12 sing N N 161 ILE CD1 HD13 sing N N 162 ILE OXT HXT sing N N 163 LEU N CA sing N N 164 LEU N H sing N N 165 LEU N H2 sing N N 166 LEU CA C sing N N 167 LEU CA CB sing N N 168 LEU CA HA sing N N 169 LEU C O doub N N 170 LEU C OXT sing N N 171 LEU CB CG sing N N 172 LEU CB HB2 sing N N 173 LEU CB HB3 sing N N 174 LEU CG CD1 sing N N 175 LEU CG CD2 sing N N 176 LEU CG HG sing N N 177 LEU CD1 HD11 sing N N 178 LEU CD1 HD12 sing N N 179 LEU CD1 HD13 sing N N 180 LEU CD2 HD21 sing N N 181 LEU CD2 HD22 sing N N 182 LEU CD2 HD23 sing N N 183 LEU OXT HXT sing N N 184 LYS N CA sing N N 185 LYS N H sing N N 186 LYS N H2 sing N N 187 LYS CA C sing N N 188 LYS CA CB sing N N 189 LYS CA HA sing N N 190 LYS C O doub N N 191 LYS C OXT sing N N 192 LYS CB CG sing N N 193 LYS CB HB2 sing N N 194 LYS CB HB3 sing N N 195 LYS CG CD sing N N 196 LYS CG HG2 sing N N 197 LYS CG HG3 sing N N 198 LYS CD CE sing N N 199 LYS CD HD2 sing N N 200 LYS CD HD3 sing N N 201 LYS CE NZ sing N N 202 LYS CE HE2 sing N N 203 LYS CE HE3 sing N N 204 LYS NZ HZ1 sing N N 205 LYS NZ HZ2 sing N N 206 LYS NZ HZ3 sing N N 207 LYS OXT HXT sing N N 208 MET N CA sing N N 209 MET N H sing N N 210 MET N H2 sing N N 211 MET CA C sing N N 212 MET CA CB sing N N 213 MET CA HA sing N N 214 MET C O doub N N 215 MET C OXT sing N N 216 MET CB CG sing N N 217 MET CB HB2 sing N N 218 MET CB HB3 sing N N 219 MET CG SD sing N N 220 MET CG HG2 sing N N 221 MET CG HG3 sing N N 222 MET SD CE sing N N 223 MET CE HE1 sing N N 224 MET CE HE2 sing N N 225 MET CE HE3 sing N N 226 MET OXT HXT sing N N 227 PHE N CA sing N N 228 PHE N H sing N N 229 PHE N H2 sing N N 230 PHE CA C sing N N 231 PHE CA CB sing N N 232 PHE CA HA sing N N 233 PHE C O doub N N 234 PHE C OXT sing N N 235 PHE CB CG sing N N 236 PHE CB HB2 sing N N 237 PHE CB HB3 sing N N 238 PHE CG CD1 doub Y N 239 PHE CG CD2 sing Y N 240 PHE CD1 CE1 sing Y N 241 PHE CD1 HD1 sing N N 242 PHE CD2 CE2 doub Y N 243 PHE CD2 HD2 sing N N 244 PHE CE1 CZ doub Y N 245 PHE CE1 HE1 sing N N 246 PHE CE2 CZ sing Y N 247 PHE CE2 HE2 sing N N 248 PHE CZ HZ sing N N 249 PHE OXT HXT sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_audit_support.funding_organization 'Ministry of Economy and Competitiveness' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number 'SAF 2015-67077-R' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1OAI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6EXZ _atom_sites.fract_transf_matrix[1][1] 0.014002 _atom_sites.fract_transf_matrix[1][2] 0.008084 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016168 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.049157 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_