data_6F7E # _entry.id 6F7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6F7E pdb_00006f7e 10.2210/pdb6f7e/pdb WWPDB D_1200007865 ? ? BMRB 27078 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27078 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6F7E _pdbx_database_status.recvd_initial_deposition_date 2017-12-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Courtade, G.' 1 ? 'Forsberg, Z.' 2 ? 'Eijsink, V.' 3 ? 'Aachmann, F.' 4 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Biol.Chem. JBCHA3 0071 1083-351X ? ? 293 ? 13006 13015 'The carbohydrate-binding module and linker of a modular lytic polysaccharide monooxygenase promote localized cellulose oxidation.' 2018 ? 10.1074/jbc.RA118.004269 29967065 ? ? ? ? ? ? ? ? NE ? ? 1 'Biomol NMR Assign' ? ? 1874-270X ? ? 11 ? 257 264 ;Chemical shift assignments for the apo-form of the catalytic domain, the linker region, and the carbohydrate-binding domain of the cellulose-active lytic polysaccharide monooxygenase ScLPMO10C. ; 2017 ? 10.1007/s12104-017-9759-2 28822070 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Courtade, G.' 1 0000-0002-1644-3223 primary 'Forsberg, Z.' 2 ? primary 'Heggset, E.B.' 3 0000-0001-8876-8898 primary 'Eijsink, V.G.H.' 4 0000-0002-9220-8743 primary 'Aachmann, F.L.' 5 0000-0003-1613-4663 1 'Courtade, G.' 6 ? 1 'Forsberg, Z.' 7 ? 1 'Vaaje-Kolstad, G.' 8 ? 1 'Eijsink, V.G.H.' 9 ? 1 'Aachmann, F.L.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative secreted cellulose binding protein' _entity.formula_weight 10662.510 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HTGSCMAVYSVENSWSGGFQGSVEVMNHGTEPLNGWAVQWQPGGGTTLGGVWNGSLTSGSDGTVTVRNVDHNRVVPPDGS VTFGFTATSTGNDFPVDSIGCVAP ; _entity_poly.pdbx_seq_one_letter_code_can ;HTGSCMAVYSVENSWSGGFQGSVEVMNHGTEPLNGWAVQWQPGGGTTLGGVWNGSLTSGSDGTVTVRNVDHNRVVPPDGS VTFGFTATSTGNDFPVDSIGCVAP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 THR n 1 3 GLY n 1 4 SER n 1 5 CYS n 1 6 MET n 1 7 ALA n 1 8 VAL n 1 9 TYR n 1 10 SER n 1 11 VAL n 1 12 GLU n 1 13 ASN n 1 14 SER n 1 15 TRP n 1 16 SER n 1 17 GLY n 1 18 GLY n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 SER n 1 23 VAL n 1 24 GLU n 1 25 VAL n 1 26 MET n 1 27 ASN n 1 28 HIS n 1 29 GLY n 1 30 THR n 1 31 GLU n 1 32 PRO n 1 33 LEU n 1 34 ASN n 1 35 GLY n 1 36 TRP n 1 37 ALA n 1 38 VAL n 1 39 GLN n 1 40 TRP n 1 41 GLN n 1 42 PRO n 1 43 GLY n 1 44 GLY n 1 45 GLY n 1 46 THR n 1 47 THR n 1 48 LEU n 1 49 GLY n 1 50 GLY n 1 51 VAL n 1 52 TRP n 1 53 ASN n 1 54 GLY n 1 55 SER n 1 56 LEU n 1 57 THR n 1 58 SER n 1 59 GLY n 1 60 SER n 1 61 ASP n 1 62 GLY n 1 63 THR n 1 64 VAL n 1 65 THR n 1 66 VAL n 1 67 ARG n 1 68 ASN n 1 69 VAL n 1 70 ASP n 1 71 HIS n 1 72 ASN n 1 73 ARG n 1 74 VAL n 1 75 VAL n 1 76 PRO n 1 77 PRO n 1 78 ASP n 1 79 GLY n 1 80 SER n 1 81 VAL n 1 82 THR n 1 83 PHE n 1 84 GLY n 1 85 PHE n 1 86 THR n 1 87 ALA n 1 88 THR n 1 89 SER n 1 90 THR n 1 91 GLY n 1 92 ASN n 1 93 ASP n 1 94 PHE n 1 95 PRO n 1 96 VAL n 1 97 ASP n 1 98 SER n 1 99 ILE n 1 100 GLY n 1 101 CYS n 1 102 VAL n 1 103 ALA n 1 104 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SCO1188 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-471 / A3(2) / M145' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor A3(2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9RJY2_STRCO _struct_ref.pdbx_db_accession Q9RJY2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HTGSCMAVYSVENSWSGGFQGSVEVMNHGTEPLNGWAVQWQPGGGTTLGGVWNGSLTSGSDGTVTVRNVDHNRVVPPDGS VTFGFTATSTGNDFPVDSIGCVAP ; _struct_ref.pdbx_align_begin 261 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6F7E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RJY2 _struct_ref_seq.db_align_beg 261 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 364 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 3 '2D 1H-13C HSQC aliphatic' 2 isotropic 3 1 2 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNHA' 2 isotropic 5 1 3 '3D HNCO' 2 isotropic 6 1 3 '3D HN(CA)CO' 2 isotropic 7 1 3 '3D HNCA' 2 isotropic 8 1 3 '3D HN(COCA)CB' 2 isotropic 9 1 3 '3D HCCH-TOCSY' 2 isotropic 10 1 2 '2D CACO' 2 isotropic 11 1 3 '2D CON' 2 isotropic 12 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 2 '3D 1H-15N NOESY aliphatic' 1 isotropic 14 1 2 '3D 1H-15N NOESY aromatic' 1 isotropic 15 1 4 '2D COSY' 1 isotropic 16 1 4 '2D NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '25 mM sodium phosphate, 25 mM sodium chloride, 0.5 mM [U-98% 15N] ScCBM2, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '25 mM sodium phosphate, 25 mM sodium chloride, 0.5 mM [U-98% 13C; U-98% 15N] ScCBM2, 100% D2O' '100% D2O' 13C15N_sample_D2O solution ? 3 '25 mM sodium phosphate, 25 mM sodium chloride, 0.5 mM [U-98% 13C; U-98% 15N] ScCBM2, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C15N_sample solution ? 4 '25 mM sodium phosphate, 25 mM sodium chloride, 0.5 mM ScCBM2, 100% D2O' '100% D2O' na_sample solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 '5 mm Z-gradient CP-TCI (H/C/N) probe' 2 'AVANCE III' ? Bruker 600 '5 mm Z-gradient CP-TCI (H/C/N) probe' # _pdbx_nmr_refine.entry_id 6F7E _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6F7E _pdbx_nmr_ensemble.conformers_calculated_total_number 256 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6F7E _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 3.5 'Bruker Biospin' 2 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 1.5 'Keller and Wuthrich' 4 refinement YASARA 14.6.23 'Elmar Krieger' 6 processing MddNMR 2.0 'Orekhov, Jaravine, Mayzel and Kazimierczuk' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6F7E _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6F7E _struct.title 'NMR solution structure of the cellulose-binding family 2 carbohydrate binding domain (CBM2) from ScLPMO10C' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6F7E _struct_keywords.text 'cellulose binding, beta-sandwich fold, lytic polysaccharide monooxgynease, lpmo, CARBOHYDRATE' _struct_keywords.pdbx_keywords CARBOHYDRATE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 70 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 74 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 70 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 74 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 5 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 101 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 5 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.033 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 6 ? TRP A 15 ? MET A 6 TRP A 15 AA1 2 GLY A 18 ? MET A 26 ? GLY A 18 MET A 26 AA1 3 SER A 80 ? SER A 89 ? SER A 80 SER A 89 AA1 4 THR A 46 ? TRP A 52 ? THR A 46 TRP A 52 AA2 1 SER A 55 ? SER A 58 ? SER A 55 SER A 58 AA2 2 VAL A 64 ? ARG A 67 ? VAL A 64 ARG A 67 AA2 3 ALA A 37 ? TRP A 40 ? ALA A 37 TRP A 40 AA2 4 CYS A 101 ? VAL A 102 ? CYS A 101 VAL A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 13 ? N ASN A 13 O GLN A 20 ? O GLN A 20 AA1 2 3 N VAL A 25 ? N VAL A 25 O VAL A 81 ? O VAL A 81 AA1 3 4 O THR A 88 ? O THR A 88 N THR A 47 ? N THR A 47 AA2 1 2 N SER A 55 ? N SER A 55 O ARG A 67 ? O ARG A 67 AA2 2 3 O VAL A 66 ? O VAL A 66 N VAL A 38 ? N VAL A 38 AA2 3 4 N ALA A 37 ? N ALA A 37 O VAL A 102 ? O VAL A 102 # _atom_sites.entry_id 6F7E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 PRO 104 104 104 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6290 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-11 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2020-01-22 4 'Structure model' 1 3 2020-01-29 5 'Structure model' 1 4 2022-12-07 6 'Structure model' 1 5 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Structure summary' 7 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' database_2 6 5 'Structure model' database_2 7 5 'Structure model' struct 8 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 3 'Structure model' '_citation_author.name' 16 3 'Structure model' '_pdbx_nmr_spectrometer.model' 17 5 'Structure model' '_database_2.pdbx_DOI' 18 5 'Structure model' '_database_2.pdbx_database_accession' 19 5 'Structure model' '_struct.title' 20 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 25 ? mM 'natural abundance' 1 'sodium chloride' 25 ? mM 'natural abundance' 1 ScCBM2 0.5 ? mM '[U-98% 15N]' 2 'sodium phosphate' 25 ? mM 'natural abundance' 2 'sodium chloride' 25 ? mM 'natural abundance' 2 ScCBM2 0.5 ? mM '[U-98% 13C; U-98% 15N]' 3 'sodium phosphate' 25 ? mM 'natural abundance' 3 'sodium chloride' 25 ? mM 'natural abundance' 3 ScCBM2 0.5 ? mM '[U-98% 13C; U-98% 15N]' 4 'sodium phosphate' 25 ? mM 'natural abundance' 4 'sodium chloride' 25 ? mM 'natural abundance' 4 ScCBM2 0.5 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? 57.96 -174.29 2 2 ASP A 78 ? ? 45.14 27.38 3 3 THR A 2 ? ? 56.49 -172.80 4 3 ASP A 78 ? ? 68.56 -10.67 5 4 THR A 2 ? ? 56.75 -171.96 6 4 ASP A 78 ? ? 44.30 26.96 7 4 VAL A 96 ? ? -127.52 -71.53 8 5 SER A 4 ? ? 68.72 -13.65 9 5 ASN A 68 ? ? 52.39 70.84 10 6 THR A 2 ? ? 62.24 167.58 11 6 ASN A 68 ? ? 50.99 80.79 12 7 ASP A 78 ? ? -141.02 18.88 13 8 THR A 2 ? ? 44.42 -153.51 14 8 ASN A 68 ? ? 50.61 77.08 15 9 THR A 2 ? ? 49.81 -162.27 16 9 SER A 4 ? ? 56.57 -159.82 17 9 ASP A 78 ? ? 66.96 -1.71 18 9 VAL A 96 ? ? -110.77 -74.44 19 10 SER A 4 ? ? 56.66 -158.74 20 11 ASN A 53 ? ? -174.34 -7.49 21 11 PRO A 77 ? ? -80.38 32.94 22 12 THR A 2 ? ? 48.76 -152.96 23 12 ASP A 78 ? ? 53.38 7.97 24 12 ASP A 97 ? ? 64.51 175.49 25 13 GLU A 12 ? ? -97.05 -60.85 26 13 ASN A 68 ? ? 54.91 81.47 27 14 ASN A 68 ? ? 54.43 87.78 28 14 VAL A 96 ? ? -120.49 -58.05 29 15 SER A 4 ? ? 55.32 -154.57 30 15 ASN A 68 ? ? 56.08 73.97 31 15 VAL A 96 ? ? -123.34 -66.38 32 16 SER A 4 ? ? -95.90 -69.88 33 16 ASN A 68 ? ? 44.94 70.99 34 17 ASN A 53 ? ? 71.23 32.26 35 17 ASN A 68 ? ? 60.41 74.32 36 17 VAL A 96 ? ? -124.22 -57.46 37 18 THR A 2 ? ? 41.32 75.28 38 18 VAL A 96 ? ? -123.49 -62.81 39 19 SER A 4 ? ? 69.99 -63.58 40 19 PRO A 32 ? ? -81.57 42.06 41 19 PRO A 77 ? ? -80.67 46.43 42 20 ASN A 68 ? ? 55.01 93.64 43 20 ASP A 78 ? ? -140.75 14.30 44 20 VAL A 96 ? ? -93.21 -76.99 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Council of Norway' Norway 221576 1 'Research Council of Norway' Norway 226244 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #