data_6FEK # _entry.id 6FEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FEK pdb_00006fek 10.2210/pdb6fek/pdb WWPDB D_1200008122 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-05-02 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' reflns 2 2 'Structure model' reflns_shell 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature 8 3 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_reflns.pdbx_Rpim_I_all' 2 2 'Structure model' '_reflns_shell.pdbx_Rpim_I_all' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FEK _pdbx_database_status.recvd_initial_deposition_date 2018-01-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McDonald, N.Q.' 1 0000-0003-0975-6325 'Kohno, T.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 625 _citation.page_last 625 _citation.title 'A secondary RET mutation in the activation loop conferring resistance to vandetanib.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-02994-7 _citation.pdbx_database_id_PubMed 29434222 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakaoku, T.' 1 ? primary 'Kohno, T.' 2 ? primary 'Araki, M.' 3 ? primary 'Niho, S.' 4 ? primary 'Chauhan, R.' 5 ? primary 'Knowles, P.P.' 6 ? primary 'Tsuchihara, K.' 7 ? primary 'Matsumoto, S.' 8 ? primary 'Shimada, Y.' 9 ? primary 'Mimaki, S.' 10 ? primary 'Ishii, G.' 11 ? primary 'Ichikawa, H.' 12 ? primary 'Nagatoishi, S.' 13 ? primary 'Tsumoto, K.' 14 ? primary 'Okuno, Y.' 15 ? primary 'Yoh, K.' 16 ? primary 'McDonald, N.Q.' 17 ? primary 'Goto, K.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase receptor Ret' 34305.684 1 2.7.10.1 S904F ? ? 2 non-polymer syn 'FORMIC ACID' 46.025 3 ? ? ? ? 3 non-polymer syn ADENOSINE 267.241 1 ? ? ? ? 4 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cadherin family member 12,Proto-oncogene c-Ret' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPLSLSVDAFKILAAPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVL KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGPDERALTMGDLISFAWQISQGMQYLAEMKLVHRD LAARNILVAEGRKMKISDFGLSRDV(PTR)EEDF(PTR)VKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVT LGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLSLSVDAFKILAAPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVL KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGPDERALTMGDLISFAWQISQGMQYLAEMKLVHRD LAARNILVAEGRKMKISDFGLSRDVYEEDFYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPG IPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 ADENOSINE ADN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 SER n 1 5 LEU n 1 6 SER n 1 7 VAL n 1 8 ASP n 1 9 ALA n 1 10 PHE n 1 11 LYS n 1 12 ILE n 1 13 LEU n 1 14 ALA n 1 15 ALA n 1 16 PRO n 1 17 LYS n 1 18 TRP n 1 19 GLU n 1 20 PHE n 1 21 PRO n 1 22 ARG n 1 23 LYS n 1 24 ASN n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 LYS n 1 30 THR n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 PHE n 1 37 GLY n 1 38 LYS n 1 39 VAL n 1 40 VAL n 1 41 LYS n 1 42 ALA n 1 43 THR n 1 44 ALA n 1 45 PHE n 1 46 HIS n 1 47 LEU n 1 48 LYS n 1 49 GLY n 1 50 ARG n 1 51 ALA n 1 52 GLY n 1 53 TYR n 1 54 THR n 1 55 THR n 1 56 VAL n 1 57 ALA n 1 58 VAL n 1 59 LYS n 1 60 MET n 1 61 LEU n 1 62 LYS n 1 63 GLU n 1 64 ASN n 1 65 ALA n 1 66 SER n 1 67 PRO n 1 68 SER n 1 69 GLU n 1 70 LEU n 1 71 ARG n 1 72 ASP n 1 73 LEU n 1 74 LEU n 1 75 SER n 1 76 GLU n 1 77 PHE n 1 78 ASN n 1 79 VAL n 1 80 LEU n 1 81 LYS n 1 82 GLN n 1 83 VAL n 1 84 ASN n 1 85 HIS n 1 86 PRO n 1 87 HIS n 1 88 VAL n 1 89 ILE n 1 90 LYS n 1 91 LEU n 1 92 TYR n 1 93 GLY n 1 94 ALA n 1 95 CYS n 1 96 SER n 1 97 GLN n 1 98 ASP n 1 99 GLY n 1 100 PRO n 1 101 LEU n 1 102 LEU n 1 103 LEU n 1 104 ILE n 1 105 VAL n 1 106 GLU n 1 107 TYR n 1 108 ALA n 1 109 LYS n 1 110 TYR n 1 111 GLY n 1 112 SER n 1 113 LEU n 1 114 ARG n 1 115 GLY n 1 116 PHE n 1 117 LEU n 1 118 ARG n 1 119 GLU n 1 120 SER n 1 121 ARG n 1 122 LYS n 1 123 VAL n 1 124 GLY n 1 125 PRO n 1 126 GLY n 1 127 PRO n 1 128 ASP n 1 129 GLU n 1 130 ARG n 1 131 ALA n 1 132 LEU n 1 133 THR n 1 134 MET n 1 135 GLY n 1 136 ASP n 1 137 LEU n 1 138 ILE n 1 139 SER n 1 140 PHE n 1 141 ALA n 1 142 TRP n 1 143 GLN n 1 144 ILE n 1 145 SER n 1 146 GLN n 1 147 GLY n 1 148 MET n 1 149 GLN n 1 150 TYR n 1 151 LEU n 1 152 ALA n 1 153 GLU n 1 154 MET n 1 155 LYS n 1 156 LEU n 1 157 VAL n 1 158 HIS n 1 159 ARG n 1 160 ASP n 1 161 LEU n 1 162 ALA n 1 163 ALA n 1 164 ARG n 1 165 ASN n 1 166 ILE n 1 167 LEU n 1 168 VAL n 1 169 ALA n 1 170 GLU n 1 171 GLY n 1 172 ARG n 1 173 LYS n 1 174 MET n 1 175 LYS n 1 176 ILE n 1 177 SER n 1 178 ASP n 1 179 PHE n 1 180 GLY n 1 181 LEU n 1 182 SER n 1 183 ARG n 1 184 ASP n 1 185 VAL n 1 186 PTR n 1 187 GLU n 1 188 GLU n 1 189 ASP n 1 190 PHE n 1 191 PTR n 1 192 VAL n 1 193 LYS n 1 194 ARG n 1 195 SER n 1 196 GLN n 1 197 GLY n 1 198 ARG n 1 199 ILE n 1 200 PRO n 1 201 VAL n 1 202 LYS n 1 203 TRP n 1 204 MET n 1 205 ALA n 1 206 ILE n 1 207 GLU n 1 208 SER n 1 209 LEU n 1 210 PHE n 1 211 ASP n 1 212 HIS n 1 213 ILE n 1 214 TYR n 1 215 THR n 1 216 THR n 1 217 GLN n 1 218 SER n 1 219 ASP n 1 220 VAL n 1 221 TRP n 1 222 SER n 1 223 PHE n 1 224 GLY n 1 225 VAL n 1 226 LEU n 1 227 LEU n 1 228 TRP n 1 229 GLU n 1 230 ILE n 1 231 VAL n 1 232 THR n 1 233 LEU n 1 234 GLY n 1 235 GLY n 1 236 ASN n 1 237 PRO n 1 238 TYR n 1 239 PRO n 1 240 GLY n 1 241 ILE n 1 242 PRO n 1 243 PRO n 1 244 GLU n 1 245 ARG n 1 246 LEU n 1 247 PHE n 1 248 ASN n 1 249 LEU n 1 250 LEU n 1 251 LYS n 1 252 THR n 1 253 GLY n 1 254 HIS n 1 255 ARG n 1 256 MET n 1 257 GLU n 1 258 ARG n 1 259 PRO n 1 260 ASP n 1 261 ASN n 1 262 CYS n 1 263 SER n 1 264 GLU n 1 265 GLU n 1 266 MET n 1 267 TYR n 1 268 ARG n 1 269 LEU n 1 270 MET n 1 271 LEU n 1 272 GLN n 1 273 CYS n 1 274 TRP n 1 275 LYS n 1 276 GLN n 1 277 GLU n 1 278 PRO n 1 279 ASP n 1 280 LYS n 1 281 ARG n 1 282 PRO n 1 283 VAL n 1 284 PHE n 1 285 ALA n 1 286 ASP n 1 287 ILE n 1 288 SER n 1 289 LYS n 1 290 ASP n 1 291 LEU n 1 292 GLU n 1 293 LYS n 1 294 MET n 1 295 MET n 1 296 VAL n 1 297 LYS n 1 298 ARG n 1 299 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RET, CDHF12, CDHR16, PTC, RET51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADN non-polymer . ADENOSINE ? 'C10 H13 N5 O4' 267.241 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 700 700 GLY GLY A . n A 1 2 PRO 2 701 701 PRO PRO A . n A 1 3 LEU 3 702 702 LEU LEU A . n A 1 4 SER 4 703 703 SER SER A . n A 1 5 LEU 5 704 704 LEU LEU A . n A 1 6 SER 6 705 705 SER SER A . n A 1 7 VAL 7 706 706 VAL VAL A . n A 1 8 ASP 8 707 707 ASP ASP A . n A 1 9 ALA 9 708 708 ALA ALA A . n A 1 10 PHE 10 709 709 PHE PHE A . n A 1 11 LYS 11 710 710 LYS LYS A . n A 1 12 ILE 12 711 711 ILE ILE A . n A 1 13 LEU 13 712 712 LEU LEU A . n A 1 14 ALA 14 713 713 ALA ALA A . n A 1 15 ALA 15 714 714 ALA ALA A . n A 1 16 PRO 16 715 715 PRO PRO A . n A 1 17 LYS 17 716 716 LYS LYS A . n A 1 18 TRP 18 717 717 TRP TRP A . n A 1 19 GLU 19 718 718 GLU GLU A . n A 1 20 PHE 20 719 719 PHE PHE A . n A 1 21 PRO 21 720 720 PRO PRO A . n A 1 22 ARG 22 721 721 ARG ARG A . n A 1 23 LYS 23 722 722 LYS LYS A . n A 1 24 ASN 24 723 723 ASN ASN A . n A 1 25 LEU 25 724 724 LEU LEU A . n A 1 26 VAL 26 725 725 VAL VAL A . n A 1 27 LEU 27 726 726 LEU LEU A . n A 1 28 GLY 28 727 727 GLY GLY A . n A 1 29 LYS 29 728 728 LYS LYS A . n A 1 30 THR 30 729 729 THR THR A . n A 1 31 LEU 31 730 730 LEU LEU A . n A 1 32 GLY 32 731 731 GLY GLY A . n A 1 33 GLU 33 732 732 GLU GLU A . n A 1 34 GLY 34 733 733 GLY GLY A . n A 1 35 GLU 35 734 734 GLU GLU A . n A 1 36 PHE 36 735 735 PHE ALA A . n A 1 37 GLY 37 736 736 GLY GLY A . n A 1 38 LYS 38 737 737 LYS LYS A . n A 1 39 VAL 39 738 738 VAL VAL A . n A 1 40 VAL 40 739 739 VAL VAL A . n A 1 41 LYS 41 740 740 LYS LYS A . n A 1 42 ALA 42 741 741 ALA ALA A . n A 1 43 THR 43 742 742 THR THR A . n A 1 44 ALA 44 743 743 ALA ALA A . n A 1 45 PHE 45 744 744 PHE PHE A . n A 1 46 HIS 46 745 745 HIS HIS A . n A 1 47 LEU 47 746 746 LEU LEU A . n A 1 48 LYS 48 747 747 LYS LYS A . n A 1 49 GLY 49 748 748 GLY GLY A . n A 1 50 ARG 50 749 749 ARG ARG A . n A 1 51 ALA 51 750 750 ALA ALA A . n A 1 52 GLY 52 751 751 GLY GLY A . n A 1 53 TYR 53 752 752 TYR TYR A . n A 1 54 THR 54 753 753 THR THR A . n A 1 55 THR 55 754 754 THR THR A . n A 1 56 VAL 56 755 755 VAL VAL A . n A 1 57 ALA 57 756 756 ALA ALA A . n A 1 58 VAL 58 757 757 VAL VAL A . n A 1 59 LYS 59 758 758 LYS LYS A . n A 1 60 MET 60 759 759 MET MET A . n A 1 61 LEU 61 760 760 LEU LEU A . n A 1 62 LYS 62 761 761 LYS LYS A . n A 1 63 GLU 63 762 762 GLU GLU A . n A 1 64 ASN 64 763 763 ASN ASN A . n A 1 65 ALA 65 764 764 ALA ALA A . n A 1 66 SER 66 765 765 SER SER A . n A 1 67 PRO 67 766 766 PRO PRO A . n A 1 68 SER 68 767 767 SER SER A . n A 1 69 GLU 69 768 768 GLU GLU A . n A 1 70 LEU 70 769 769 LEU LEU A . n A 1 71 ARG 71 770 770 ARG ARG A . n A 1 72 ASP 72 771 771 ASP ASP A . n A 1 73 LEU 73 772 772 LEU LEU A . n A 1 74 LEU 74 773 773 LEU LEU A . n A 1 75 SER 75 774 774 SER SER A . n A 1 76 GLU 76 775 775 GLU GLU A . n A 1 77 PHE 77 776 776 PHE PHE A . n A 1 78 ASN 78 777 777 ASN ASN A . n A 1 79 VAL 79 778 778 VAL VAL A . n A 1 80 LEU 80 779 779 LEU LEU A . n A 1 81 LYS 81 780 780 LYS LYS A . n A 1 82 GLN 82 781 781 GLN GLN A . n A 1 83 VAL 83 782 782 VAL VAL A . n A 1 84 ASN 84 783 783 ASN ASN A . n A 1 85 HIS 85 784 784 HIS HIS A . n A 1 86 PRO 86 785 785 PRO PRO A . n A 1 87 HIS 87 786 786 HIS HIS A . n A 1 88 VAL 88 787 787 VAL VAL A . n A 1 89 ILE 89 788 788 ILE ILE A . n A 1 90 LYS 90 789 789 LYS LYS A . n A 1 91 LEU 91 790 790 LEU LEU A . n A 1 92 TYR 92 791 791 TYR TYR A . n A 1 93 GLY 93 792 792 GLY GLY A . n A 1 94 ALA 94 793 793 ALA ALA A . n A 1 95 CYS 95 794 794 CYS CYS A . n A 1 96 SER 96 795 795 SER SER A . n A 1 97 GLN 97 796 796 GLN GLN A . n A 1 98 ASP 98 797 797 ASP ASP A . n A 1 99 GLY 99 798 798 GLY GLY A . n A 1 100 PRO 100 799 799 PRO PRO A . n A 1 101 LEU 101 800 800 LEU LEU A . n A 1 102 LEU 102 801 801 LEU LEU A . n A 1 103 LEU 103 802 802 LEU LEU A . n A 1 104 ILE 104 803 803 ILE ILE A . n A 1 105 VAL 105 804 804 VAL VAL A . n A 1 106 GLU 106 805 805 GLU GLU A . n A 1 107 TYR 107 806 806 TYR TYR A . n A 1 108 ALA 108 807 807 ALA ALA A . n A 1 109 LYS 109 808 808 LYS LYS A . n A 1 110 TYR 110 809 809 TYR TYR A . n A 1 111 GLY 111 810 810 GLY GLY A . n A 1 112 SER 112 811 811 SER SER A . n A 1 113 LEU 113 812 812 LEU LEU A . n A 1 114 ARG 114 813 813 ARG ARG A . n A 1 115 GLY 115 814 814 GLY GLY A . n A 1 116 PHE 116 815 815 PHE PHE A . n A 1 117 LEU 117 816 816 LEU LEU A . n A 1 118 ARG 118 817 817 ARG ARG A . n A 1 119 GLU 119 818 818 GLU GLU A . n A 1 120 SER 120 819 819 SER SER A . n A 1 121 ARG 121 820 820 ARG ARG A . n A 1 122 LYS 122 821 821 LYS LYS A . n A 1 123 VAL 123 822 822 VAL VAL A . n A 1 124 GLY 124 823 823 GLY GLY A . n A 1 125 PRO 125 824 824 PRO PRO A . n A 1 126 GLY 126 825 825 GLY GLY A . n A 1 127 PRO 127 841 841 PRO PRO A . n A 1 128 ASP 128 842 842 ASP ASP A . n A 1 129 GLU 129 843 843 GLU GLU A . n A 1 130 ARG 130 844 844 ARG ARG A . n A 1 131 ALA 131 845 845 ALA ALA A . n A 1 132 LEU 132 846 846 LEU LEU A . n A 1 133 THR 133 847 847 THR THR A . n A 1 134 MET 134 848 848 MET MET A . n A 1 135 GLY 135 849 849 GLY GLY A . n A 1 136 ASP 136 850 850 ASP ASP A . n A 1 137 LEU 137 851 851 LEU LEU A . n A 1 138 ILE 138 852 852 ILE ILE A . n A 1 139 SER 139 853 853 SER SER A . n A 1 140 PHE 140 854 854 PHE PHE A . n A 1 141 ALA 141 855 855 ALA ALA A . n A 1 142 TRP 142 856 856 TRP TRP A . n A 1 143 GLN 143 857 857 GLN GLN A . n A 1 144 ILE 144 858 858 ILE ILE A . n A 1 145 SER 145 859 859 SER SER A . n A 1 146 GLN 146 860 860 GLN GLN A . n A 1 147 GLY 147 861 861 GLY GLY A . n A 1 148 MET 148 862 862 MET MET A . n A 1 149 GLN 149 863 863 GLN GLN A . n A 1 150 TYR 150 864 864 TYR TYR A . n A 1 151 LEU 151 865 865 LEU LEU A . n A 1 152 ALA 152 866 866 ALA ALA A . n A 1 153 GLU 153 867 867 GLU GLU A . n A 1 154 MET 154 868 868 MET MET A . n A 1 155 LYS 155 869 869 LYS LYS A . n A 1 156 LEU 156 870 870 LEU LEU A . n A 1 157 VAL 157 871 871 VAL VAL A . n A 1 158 HIS 158 872 872 HIS HIS A . n A 1 159 ARG 159 873 873 ARG ARG A . n A 1 160 ASP 160 874 874 ASP ASP A . n A 1 161 LEU 161 875 875 LEU LEU A . n A 1 162 ALA 162 876 876 ALA ALA A . n A 1 163 ALA 163 877 877 ALA ALA A . n A 1 164 ARG 164 878 878 ARG ALA A . n A 1 165 ASN 165 879 879 ASN ASN A . n A 1 166 ILE 166 880 880 ILE ILE A . n A 1 167 LEU 167 881 881 LEU LEU A . n A 1 168 VAL 168 882 882 VAL VAL A . n A 1 169 ALA 169 883 883 ALA ALA A . n A 1 170 GLU 170 884 884 GLU GLU A . n A 1 171 GLY 171 885 885 GLY GLY A . n A 1 172 ARG 172 886 886 ARG ARG A . n A 1 173 LYS 173 887 887 LYS LYS A . n A 1 174 MET 174 888 888 MET MET A . n A 1 175 LYS 175 889 889 LYS LYS A . n A 1 176 ILE 176 890 890 ILE ILE A . n A 1 177 SER 177 891 891 SER SER A . n A 1 178 ASP 178 892 892 ASP ASP A . n A 1 179 PHE 179 893 893 PHE PHE A . n A 1 180 GLY 180 894 894 GLY GLY A . n A 1 181 LEU 181 895 895 LEU LEU A . n A 1 182 SER 182 896 896 SER SER A . n A 1 183 ARG 183 897 897 ARG ARG A . n A 1 184 ASP 184 898 898 ASP ASP A . n A 1 185 VAL 185 899 899 VAL VAL A . n A 1 186 PTR 186 900 900 PTR PTR A . n A 1 187 GLU 187 901 901 GLU GLU A . n A 1 188 GLU 188 902 902 GLU GLU A . n A 1 189 ASP 189 903 903 ASP ASP A . n A 1 190 PHE 190 904 904 PHE PHE A . n A 1 191 PTR 191 905 905 PTR PTR A . n A 1 192 VAL 192 906 906 VAL VAL A . n A 1 193 LYS 193 907 907 LYS LYS A . n A 1 194 ARG 194 908 908 ARG ARG A . n A 1 195 SER 195 909 909 SER SER A . n A 1 196 GLN 196 910 910 GLN GLN A . n A 1 197 GLY 197 911 911 GLY GLY A . n A 1 198 ARG 198 912 912 ARG ARG A . n A 1 199 ILE 199 913 913 ILE ILE A . n A 1 200 PRO 200 914 914 PRO PRO A . n A 1 201 VAL 201 915 915 VAL VAL A . n A 1 202 LYS 202 916 916 LYS LYS A . n A 1 203 TRP 203 917 917 TRP TRP A . n A 1 204 MET 204 918 918 MET MET A . n A 1 205 ALA 205 919 919 ALA ALA A . n A 1 206 ILE 206 920 920 ILE ILE A . n A 1 207 GLU 207 921 921 GLU GLU A . n A 1 208 SER 208 922 922 SER SER A . n A 1 209 LEU 209 923 923 LEU LEU A . n A 1 210 PHE 210 924 924 PHE PHE A . n A 1 211 ASP 211 925 925 ASP ASP A . n A 1 212 HIS 212 926 926 HIS HIS A . n A 1 213 ILE 213 927 927 ILE ILE A . n A 1 214 TYR 214 928 928 TYR TYR A . n A 1 215 THR 215 929 929 THR THR A . n A 1 216 THR 216 930 930 THR THR A . n A 1 217 GLN 217 931 931 GLN GLN A . n A 1 218 SER 218 932 932 SER SER A . n A 1 219 ASP 219 933 933 ASP ASP A . n A 1 220 VAL 220 934 934 VAL VAL A . n A 1 221 TRP 221 935 935 TRP TRP A . n A 1 222 SER 222 936 936 SER SER A . n A 1 223 PHE 223 937 937 PHE PHE A . n A 1 224 GLY 224 938 938 GLY GLY A . n A 1 225 VAL 225 939 939 VAL VAL A . n A 1 226 LEU 226 940 940 LEU LEU A . n A 1 227 LEU 227 941 941 LEU LEU A . n A 1 228 TRP 228 942 942 TRP TRP A . n A 1 229 GLU 229 943 943 GLU GLU A . n A 1 230 ILE 230 944 944 ILE ILE A . n A 1 231 VAL 231 945 945 VAL VAL A . n A 1 232 THR 232 946 946 THR THR A . n A 1 233 LEU 233 947 947 LEU LEU A . n A 1 234 GLY 234 948 948 GLY GLY A . n A 1 235 GLY 235 949 949 GLY GLY A . n A 1 236 ASN 236 950 950 ASN ASN A . n A 1 237 PRO 237 951 951 PRO PRO A . n A 1 238 TYR 238 952 952 TYR TYR A . n A 1 239 PRO 239 953 953 PRO PRO A . n A 1 240 GLY 240 954 954 GLY GLY A . n A 1 241 ILE 241 955 955 ILE ILE A . n A 1 242 PRO 242 956 956 PRO PRO A . n A 1 243 PRO 243 957 957 PRO PRO A . n A 1 244 GLU 244 958 958 GLU GLU A . n A 1 245 ARG 245 959 959 ARG ARG A . n A 1 246 LEU 246 960 960 LEU LEU A . n A 1 247 PHE 247 961 961 PHE PHE A . n A 1 248 ASN 248 962 962 ASN ASN A . n A 1 249 LEU 249 963 963 LEU LEU A . n A 1 250 LEU 250 964 964 LEU LEU A . n A 1 251 LYS 251 965 965 LYS LYS A . n A 1 252 THR 252 966 966 THR THR A . n A 1 253 GLY 253 967 967 GLY GLY A . n A 1 254 HIS 254 968 968 HIS HIS A . n A 1 255 ARG 255 969 969 ARG ARG A . n A 1 256 MET 256 970 970 MET MET A . n A 1 257 GLU 257 971 971 GLU GLU A . n A 1 258 ARG 258 972 972 ARG ARG A . n A 1 259 PRO 259 973 973 PRO PRO A . n A 1 260 ASP 260 974 974 ASP ASP A . n A 1 261 ASN 261 975 975 ASN ASN A . n A 1 262 CYS 262 976 976 CYS CYS A . n A 1 263 SER 263 977 977 SER SER A . n A 1 264 GLU 264 978 978 GLU GLU A . n A 1 265 GLU 265 979 979 GLU ALA A . n A 1 266 MET 266 980 980 MET MET A . n A 1 267 TYR 267 981 981 TYR TYR A . n A 1 268 ARG 268 982 982 ARG ARG A . n A 1 269 LEU 269 983 983 LEU LEU A . n A 1 270 MET 270 984 984 MET MET A . n A 1 271 LEU 271 985 985 LEU LEU A . n A 1 272 GLN 272 986 986 GLN GLN A . n A 1 273 CYS 273 987 987 CYS CYS A . n A 1 274 TRP 274 988 988 TRP TRP A . n A 1 275 LYS 275 989 989 LYS LYS A . n A 1 276 GLN 276 990 990 GLN GLN A . n A 1 277 GLU 277 991 991 GLU GLU A . n A 1 278 PRO 278 992 992 PRO PRO A . n A 1 279 ASP 279 993 993 ASP ASP A . n A 1 280 LYS 280 994 994 LYS LYS A . n A 1 281 ARG 281 995 995 ARG ARG A . n A 1 282 PRO 282 996 996 PRO PRO A . n A 1 283 VAL 283 997 997 VAL VAL A . n A 1 284 PHE 284 998 998 PHE PHE A . n A 1 285 ALA 285 999 999 ALA ALA A . n A 1 286 ASP 286 1000 1000 ASP ASP A . n A 1 287 ILE 287 1001 1001 ILE ILE A . n A 1 288 SER 288 1002 1002 SER SER A . n A 1 289 LYS 289 1003 1003 LYS LYS A . n A 1 290 ASP 290 1004 1004 ASP ASP A . n A 1 291 LEU 291 1005 1005 LEU LEU A . n A 1 292 GLU 292 1006 1006 GLU GLU A . n A 1 293 LYS 293 1007 1007 LYS LYS A . n A 1 294 MET 294 1008 1008 MET MET A . n A 1 295 MET 295 1009 1009 MET MET A . n A 1 296 VAL 296 1010 1010 VAL VAL A . n A 1 297 LYS 297 1011 ? ? ? A . n A 1 298 ARG 298 1012 ? ? ? A . n A 1 299 ARG 299 1013 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 1101 2 FMT FMT A . C 2 FMT 1 1102 3 FMT FMT A . D 2 FMT 1 1103 4 FMT FMT A . E 3 ADN 1 1104 1 ADN ADN A . F 4 HOH 1 1201 13 HOH HOH A . F 4 HOH 2 1202 8 HOH HOH A . F 4 HOH 3 1203 9 HOH HOH A . F 4 HOH 4 1204 39 HOH HOH A . F 4 HOH 5 1205 37 HOH HOH A . F 4 HOH 6 1206 23 HOH HOH A . F 4 HOH 7 1207 19 HOH HOH A . F 4 HOH 8 1208 14 HOH HOH A . F 4 HOH 9 1209 15 HOH HOH A . F 4 HOH 10 1210 11 HOH HOH A . F 4 HOH 11 1211 38 HOH HOH A . F 4 HOH 12 1212 35 HOH HOH A . F 4 HOH 13 1213 33 HOH HOH A . F 4 HOH 14 1214 31 HOH HOH A . F 4 HOH 15 1215 6 HOH HOH A . F 4 HOH 16 1216 26 HOH HOH A . F 4 HOH 17 1217 21 HOH HOH A . F 4 HOH 18 1218 41 HOH HOH A . F 4 HOH 19 1219 24 HOH HOH A . F 4 HOH 20 1220 16 HOH HOH A . F 4 HOH 21 1221 43 HOH HOH A . F 4 HOH 22 1222 27 HOH HOH A . F 4 HOH 23 1223 1 HOH HOH A . F 4 HOH 24 1224 36 HOH HOH A . F 4 HOH 25 1225 40 HOH HOH A . F 4 HOH 26 1226 12 HOH HOH A . F 4 HOH 27 1227 22 HOH HOH A . F 4 HOH 28 1228 20 HOH HOH A . F 4 HOH 29 1229 3 HOH HOH A . F 4 HOH 30 1230 32 HOH HOH A . F 4 HOH 31 1231 7 HOH HOH A . F 4 HOH 32 1232 34 HOH HOH A . F 4 HOH 33 1233 42 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 710 ? CG ? A LYS 11 CG 2 1 Y 1 A LYS 710 ? CD ? A LYS 11 CD 3 1 Y 1 A LYS 710 ? CE ? A LYS 11 CE 4 1 Y 1 A LYS 710 ? NZ ? A LYS 11 NZ 5 1 Y 1 A ILE 711 ? CG1 ? A ILE 12 CG1 6 1 Y 1 A ILE 711 ? CG2 ? A ILE 12 CG2 7 1 Y 1 A ILE 711 ? CD1 ? A ILE 12 CD1 8 1 Y 1 A LYS 716 ? CG ? A LYS 17 CG 9 1 Y 1 A LYS 716 ? CD ? A LYS 17 CD 10 1 Y 1 A LYS 716 ? CE ? A LYS 17 CE 11 1 Y 1 A LYS 716 ? NZ ? A LYS 17 NZ 12 1 Y 1 A LYS 722 ? CG ? A LYS 23 CG 13 1 Y 1 A LYS 722 ? CD ? A LYS 23 CD 14 1 Y 1 A LYS 722 ? CE ? A LYS 23 CE 15 1 Y 1 A LYS 722 ? NZ ? A LYS 23 NZ 16 1 Y 1 A GLU 732 ? CD ? A GLU 33 CD 17 1 Y 1 A GLU 732 ? OE1 ? A GLU 33 OE1 18 1 Y 1 A GLU 732 ? OE2 ? A GLU 33 OE2 19 1 Y 1 A GLU 734 ? CG ? A GLU 35 CG 20 1 Y 1 A GLU 734 ? CD ? A GLU 35 CD 21 1 Y 1 A GLU 734 ? OE1 ? A GLU 35 OE1 22 1 Y 1 A GLU 734 ? OE2 ? A GLU 35 OE2 23 1 Y 1 A PHE 735 ? CG ? A PHE 36 CG 24 1 Y 1 A PHE 735 ? CD1 ? A PHE 36 CD1 25 1 Y 1 A PHE 735 ? CD2 ? A PHE 36 CD2 26 1 Y 1 A PHE 735 ? CE1 ? A PHE 36 CE1 27 1 Y 1 A PHE 735 ? CE2 ? A PHE 36 CE2 28 1 Y 1 A PHE 735 ? CZ ? A PHE 36 CZ 29 1 Y 1 A LYS 747 ? CG ? A LYS 48 CG 30 1 Y 1 A LYS 747 ? CD ? A LYS 48 CD 31 1 Y 1 A LYS 747 ? CE ? A LYS 48 CE 32 1 Y 1 A LYS 747 ? NZ ? A LYS 48 NZ 33 1 Y 1 A ARG 749 ? CG ? A ARG 50 CG 34 1 Y 1 A ARG 749 ? CD ? A ARG 50 CD 35 1 Y 1 A ARG 749 ? NE ? A ARG 50 NE 36 1 Y 1 A ARG 749 ? CZ ? A ARG 50 CZ 37 1 Y 1 A ARG 749 ? NH1 ? A ARG 50 NH1 38 1 Y 1 A ARG 749 ? NH2 ? A ARG 50 NH2 39 1 Y 1 A LYS 758 ? NZ ? A LYS 59 NZ 40 1 Y 1 A LYS 761 ? CG ? A LYS 62 CG 41 1 Y 1 A LYS 761 ? CD ? A LYS 62 CD 42 1 Y 1 A LYS 761 ? CE ? A LYS 62 CE 43 1 Y 1 A LYS 761 ? NZ ? A LYS 62 NZ 44 1 Y 1 A GLU 762 ? CG ? A GLU 63 CG 45 1 Y 1 A GLU 762 ? CD ? A GLU 63 CD 46 1 Y 1 A GLU 762 ? OE1 ? A GLU 63 OE1 47 1 Y 1 A GLU 762 ? OE2 ? A GLU 63 OE2 48 1 Y 1 A ASP 797 ? CG ? A ASP 98 CG 49 1 Y 1 A ASP 797 ? OD1 ? A ASP 98 OD1 50 1 Y 1 A ASP 797 ? OD2 ? A ASP 98 OD2 51 1 Y 1 A GLU 818 ? CG ? A GLU 119 CG 52 1 Y 1 A GLU 818 ? CD ? A GLU 119 CD 53 1 Y 1 A GLU 818 ? OE1 ? A GLU 119 OE1 54 1 Y 1 A GLU 818 ? OE2 ? A GLU 119 OE2 55 1 Y 1 A LYS 821 ? CD ? A LYS 122 CD 56 1 Y 1 A LYS 821 ? CE ? A LYS 122 CE 57 1 Y 1 A LYS 821 ? NZ ? A LYS 122 NZ 58 1 Y 1 A ASP 842 ? CG ? A ASP 128 CG 59 1 Y 1 A ASP 842 ? OD1 ? A ASP 128 OD1 60 1 Y 1 A ASP 842 ? OD2 ? A ASP 128 OD2 61 1 Y 0 A SER 859 ? CA A A SER 145 CA 62 1 Y 0 A SER 859 ? CB A A SER 145 CB 63 1 Y 0 A SER 859 ? OG A A SER 145 OG 64 1 Y 1 A GLU 867 ? CD ? A GLU 153 CD 65 1 Y 1 A GLU 867 ? OE1 ? A GLU 153 OE1 66 1 Y 1 A GLU 867 ? OE2 ? A GLU 153 OE2 67 1 Y 1 A LYS 869 ? NZ ? A LYS 155 NZ 68 1 Y 1 A ARG 878 ? CG ? A ARG 164 CG 69 1 Y 1 A ARG 878 ? CD ? A ARG 164 CD 70 1 Y 1 A ARG 878 ? NE ? A ARG 164 NE 71 1 Y 1 A ARG 878 ? CZ ? A ARG 164 CZ 72 1 Y 1 A ARG 878 ? NH1 ? A ARG 164 NH1 73 1 Y 1 A ARG 878 ? NH2 ? A ARG 164 NH2 74 1 Y 1 A GLU 884 ? OE1 ? A GLU 170 OE1 75 1 Y 1 A GLU 884 ? OE2 ? A GLU 170 OE2 76 1 Y 1 A ASP 892 ? CG ? A ASP 178 CG 77 1 Y 1 A ASP 892 ? OD1 ? A ASP 178 OD1 78 1 Y 1 A ASP 892 ? OD2 ? A ASP 178 OD2 79 1 Y 1 A GLU 901 ? CD ? A GLU 187 CD 80 1 Y 1 A GLU 901 ? OE1 ? A GLU 187 OE1 81 1 Y 1 A GLU 901 ? OE2 ? A GLU 187 OE2 82 1 Y 1 A ARG 959 ? NE ? A ARG 245 NE 83 1 Y 1 A ARG 959 ? CZ ? A ARG 245 CZ 84 1 Y 1 A ARG 959 ? NH1 ? A ARG 245 NH1 85 1 Y 1 A ARG 959 ? NH2 ? A ARG 245 NH2 86 1 Y 1 A LYS 965 ? CE ? A LYS 251 CE 87 1 Y 1 A LYS 965 ? NZ ? A LYS 251 NZ 88 1 Y 1 A GLU 978 ? CG ? A GLU 264 CG 89 1 Y 1 A GLU 978 ? CD ? A GLU 264 CD 90 1 Y 1 A GLU 978 ? OE1 ? A GLU 264 OE1 91 1 Y 1 A GLU 978 ? OE2 ? A GLU 264 OE2 92 1 Y 1 A GLU 979 ? CG ? A GLU 265 CG 93 1 Y 1 A GLU 979 ? CD ? A GLU 265 CD 94 1 Y 1 A GLU 979 ? OE1 ? A GLU 265 OE1 95 1 Y 1 A GLU 979 ? OE2 ? A GLU 265 OE2 96 1 Y 1 A LYS 989 ? CE ? A LYS 275 CE 97 1 Y 1 A LYS 989 ? NZ ? A LYS 275 NZ 98 1 Y 1 A LYS 994 ? CE ? A LYS 280 CE 99 1 Y 1 A LYS 994 ? NZ ? A LYS 280 NZ 100 1 Y 1 A LYS 1003 ? CE ? A LYS 289 CE 101 1 Y 1 A LYS 1003 ? NZ ? A LYS 289 NZ 102 1 Y 1 A LYS 1007 ? CE ? A LYS 293 CE 103 1 Y 1 A LYS 1007 ? NZ ? A LYS 293 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6FEK _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.901 _cell.length_a_esd ? _cell.length_b 50.901 _cell.length_b_esd ? _cell.length_c 242.515 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FEK _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FEK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.84 _exptl_crystal.description plates _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.4 M sodium formate, and 0.1 M sodium acetate pH 4.4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 28.3 _reflns.entry_id 6FEK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 48.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27003 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1364 _reflns_shell.percent_possible_all 97 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 25.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.340 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.641 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FEK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 46.934 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27002 _refine.ls_number_reflns_R_free 1364 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2029 _refine.ls_R_factor_R_free 0.2441 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2007 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.62 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2276 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 2337 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 46.934 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2369 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.582 ? 3217 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.051 ? 1401 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 356 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 405 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3000 2.3822 . . 139 2558 100.00 . . . 0.2870 . 0.2790 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3822 2.4776 . . 140 2591 100.00 . . . 0.3470 . 0.2681 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4776 2.5904 . . 137 2535 100.00 . . . 0.2767 . 0.2552 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5904 2.7269 . . 134 2566 100.00 . . . 0.2734 . 0.2486 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7269 2.8977 . . 131 2568 100.00 . . . 0.2823 . 0.2282 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8977 3.1214 . . 142 2571 100.00 . . . 0.2715 . 0.2383 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1214 3.4355 . . 133 2584 100.00 . . . 0.2469 . 0.2038 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4355 3.9324 . . 130 2542 99.00 . . . 0.2586 . 0.1847 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9324 4.9535 . . 136 2559 100.00 . . . 0.1622 . 0.1491 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9535 46.9433 . . 142 2564 100.00 . . . 0.2395 . 0.1769 . . . . . . . . . . # _struct.entry_id 6FEK _struct.title 'Oncogenic point mutation of RET receptor tyrosine kinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FEK _struct_keywords.text 'tyrosine kinase, oncogene, mutation, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RET_HUMAN _struct_ref.pdbx_db_accession P07949 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNH PHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQY LAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEI VTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR ; _struct_ref.pdbx_align_begin 705 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FEK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07949 _struct_ref_seq.db_align_beg 705 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1013 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 705 _struct_ref_seq.pdbx_auth_seq_align_end 1013 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FEK GLY A 1 ? UNP P07949 ? ? 'expression tag' 700 1 1 6FEK PRO A 2 ? UNP P07949 ? ? 'expression tag' 701 2 1 6FEK LEU A 3 ? UNP P07949 ? ? 'expression tag' 702 3 1 6FEK SER A 4 ? UNP P07949 ? ? 'expression tag' 703 4 1 6FEK LEU A 5 ? UNP P07949 ? ? 'expression tag' 704 5 1 6FEK ALA A 14 ? UNP P07949 GLU 713 conflict 713 6 1 6FEK ALA A 15 ? UNP P07949 ASP 714 conflict 714 7 1 6FEK ? A ? ? UNP P07949 TYR 826 deletion ? 8 1 6FEK ? A ? ? UNP P07949 LEU 827 deletion ? 9 1 6FEK ? A ? ? UNP P07949 GLY 828 deletion ? 10 1 6FEK ? A ? ? UNP P07949 SER 829 deletion ? 11 1 6FEK ? A ? ? UNP P07949 GLY 830 deletion ? 12 1 6FEK ? A ? ? UNP P07949 GLY 831 deletion ? 13 1 6FEK ? A ? ? UNP P07949 SER 832 deletion ? 14 1 6FEK ? A ? ? UNP P07949 ARG 833 deletion ? 15 1 6FEK ? A ? ? UNP P07949 ASN 834 deletion ? 16 1 6FEK ? A ? ? UNP P07949 SER 835 deletion ? 17 1 6FEK ? A ? ? UNP P07949 SER 836 deletion ? 18 1 6FEK ? A ? ? UNP P07949 SER 837 deletion ? 19 1 6FEK ? A ? ? UNP P07949 LEU 838 deletion ? 20 1 6FEK ? A ? ? UNP P07949 ASP 839 deletion ? 21 1 6FEK ? A ? ? UNP P07949 HIS 840 deletion ? 22 1 6FEK PHE A 190 ? UNP P07949 SER 904 'engineered mutation' 904 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1010 ? 1 MORE 3 ? 1 'SSA (A^2)' 14350 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? LEU A 13 ? GLY A 700 LEU A 712 1 ? 13 HELX_P HELX_P2 AA2 PRO A 21 ? LYS A 23 ? PRO A 720 LYS A 722 5 ? 3 HELX_P HELX_P3 AA3 SER A 66 ? LYS A 81 ? SER A 765 LYS A 780 1 ? 16 HELX_P HELX_P4 AA4 SER A 112 ? LYS A 122 ? SER A 811 LYS A 821 1 ? 11 HELX_P HELX_P5 AA5 THR A 133 ? MET A 154 ? THR A 847 MET A 868 1 ? 22 HELX_P HELX_P6 AA6 ALA A 162 ? ARG A 164 ? ALA A 876 ARG A 878 5 ? 3 HELX_P HELX_P7 AA7 PRO A 200 ? MET A 204 ? PRO A 914 MET A 918 5 ? 5 HELX_P HELX_P8 AA8 ALA A 205 ? HIS A 212 ? ALA A 919 HIS A 926 1 ? 8 HELX_P HELX_P9 AA9 THR A 215 ? THR A 232 ? THR A 929 THR A 946 1 ? 18 HELX_P HELX_P10 AB1 PRO A 242 ? GLU A 244 ? PRO A 956 GLU A 958 5 ? 3 HELX_P HELX_P11 AB2 ARG A 245 ? THR A 252 ? ARG A 959 THR A 966 1 ? 8 HELX_P HELX_P12 AB3 SER A 263 ? TRP A 274 ? SER A 977 TRP A 988 1 ? 12 HELX_P HELX_P13 AB4 GLU A 277 ? ARG A 281 ? GLU A 991 ARG A 995 5 ? 5 HELX_P HELX_P14 AB5 VAL A 283 ? MET A 294 ? VAL A 997 MET A 1008 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 185 C ? ? ? 1_555 A PTR 186 N ? ? A VAL 899 A PTR 900 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A PTR 186 C ? ? ? 1_555 A GLU 187 N ? ? A PTR 900 A GLU 901 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A PHE 190 C ? ? ? 1_555 A PTR 191 N ? ? A PHE 904 A PTR 905 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A PTR 191 C ? ? ? 1_555 A VAL 192 N ? ? A PTR 905 A VAL 906 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR A 186 ? . . . . PTR A 900 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 PTR A 191 ? . . . . PTR A 905 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 25 ? GLU A 33 ? LEU A 724 GLU A 732 AA1 2 GLY A 37 ? LEU A 47 ? GLY A 736 LEU A 746 AA1 3 ARG A 50 ? LEU A 61 ? ARG A 749 LEU A 760 AA1 4 LEU A 102 ? GLU A 106 ? LEU A 801 GLU A 805 AA1 5 LEU A 91 ? CYS A 95 ? LEU A 790 CYS A 794 AA2 1 LEU A 156 ? VAL A 157 ? LEU A 870 VAL A 871 AA2 2 ARG A 183 ? ASP A 184 ? ARG A 897 ASP A 898 AA3 1 ILE A 166 ? ALA A 169 ? ILE A 880 ALA A 883 AA3 2 LYS A 173 ? ILE A 176 ? LYS A 887 ILE A 890 AA4 1 PTR A 191 ? VAL A 192 ? PTR A 905 VAL A 906 AA4 2 ILE A 213 ? TYR A 214 ? ILE A 927 TYR A 928 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 28 ? N GLY A 727 O LYS A 41 ? O LYS A 740 AA1 2 3 N ALA A 44 ? N ALA A 743 O THR A 54 ? O THR A 753 AA1 3 4 N ALA A 57 ? N ALA A 756 O VAL A 105 ? O VAL A 804 AA1 4 5 O ILE A 104 ? O ILE A 803 N GLY A 93 ? N GLY A 792 AA2 1 2 N VAL A 157 ? N VAL A 871 O ARG A 183 ? O ARG A 897 AA3 1 2 N LEU A 167 ? N LEU A 881 O LYS A 175 ? O LYS A 889 AA4 1 2 N PTR A 191 ? N PTR A 905 O TYR A 214 ? O TYR A 928 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FMT 1101 ? 4 'binding site for residue FMT A 1101' AC2 Software A FMT 1102 ? 7 'binding site for residue FMT A 1102' AC3 Software A FMT 1103 ? 5 'binding site for residue FMT A 1103' AC4 Software A ADN 1104 ? 6 'binding site for residue ADN A 1104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 159 ? ARG A 873 . ? 1_555 ? 2 AC1 4 LYS A 193 ? LYS A 907 . ? 1_555 ? 3 AC1 4 GLY A 197 ? GLY A 911 . ? 1_555 ? 4 AC1 4 ARG A 198 ? ARG A 912 . ? 1_555 ? 5 AC2 7 GLY A 1 ? GLY A 700 . ? 1_555 ? 6 AC2 7 PRO A 2 ? PRO A 701 . ? 1_555 ? 7 AC2 7 LEU A 3 ? LEU A 702 . ? 1_555 ? 8 AC2 7 SER A 4 ? SER A 703 . ? 1_555 ? 9 AC2 7 GLN A 196 ? GLN A 910 . ? 7_645 ? 10 AC2 7 LEU A 209 ? LEU A 923 . ? 7_645 ? 11 AC2 7 HIS A 212 ? HIS A 926 . ? 7_645 ? 12 AC3 5 ARG A 22 ? ARG A 721 . ? 1_555 ? 13 AC3 5 GLN A 97 ? GLN A 796 . ? 1_555 ? 14 AC3 5 GLY A 99 ? GLY A 798 . ? 1_555 ? 15 AC3 5 PRO A 100 ? PRO A 799 . ? 1_555 ? 16 AC3 5 LEU A 102 ? LEU A 801 . ? 1_555 ? 17 AC4 6 VAL A 39 ? VAL A 738 . ? 1_555 ? 18 AC4 6 ALA A 57 ? ALA A 756 . ? 1_555 ? 19 AC4 6 GLU A 106 ? GLU A 805 . ? 1_555 ? 20 AC4 6 ALA A 108 ? ALA A 807 . ? 1_555 ? 21 AC4 6 SER A 112 ? SER A 811 . ? 1_555 ? 22 AC4 6 LEU A 167 ? LEU A 881 . ? 1_555 ? # _pdbx_entry_details.entry_id 6FEK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 713 ? ? -96.77 -60.73 2 1 ALA A 714 ? ? 61.02 65.37 3 1 PHE A 735 ? ? 78.44 -44.39 4 1 GLU A 843 ? ? -162.92 99.36 5 1 ARG A 873 ? ? 73.86 -24.59 6 1 ASP A 892 ? ? 59.54 71.43 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PTR 186 A PTR 900 ? TYR 'modified residue' 2 A PTR 191 A PTR 905 ? TYR 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 1011 ? A LYS 297 2 1 Y 1 A ARG 1012 ? A ARG 298 3 1 Y 1 A ARG 1013 ? A ARG 299 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADN "O5'" O N N 1 ADN "C5'" C N N 2 ADN "C4'" C N R 3 ADN "O4'" O N N 4 ADN "C3'" C N S 5 ADN "O3'" O N N 6 ADN "C2'" C N R 7 ADN "O2'" O N N 8 ADN "C1'" C N R 9 ADN N9 N Y N 10 ADN C8 C Y N 11 ADN N7 N Y N 12 ADN C5 C Y N 13 ADN C6 C Y N 14 ADN N6 N N N 15 ADN N1 N Y N 16 ADN C2 C Y N 17 ADN N3 N Y N 18 ADN C4 C Y N 19 ADN "HO5'" H N N 20 ADN "H5'1" H N N 21 ADN "H5'2" H N N 22 ADN "H4'" H N N 23 ADN "H3'" H N N 24 ADN "HO3'" H N N 25 ADN "H2'" H N N 26 ADN "HO2'" H N N 27 ADN "H1'" H N N 28 ADN H8 H N N 29 ADN HN61 H N N 30 ADN HN62 H N N 31 ADN H2 H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ARG N N N N 46 ARG CA C N S 47 ARG C C N N 48 ARG O O N N 49 ARG CB C N N 50 ARG CG C N N 51 ARG CD C N N 52 ARG NE N N N 53 ARG CZ C N N 54 ARG NH1 N N N 55 ARG NH2 N N N 56 ARG OXT O N N 57 ARG H H N N 58 ARG H2 H N N 59 ARG HA H N N 60 ARG HB2 H N N 61 ARG HB3 H N N 62 ARG HG2 H N N 63 ARG HG3 H N N 64 ARG HD2 H N N 65 ARG HD3 H N N 66 ARG HE H N N 67 ARG HH11 H N N 68 ARG HH12 H N N 69 ARG HH21 H N N 70 ARG HH22 H N N 71 ARG HXT H N N 72 ASN N N N N 73 ASN CA C N S 74 ASN C C N N 75 ASN O O N N 76 ASN CB C N N 77 ASN CG C N N 78 ASN OD1 O N N 79 ASN ND2 N N N 80 ASN OXT O N N 81 ASN H H N N 82 ASN H2 H N N 83 ASN HA H N N 84 ASN HB2 H N N 85 ASN HB3 H N N 86 ASN HD21 H N N 87 ASN HD22 H N N 88 ASN HXT H N N 89 ASP N N N N 90 ASP CA C N S 91 ASP C C N N 92 ASP O O N N 93 ASP CB C N N 94 ASP CG C N N 95 ASP OD1 O N N 96 ASP OD2 O N N 97 ASP OXT O N N 98 ASP H H N N 99 ASP H2 H N N 100 ASP HA H N N 101 ASP HB2 H N N 102 ASP HB3 H N N 103 ASP HD2 H N N 104 ASP HXT H N N 105 CYS N N N N 106 CYS CA C N R 107 CYS C C N N 108 CYS O O N N 109 CYS CB C N N 110 CYS SG S N N 111 CYS OXT O N N 112 CYS H H N N 113 CYS H2 H N N 114 CYS HA H N N 115 CYS HB2 H N N 116 CYS HB3 H N N 117 CYS HG H N N 118 CYS HXT H N N 119 FMT C C N N 120 FMT O1 O N N 121 FMT O2 O N N 122 FMT H H N N 123 FMT HO2 H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 PTR N N N N 327 PTR CA C N S 328 PTR C C N N 329 PTR O O N N 330 PTR OXT O N N 331 PTR CB C N N 332 PTR CG C Y N 333 PTR CD1 C Y N 334 PTR CD2 C Y N 335 PTR CE1 C Y N 336 PTR CE2 C Y N 337 PTR CZ C Y N 338 PTR OH O N N 339 PTR P P N N 340 PTR O1P O N N 341 PTR O2P O N N 342 PTR O3P O N N 343 PTR H H N N 344 PTR H2 H N N 345 PTR HA H N N 346 PTR HXT H N N 347 PTR HB2 H N N 348 PTR HB3 H N N 349 PTR HD1 H N N 350 PTR HD2 H N N 351 PTR HE1 H N N 352 PTR HE2 H N N 353 PTR HO2P H N N 354 PTR HO3P H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADN "O5'" "C5'" sing N N 1 ADN "O5'" "HO5'" sing N N 2 ADN "C5'" "C4'" sing N N 3 ADN "C5'" "H5'1" sing N N 4 ADN "C5'" "H5'2" sing N N 5 ADN "C4'" "O4'" sing N N 6 ADN "C4'" "C3'" sing N N 7 ADN "C4'" "H4'" sing N N 8 ADN "O4'" "C1'" sing N N 9 ADN "C3'" "O3'" sing N N 10 ADN "C3'" "C2'" sing N N 11 ADN "C3'" "H3'" sing N N 12 ADN "O3'" "HO3'" sing N N 13 ADN "C2'" "O2'" sing N N 14 ADN "C2'" "C1'" sing N N 15 ADN "C2'" "H2'" sing N N 16 ADN "O2'" "HO2'" sing N N 17 ADN "C1'" N9 sing N N 18 ADN "C1'" "H1'" sing N N 19 ADN N9 C8 sing Y N 20 ADN N9 C4 sing Y N 21 ADN C8 N7 doub Y N 22 ADN C8 H8 sing N N 23 ADN N7 C5 sing Y N 24 ADN C5 C6 sing Y N 25 ADN C5 C4 doub Y N 26 ADN C6 N6 sing N N 27 ADN C6 N1 doub Y N 28 ADN N6 HN61 sing N N 29 ADN N6 HN62 sing N N 30 ADN N1 C2 sing Y N 31 ADN C2 N3 doub Y N 32 ADN C2 H2 sing N N 33 ADN N3 C4 sing Y N 34 ALA N CA sing N N 35 ALA N H sing N N 36 ALA N H2 sing N N 37 ALA CA C sing N N 38 ALA CA CB sing N N 39 ALA CA HA sing N N 40 ALA C O doub N N 41 ALA C OXT sing N N 42 ALA CB HB1 sing N N 43 ALA CB HB2 sing N N 44 ALA CB HB3 sing N N 45 ALA OXT HXT sing N N 46 ARG N CA sing N N 47 ARG N H sing N N 48 ARG N H2 sing N N 49 ARG CA C sing N N 50 ARG CA CB sing N N 51 ARG CA HA sing N N 52 ARG C O doub N N 53 ARG C OXT sing N N 54 ARG CB CG sing N N 55 ARG CB HB2 sing N N 56 ARG CB HB3 sing N N 57 ARG CG CD sing N N 58 ARG CG HG2 sing N N 59 ARG CG HG3 sing N N 60 ARG CD NE sing N N 61 ARG CD HD2 sing N N 62 ARG CD HD3 sing N N 63 ARG NE CZ sing N N 64 ARG NE HE sing N N 65 ARG CZ NH1 sing N N 66 ARG CZ NH2 doub N N 67 ARG NH1 HH11 sing N N 68 ARG NH1 HH12 sing N N 69 ARG NH2 HH21 sing N N 70 ARG NH2 HH22 sing N N 71 ARG OXT HXT sing N N 72 ASN N CA sing N N 73 ASN N H sing N N 74 ASN N H2 sing N N 75 ASN CA C sing N N 76 ASN CA CB sing N N 77 ASN CA HA sing N N 78 ASN C O doub N N 79 ASN C OXT sing N N 80 ASN CB CG sing N N 81 ASN CB HB2 sing N N 82 ASN CB HB3 sing N N 83 ASN CG OD1 doub N N 84 ASN CG ND2 sing N N 85 ASN ND2 HD21 sing N N 86 ASN ND2 HD22 sing N N 87 ASN OXT HXT sing N N 88 ASP N CA sing N N 89 ASP N H sing N N 90 ASP N H2 sing N N 91 ASP CA C sing N N 92 ASP CA CB sing N N 93 ASP CA HA sing N N 94 ASP C O doub N N 95 ASP C OXT sing N N 96 ASP CB CG sing N N 97 ASP CB HB2 sing N N 98 ASP CB HB3 sing N N 99 ASP CG OD1 doub N N 100 ASP CG OD2 sing N N 101 ASP OD2 HD2 sing N N 102 ASP OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 FMT C O1 doub N N 117 FMT C O2 sing N N 118 FMT C H sing N N 119 FMT O2 HO2 sing N N 120 GLN N CA sing N N 121 GLN N H sing N N 122 GLN N H2 sing N N 123 GLN CA C sing N N 124 GLN CA CB sing N N 125 GLN CA HA sing N N 126 GLN C O doub N N 127 GLN C OXT sing N N 128 GLN CB CG sing N N 129 GLN CB HB2 sing N N 130 GLN CB HB3 sing N N 131 GLN CG CD sing N N 132 GLN CG HG2 sing N N 133 GLN CG HG3 sing N N 134 GLN CD OE1 doub N N 135 GLN CD NE2 sing N N 136 GLN NE2 HE21 sing N N 137 GLN NE2 HE22 sing N N 138 GLN OXT HXT sing N N 139 GLU N CA sing N N 140 GLU N H sing N N 141 GLU N H2 sing N N 142 GLU CA C sing N N 143 GLU CA CB sing N N 144 GLU CA HA sing N N 145 GLU C O doub N N 146 GLU C OXT sing N N 147 GLU CB CG sing N N 148 GLU CB HB2 sing N N 149 GLU CB HB3 sing N N 150 GLU CG CD sing N N 151 GLU CG HG2 sing N N 152 GLU CG HG3 sing N N 153 GLU CD OE1 doub N N 154 GLU CD OE2 sing N N 155 GLU OE2 HE2 sing N N 156 GLU OXT HXT sing N N 157 GLY N CA sing N N 158 GLY N H sing N N 159 GLY N H2 sing N N 160 GLY CA C sing N N 161 GLY CA HA2 sing N N 162 GLY CA HA3 sing N N 163 GLY C O doub N N 164 GLY C OXT sing N N 165 GLY OXT HXT sing N N 166 HIS N CA sing N N 167 HIS N H sing N N 168 HIS N H2 sing N N 169 HIS CA C sing N N 170 HIS CA CB sing N N 171 HIS CA HA sing N N 172 HIS C O doub N N 173 HIS C OXT sing N N 174 HIS CB CG sing N N 175 HIS CB HB2 sing N N 176 HIS CB HB3 sing N N 177 HIS CG ND1 sing Y N 178 HIS CG CD2 doub Y N 179 HIS ND1 CE1 doub Y N 180 HIS ND1 HD1 sing N N 181 HIS CD2 NE2 sing Y N 182 HIS CD2 HD2 sing N N 183 HIS CE1 NE2 sing Y N 184 HIS CE1 HE1 sing N N 185 HIS NE2 HE2 sing N N 186 HIS OXT HXT sing N N 187 HOH O H1 sing N N 188 HOH O H2 sing N N 189 ILE N CA sing N N 190 ILE N H sing N N 191 ILE N H2 sing N N 192 ILE CA C sing N N 193 ILE CA CB sing N N 194 ILE CA HA sing N N 195 ILE C O doub N N 196 ILE C OXT sing N N 197 ILE CB CG1 sing N N 198 ILE CB CG2 sing N N 199 ILE CB HB sing N N 200 ILE CG1 CD1 sing N N 201 ILE CG1 HG12 sing N N 202 ILE CG1 HG13 sing N N 203 ILE CG2 HG21 sing N N 204 ILE CG2 HG22 sing N N 205 ILE CG2 HG23 sing N N 206 ILE CD1 HD11 sing N N 207 ILE CD1 HD12 sing N N 208 ILE CD1 HD13 sing N N 209 ILE OXT HXT sing N N 210 LEU N CA sing N N 211 LEU N H sing N N 212 LEU N H2 sing N N 213 LEU CA C sing N N 214 LEU CA CB sing N N 215 LEU CA HA sing N N 216 LEU C O doub N N 217 LEU C OXT sing N N 218 LEU CB CG sing N N 219 LEU CB HB2 sing N N 220 LEU CB HB3 sing N N 221 LEU CG CD1 sing N N 222 LEU CG CD2 sing N N 223 LEU CG HG sing N N 224 LEU CD1 HD11 sing N N 225 LEU CD1 HD12 sing N N 226 LEU CD1 HD13 sing N N 227 LEU CD2 HD21 sing N N 228 LEU CD2 HD22 sing N N 229 LEU CD2 HD23 sing N N 230 LEU OXT HXT sing N N 231 LYS N CA sing N N 232 LYS N H sing N N 233 LYS N H2 sing N N 234 LYS CA C sing N N 235 LYS CA CB sing N N 236 LYS CA HA sing N N 237 LYS C O doub N N 238 LYS C OXT sing N N 239 LYS CB CG sing N N 240 LYS CB HB2 sing N N 241 LYS CB HB3 sing N N 242 LYS CG CD sing N N 243 LYS CG HG2 sing N N 244 LYS CG HG3 sing N N 245 LYS CD CE sing N N 246 LYS CD HD2 sing N N 247 LYS CD HD3 sing N N 248 LYS CE NZ sing N N 249 LYS CE HE2 sing N N 250 LYS CE HE3 sing N N 251 LYS NZ HZ1 sing N N 252 LYS NZ HZ2 sing N N 253 LYS NZ HZ3 sing N N 254 LYS OXT HXT sing N N 255 MET N CA sing N N 256 MET N H sing N N 257 MET N H2 sing N N 258 MET CA C sing N N 259 MET CA CB sing N N 260 MET CA HA sing N N 261 MET C O doub N N 262 MET C OXT sing N N 263 MET CB CG sing N N 264 MET CB HB2 sing N N 265 MET CB HB3 sing N N 266 MET CG SD sing N N 267 MET CG HG2 sing N N 268 MET CG HG3 sing N N 269 MET SD CE sing N N 270 MET CE HE1 sing N N 271 MET CE HE2 sing N N 272 MET CE HE3 sing N N 273 MET OXT HXT sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 PTR N CA sing N N 315 PTR N H sing N N 316 PTR N H2 sing N N 317 PTR CA C sing N N 318 PTR CA CB sing N N 319 PTR CA HA sing N N 320 PTR C O doub N N 321 PTR C OXT sing N N 322 PTR OXT HXT sing N N 323 PTR CB CG sing N N 324 PTR CB HB2 sing N N 325 PTR CB HB3 sing N N 326 PTR CG CD1 doub Y N 327 PTR CG CD2 sing Y N 328 PTR CD1 CE1 sing Y N 329 PTR CD1 HD1 sing N N 330 PTR CD2 CE2 doub Y N 331 PTR CD2 HD2 sing N N 332 PTR CE1 CZ doub Y N 333 PTR CE1 HE1 sing N N 334 PTR CE2 CZ sing Y N 335 PTR CE2 HE2 sing N N 336 PTR CZ OH sing N N 337 PTR OH P sing N N 338 PTR P O1P doub N N 339 PTR P O2P sing N N 340 PTR P O3P sing N N 341 PTR O2P HO2P sing N N 342 PTR O3P HO3P sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 THR N CA sing N N 357 THR N H sing N N 358 THR N H2 sing N N 359 THR CA C sing N N 360 THR CA CB sing N N 361 THR CA HA sing N N 362 THR C O doub N N 363 THR C OXT sing N N 364 THR CB OG1 sing N N 365 THR CB CG2 sing N N 366 THR CB HB sing N N 367 THR OG1 HG1 sing N N 368 THR CG2 HG21 sing N N 369 THR CG2 HG22 sing N N 370 THR CG2 HG23 sing N N 371 THR OXT HXT sing N N 372 TRP N CA sing N N 373 TRP N H sing N N 374 TRP N H2 sing N N 375 TRP CA C sing N N 376 TRP CA CB sing N N 377 TRP CA HA sing N N 378 TRP C O doub N N 379 TRP C OXT sing N N 380 TRP CB CG sing N N 381 TRP CB HB2 sing N N 382 TRP CB HB3 sing N N 383 TRP CG CD1 doub Y N 384 TRP CG CD2 sing Y N 385 TRP CD1 NE1 sing Y N 386 TRP CD1 HD1 sing N N 387 TRP CD2 CE2 doub Y N 388 TRP CD2 CE3 sing Y N 389 TRP NE1 CE2 sing Y N 390 TRP NE1 HE1 sing N N 391 TRP CE2 CZ2 sing Y N 392 TRP CE3 CZ3 doub Y N 393 TRP CE3 HE3 sing N N 394 TRP CZ2 CH2 doub Y N 395 TRP CZ2 HZ2 sing N N 396 TRP CZ3 CH2 sing Y N 397 TRP CZ3 HZ3 sing N N 398 TRP CH2 HH2 sing N N 399 TRP OXT HXT sing N N 400 TYR N CA sing N N 401 TYR N H sing N N 402 TYR N H2 sing N N 403 TYR CA C sing N N 404 TYR CA CB sing N N 405 TYR CA HA sing N N 406 TYR C O doub N N 407 TYR C OXT sing N N 408 TYR CB CG sing N N 409 TYR CB HB2 sing N N 410 TYR CB HB3 sing N N 411 TYR CG CD1 doub Y N 412 TYR CG CD2 sing Y N 413 TYR CD1 CE1 sing Y N 414 TYR CD1 HD1 sing N N 415 TYR CD2 CE2 doub Y N 416 TYR CD2 HD2 sing N N 417 TYR CE1 CZ doub Y N 418 TYR CE1 HE1 sing N N 419 TYR CE2 CZ sing Y N 420 TYR CE2 HE2 sing N N 421 TYR CZ OH sing N N 422 TYR OH HH sing N N 423 TYR OXT HXT sing N N 424 VAL N CA sing N N 425 VAL N H sing N N 426 VAL N H2 sing N N 427 VAL CA C sing N N 428 VAL CA CB sing N N 429 VAL CA HA sing N N 430 VAL C O doub N N 431 VAL C OXT sing N N 432 VAL CB CG1 sing N N 433 VAL CB CG2 sing N N 434 VAL CB HB sing N N 435 VAL CG1 HG11 sing N N 436 VAL CG1 HG12 sing N N 437 VAL CG1 HG13 sing N N 438 VAL CG2 HG21 sing N N 439 VAL CG2 HG22 sing N N 440 VAL CG2 HG23 sing N N 441 VAL OXT HXT sing N N 442 # _pdbx_audit_support.funding_organization 'Francis Crick Institute' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number FC001115 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6FEK _atom_sites.fract_transf_matrix[1][1] 0.019646 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019646 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004123 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ #