data_6FFM
# 
_entry.id   6FFM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.399 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6FFM         pdb_00006ffm 10.2210/pdb6ffm/pdb 
WWPDB D_1200008240 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-11-14 
2 'Structure model' 1 1 2024-01-17 
3 'Structure model' 1 2 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
4 3 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
5 3 'Structure model' pdbx_entry_details            
6 3 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FFM 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Moniot, S.'    1 0000-0002-2890-8075 
'Steegborn, C.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   DE 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            ChemistryOpen 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2191-1363 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                858 
_citation.page_last                 864 
_citation.title                     
'Effects of 3-Bromo-4,5-dihydroisoxazole Derivatives on Nrf2 Activation and Heme Oxygenase-1 Expression.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/open.201800185 
_citation.pdbx_database_id_PubMed   30397576 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pinto, A.'      1 ?                   
primary 'El Ali, Z.'     2 ?                   
primary 'Moniot, S.'     3 ?                   
primary 'Tamborini, L.'  4 0000-0002-9755-7846 
primary 'Steegborn, C.'  5 ?                   
primary 'Foresti, R.'    6 ?                   
primary 'De Micheli, C.' 7 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kelch-like ECH-associated protein 1'                            15206.571 1  ? S172A ? ? 
2 non-polymer syn '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' 204.225   1  ? ?     ? ? 
3 water       nat water                                                            18.015    18 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVS
IEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVS
IEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' D8N 
3 water                                                            HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   GLY n 
1 5   ASN n 
1 6   ARG n 
1 7   THR n 
1 8   PHE n 
1 9   SER n 
1 10  TYR n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  ASP n 
1 15  HIS n 
1 16  THR n 
1 17  LYS n 
1 18  GLN n 
1 19  ALA n 
1 20  PHE n 
1 21  GLY n 
1 22  ILE n 
1 23  MET n 
1 24  ASN n 
1 25  GLU n 
1 26  LEU n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  GLN n 
1 31  GLN n 
1 32  LEU n 
1 33  CYS n 
1 34  ASP n 
1 35  VAL n 
1 36  THR n 
1 37  LEU n 
1 38  GLN n 
1 39  VAL n 
1 40  LYS n 
1 41  TYR n 
1 42  GLN n 
1 43  ASP n 
1 44  ALA n 
1 45  PRO n 
1 46  ALA n 
1 47  ALA n 
1 48  GLN n 
1 49  PHE n 
1 50  MET n 
1 51  ALA n 
1 52  HIS n 
1 53  LYS n 
1 54  VAL n 
1 55  VAL n 
1 56  LEU n 
1 57  ALA n 
1 58  SER n 
1 59  SER n 
1 60  SER n 
1 61  PRO n 
1 62  VAL n 
1 63  PHE n 
1 64  LYS n 
1 65  ALA n 
1 66  MET n 
1 67  PHE n 
1 68  THR n 
1 69  ASN n 
1 70  GLY n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  GLN n 
1 75  GLY n 
1 76  MET n 
1 77  GLU n 
1 78  VAL n 
1 79  VAL n 
1 80  SER n 
1 81  ILE n 
1 82  GLU n 
1 83  GLY n 
1 84  ILE n 
1 85  HIS n 
1 86  PRO n 
1 87  LYS n 
1 88  VAL n 
1 89  MET n 
1 90  GLU n 
1 91  ARG n 
1 92  LEU n 
1 93  ILE n 
1 94  GLU n 
1 95  PHE n 
1 96  ALA n 
1 97  TYR n 
1 98  THR n 
1 99  ALA n 
1 100 SER n 
1 101 ILE n 
1 102 SER n 
1 103 MET n 
1 104 GLY n 
1 105 GLU n 
1 106 LYS n 
1 107 CYS n 
1 108 VAL n 
1 109 LEU n 
1 110 HIS n 
1 111 VAL n 
1 112 MET n 
1 113 ASN n 
1 114 GLY n 
1 115 ALA n 
1 116 VAL n 
1 117 MET n 
1 118 TYR n 
1 119 GLN n 
1 120 ILE n 
1 121 ASP n 
1 122 SER n 
1 123 VAL n 
1 124 VAL n 
1 125 ARG n 
1 126 ALA n 
1 127 CYS n 
1 128 ALA n 
1 129 ASP n 
1 130 PHE n 
1 131 LEU n 
1 132 VAL n 
1 133 GLN n 
1 134 GLN n 
1 135 LEU n 
1 136 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   136 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KEAP1, INRF2, KIAA0132, KLHL19' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   'N-term His-tag cleavable with TEV protease' 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19mod 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                         ? 'C3 H7 N O2 S'   121.158 
D8N non-polymer         . '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' ? 'C11 H12 N2 O2'  204.225 
GLN 'L-peptide linking' y GLUTAMINE                                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   45  ?   ?   ?   A . n 
A 1 2   HIS 2   46  ?   ?   ?   A . n 
A 1 3   MET 3   47  ?   ?   ?   A . n 
A 1 4   GLY 4   48  ?   ?   ?   A . n 
A 1 5   ASN 5   49  ?   ?   ?   A . n 
A 1 6   ARG 6   50  50  ARG ARG A . n 
A 1 7   THR 7   51  51  THR THR A . n 
A 1 8   PHE 8   52  52  PHE PHE A . n 
A 1 9   SER 9   53  53  SER SER A . n 
A 1 10  TYR 10  54  54  TYR TYR A . n 
A 1 11  THR 11  55  55  THR THR A . n 
A 1 12  LEU 12  56  56  LEU LEU A . n 
A 1 13  GLU 13  57  57  GLU GLU A . n 
A 1 14  ASP 14  58  58  ASP ASP A . n 
A 1 15  HIS 15  59  59  HIS HIS A . n 
A 1 16  THR 16  60  60  THR THR A . n 
A 1 17  LYS 17  61  61  LYS LYS A . n 
A 1 18  GLN 18  62  62  GLN GLN A . n 
A 1 19  ALA 19  63  63  ALA ALA A . n 
A 1 20  PHE 20  64  64  PHE PHE A . n 
A 1 21  GLY 21  65  65  GLY GLY A . n 
A 1 22  ILE 22  66  66  ILE ILE A . n 
A 1 23  MET 23  67  67  MET MET A . n 
A 1 24  ASN 24  68  68  ASN ASN A . n 
A 1 25  GLU 25  69  69  GLU GLU A . n 
A 1 26  LEU 26  70  70  LEU LEU A . n 
A 1 27  ARG 27  71  71  ARG ARG A . n 
A 1 28  LEU 28  72  72  LEU LEU A . n 
A 1 29  SER 29  73  73  SER SER A . n 
A 1 30  GLN 30  74  74  GLN GLN A . n 
A 1 31  GLN 31  75  75  GLN GLN A . n 
A 1 32  LEU 32  76  76  LEU LEU A . n 
A 1 33  CYS 33  77  77  CYS CYS A . n 
A 1 34  ASP 34  78  78  ASP ASP A . n 
A 1 35  VAL 35  79  79  VAL VAL A . n 
A 1 36  THR 36  80  80  THR THR A . n 
A 1 37  LEU 37  81  81  LEU LEU A . n 
A 1 38  GLN 38  82  82  GLN GLN A . n 
A 1 39  VAL 39  83  83  VAL VAL A . n 
A 1 40  LYS 40  84  84  LYS LYS A . n 
A 1 41  TYR 41  85  85  TYR TYR A . n 
A 1 42  GLN 42  86  86  GLN GLN A . n 
A 1 43  ASP 43  87  87  ASP ASP A . n 
A 1 44  ALA 44  88  88  ALA ALA A . n 
A 1 45  PRO 45  89  89  PRO PRO A . n 
A 1 46  ALA 46  90  90  ALA ALA A . n 
A 1 47  ALA 47  91  91  ALA ALA A . n 
A 1 48  GLN 48  92  92  GLN GLN A . n 
A 1 49  PHE 49  93  93  PHE PHE A . n 
A 1 50  MET 50  94  94  MET MET A . n 
A 1 51  ALA 51  95  95  ALA ALA A . n 
A 1 52  HIS 52  96  96  HIS HIS A . n 
A 1 53  LYS 53  97  97  LYS LYS A . n 
A 1 54  VAL 54  98  98  VAL VAL A . n 
A 1 55  VAL 55  99  99  VAL VAL A . n 
A 1 56  LEU 56  100 100 LEU LEU A . n 
A 1 57  ALA 57  101 101 ALA ALA A . n 
A 1 58  SER 58  102 102 SER SER A . n 
A 1 59  SER 59  103 103 SER SER A . n 
A 1 60  SER 60  104 104 SER SER A . n 
A 1 61  PRO 61  105 105 PRO PRO A . n 
A 1 62  VAL 62  106 106 VAL VAL A . n 
A 1 63  PHE 63  107 107 PHE PHE A . n 
A 1 64  LYS 64  108 108 LYS LYS A . n 
A 1 65  ALA 65  109 109 ALA ALA A . n 
A 1 66  MET 66  110 110 MET MET A . n 
A 1 67  PHE 67  111 111 PHE PHE A . n 
A 1 68  THR 68  112 112 THR THR A . n 
A 1 69  ASN 69  113 113 ASN ASN A . n 
A 1 70  GLY 70  114 114 GLY GLY A . n 
A 1 71  LEU 71  115 115 LEU LEU A . n 
A 1 72  ARG 72  116 116 ARG ARG A . n 
A 1 73  GLU 73  117 117 GLU GLU A . n 
A 1 74  GLN 74  118 118 GLN GLN A . n 
A 1 75  GLY 75  119 119 GLY GLY A . n 
A 1 76  MET 76  120 120 MET MET A . n 
A 1 77  GLU 77  121 121 GLU GLU A . n 
A 1 78  VAL 78  122 122 VAL VAL A . n 
A 1 79  VAL 79  123 123 VAL VAL A . n 
A 1 80  SER 80  124 124 SER SER A . n 
A 1 81  ILE 81  125 125 ILE ILE A . n 
A 1 82  GLU 82  126 126 GLU GLU A . n 
A 1 83  GLY 83  127 127 GLY GLY A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  HIS 85  129 129 HIS HIS A . n 
A 1 86  PRO 86  130 130 PRO PRO A . n 
A 1 87  LYS 87  131 131 LYS LYS A . n 
A 1 88  VAL 88  132 132 VAL VAL A . n 
A 1 89  MET 89  133 133 MET MET A . n 
A 1 90  GLU 90  134 134 GLU GLU A . n 
A 1 91  ARG 91  135 135 ARG ARG A . n 
A 1 92  LEU 92  136 136 LEU LEU A . n 
A 1 93  ILE 93  137 137 ILE ILE A . n 
A 1 94  GLU 94  138 138 GLU GLU A . n 
A 1 95  PHE 95  139 139 PHE PHE A . n 
A 1 96  ALA 96  140 140 ALA ALA A . n 
A 1 97  TYR 97  141 141 TYR TYR A . n 
A 1 98  THR 98  142 142 THR THR A . n 
A 1 99  ALA 99  143 143 ALA ALA A . n 
A 1 100 SER 100 144 144 SER SER A . n 
A 1 101 ILE 101 145 145 ILE ILE A . n 
A 1 102 SER 102 146 146 SER SER A . n 
A 1 103 MET 103 147 147 MET MET A . n 
A 1 104 GLY 104 148 148 GLY GLY A . n 
A 1 105 GLU 105 149 149 GLU GLU A . n 
A 1 106 LYS 106 150 150 LYS LYS A . n 
A 1 107 CYS 107 151 151 CYS CYS A . n 
A 1 108 VAL 108 152 152 VAL VAL A . n 
A 1 109 LEU 109 153 153 LEU LEU A . n 
A 1 110 HIS 110 154 154 HIS HIS A . n 
A 1 111 VAL 111 155 155 VAL VAL A . n 
A 1 112 MET 112 156 156 MET MET A . n 
A 1 113 ASN 113 157 157 ASN ASN A . n 
A 1 114 GLY 114 158 158 GLY GLY A . n 
A 1 115 ALA 115 159 159 ALA ALA A . n 
A 1 116 VAL 116 160 160 VAL VAL A . n 
A 1 117 MET 117 161 161 MET MET A . n 
A 1 118 TYR 118 162 162 TYR TYR A . n 
A 1 119 GLN 119 163 163 GLN GLN A . n 
A 1 120 ILE 120 164 164 ILE ILE A . n 
A 1 121 ASP 121 165 165 ASP ASP A . n 
A 1 122 SER 122 166 166 SER SER A . n 
A 1 123 VAL 123 167 167 VAL VAL A . n 
A 1 124 VAL 124 168 168 VAL VAL A . n 
A 1 125 ARG 125 169 169 ARG ARG A . n 
A 1 126 ALA 126 170 170 ALA ALA A . n 
A 1 127 CYS 127 171 171 CYS CYS A . n 
A 1 128 ALA 128 172 172 ALA ALA A . n 
A 1 129 ASP 129 173 173 ASP ASP A . n 
A 1 130 PHE 130 174 174 PHE PHE A . n 
A 1 131 LEU 131 175 175 LEU LEU A . n 
A 1 132 VAL 132 176 176 VAL VAL A . n 
A 1 133 GLN 133 177 177 GLN GLN A . n 
A 1 134 GLN 134 178 178 GLN GLN A . n 
A 1 135 LEU 135 179 179 LEU LEU A . n 
A 1 136 ASP 136 180 180 ASP ASP A . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        D8N 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   D8N 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 D8N 1  500 500 D8N lig A . 
C 3 HOH 1  601 3   HOH HOH A . 
C 3 HOH 2  602 14  HOH HOH A . 
C 3 HOH 3  603 15  HOH HOH A . 
C 3 HOH 4  604 1   HOH HOH A . 
C 3 HOH 5  605 16  HOH HOH A . 
C 3 HOH 6  606 18  HOH HOH A . 
C 3 HOH 7  607 6   HOH HOH A . 
C 3 HOH 8  608 13  HOH HOH A . 
C 3 HOH 9  609 17  HOH HOH A . 
C 3 HOH 10 610 7   HOH HOH A . 
C 3 HOH 11 611 8   HOH HOH A . 
C 3 HOH 12 612 4   HOH HOH A . 
C 3 HOH 13 613 12  HOH HOH A . 
C 3 HOH 14 614 10  HOH HOH A . 
C 3 HOH 15 615 19  HOH HOH A . 
C 3 HOH 16 616 5   HOH HOH A . 
C 3 HOH 17 617 2   HOH HOH A . 
C 3 HOH 18 618 11  HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 116 ? CG  ? A ARG 72 CG  
2 1 Y 1 A ARG 116 ? CD  ? A ARG 72 CD  
3 1 Y 1 A ARG 116 ? NE  ? A ARG 72 NE  
4 1 Y 1 A ARG 116 ? CZ  ? A ARG 72 CZ  
5 1 Y 1 A ARG 116 ? NH1 ? A ARG 72 NH1 
6 1 Y 1 A ARG 116 ? NH2 ? A ARG 72 NH2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? .                  4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6FFM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     42.491 
_cell.length_a_esd                 ? 
_cell.length_b                     42.491 
_cell.length_b_esd                 ? 
_cell.length_c                     265.213 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6FFM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FFM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.87 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25-28 % PEG 4000, 0.1 M Tris-HCl pH 8.0 and 0.2 M lithium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-09-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    KMC-1 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91814 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91814 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            50.25 
_reflns.entry_id                         6FFM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 44.202 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       7968 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.73 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.33 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.1492 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.2 
_reflns_shell.d_res_low                   2.279 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.57 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           752 
_reflns_shell.percent_possible_all        99.08 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             3.161 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.33 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6FFM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             44.202 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7948 
_refine.ls_number_reflns_R_free                  793 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.76 
_refine.ls_percent_reflns_R_free                 9.98 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2568 
_refine.ls_R_factor_R_free                       0.2929 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2525 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4cxi 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 37.61 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.48 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1020 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               1053 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        44.202 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 1091 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.398  ? 1478 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.583 ? 664  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 168  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 192  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2000 2.3378  . . 127 1148 99.00  . . . 0.4441 . 0.4063 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3378 2.5183  . . 125 1136 98.00  . . . 0.3759 . 0.3726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5183 2.7717  . . 128 1159 100.00 . . . 0.3573 . 0.3355 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7717 3.1727  . . 131 1178 99.00  . . . 0.3559 . 0.2889 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1727 3.9969  . . 134 1204 99.00  . . . 0.2970 . 0.2337 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9969 44.2111 . . 148 1330 98.00  . . . 0.2394 . 0.2068 . . . . . . . . . . 
# 
_struct.entry_id                     6FFM 
_struct.title                        'Crystal Structure of Human KEAP1 BTB Domain in Complex with isoxazoline-based inhibitor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FFM 
_struct_keywords.text            '3-bromo-4 5-dihydroisoxazole, BTB domain, antioxidant response, Signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KEAP1_HUMAN 
_struct_ref.pdbx_db_accession          Q14145 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEG
IHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
;
_struct_ref.pdbx_align_begin           48 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6FFM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 136 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14145 
_struct_ref_seq.db_align_beg                  48 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  180 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       48 
_struct_ref_seq.pdbx_auth_seq_align_end       180 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6FFM GLY A 1   ? UNP Q14145 ?   ?   'expression tag'      45  1 
1 6FFM HIS A 2   ? UNP Q14145 ?   ?   'expression tag'      46  2 
1 6FFM MET A 3   ? UNP Q14145 ?   ?   'expression tag'      47  3 
1 6FFM ALA A 128 ? UNP Q14145 SER 172 'engineered mutation' 172 4 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4070  ? 
1 MORE         -37   ? 
1 'SSA (A^2)'  14030 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_544 x,x-y-1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 21.2455000000 0.8660254038 
-0.5000000000 0.0000000000 -36.7982854322 0.0000000000 0.0000000000 -1.0000000000 -44.2021666667 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 14  ? SER A 29  ? ASP A 58  SER A 73  1 ? 16 
HELX_P HELX_P2 AA2 HIS A 52  ? SER A 60  ? HIS A 96  SER A 104 1 ? 9  
HELX_P HELX_P3 AA3 SER A 60  ? THR A 68  ? SER A 104 THR A 112 1 ? 9  
HELX_P HELX_P4 AA4 HIS A 85  ? ALA A 99  ? HIS A 129 ALA A 143 1 ? 15 
HELX_P HELX_P5 AA5 GLY A 104 ? LYS A 106 ? GLY A 148 LYS A 150 5 ? 3  
HELX_P HELX_P6 AA6 CYS A 107 ? TYR A 118 ? CYS A 151 TYR A 162 1 ? 12 
HELX_P HELX_P7 AA7 ILE A 120 ? LEU A 135 ? ILE A 164 LEU A 179 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            107 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       A 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           D8N 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C05 
_struct_conn.pdbx_ptnr2_label_alt_id       A 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             151 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            D8N 
_struct_conn.ptnr2_auth_seq_id             500 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.813 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      D8N 
_pdbx_modification_feature.label_asym_id                      B 
_pdbx_modification_feature.label_seq_id                       . 
_pdbx_modification_feature.label_alt_id                       A 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      107 
_pdbx_modification_feature.modified_residue_label_alt_id      A 
_pdbx_modification_feature.auth_comp_id                       D8N 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        500 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       151 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               C05 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                CYS 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        D8N 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Covalent chemical modification' 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 44 ? ALA A 51 ? ALA A 88  ALA A 95  
AA1 2 VAL A 35 ? TYR A 41 ? VAL A 79  TYR A 85  
AA1 3 GLU A 77 ? GLU A 82 ? GLU A 121 GLU A 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 49 ? O PHE A 93 N LEU A 37 ? N LEU A 81  
AA1 2 3 N GLN A 38 ? N GLN A 82 O ILE A 81 ? O ILE A 125 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    D8N 
_struct_site.pdbx_auth_seq_id     500 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'binding site for residue D8N A 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LYS A 87  ? LYS A 131 . ? 1_555 ? 
2 AC1 2 CYS A 107 ? CYS A 151 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   6FFM 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 58 ? ? -91.39 32.24   
2 1 GLN A 86 ? ? 50.02  -110.91 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 18.7508 -16.6090 -27.7593 0.5882 0.6311 0.5789 0.0781 -0.0616 0.0003  3.8410 6.0595 2.4275 -3.0904 
0.0214  0.2021  1.0596  0.6748  0.3873  -0.5398 -0.6391 -0.6658 0.1896  0.4715  -0.1915 
'X-RAY DIFFRACTION' 2 ? refined -0.3245 -13.0957 -15.7097 0.5183 0.3855 0.5770 0.1067 0.0663  -0.0749 2.7298 1.8474 2.5739 -1.4801 
1.5658  -0.0994 0.0083  -0.2215 -0.2156 0.4932  -0.1637 0.4697  0.1517  0.0632  0.1276  
'X-RAY DIFFRACTION' 3 ? refined -2.2405 -26.8647 -15.1197 2.0984 0.9079 1.2551 0.1277 -0.2724 0.0806  0.2872 0.0113 0.4056 0.0603  
0.3421  0.0710  -0.0186 -0.9723 -0.6905 -0.3516 -0.3347 0.6520  1.7871  -0.4391 0.1167  
'X-RAY DIFFRACTION' 4 ? refined 3.6584  -4.1604  -13.2552 0.7744 0.4881 0.5263 0.1956 -0.0275 0.0021  5.9449 3.4036 4.8844 -1.6046 
-0.4537 1.5584  -0.4686 -0.5099 0.9854  0.2590  0.3311  0.1073  -1.2095 -0.3755 0.0659  
'X-RAY DIFFRACTION' 5 ? refined 12.0560 -1.0122  -4.5131  0.8868 0.4355 0.5056 0.0516 -0.0645 -0.0314 5.3869 6.0889 4.4629 3.0357  
0.5627  1.6268  -0.0205 -0.1455 0.0829  -0.8055 -0.0041 -0.2281 -0.2576 0.4503  0.0476  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 50 through 72 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 73 through 111 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 112 through 120 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 121 through 151 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 152 through 180 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 45 ? A GLY 1 
2 1 Y 1 A HIS 46 ? A HIS 2 
3 1 Y 1 A MET 47 ? A MET 3 
4 1 Y 1 A GLY 48 ? A GLY 4 
5 1 Y 1 A ASN 49 ? A ASN 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
D8N C01  C N N 88  
D8N C02  C N R 89  
D8N C05  C N N 90  
D8N C06  C Y N 91  
D8N C07  C Y N 92  
D8N C08  C Y N 93  
D8N C09  C Y N 94  
D8N C10  C Y N 95  
D8N C11  C Y N 96  
D8N C13  C N N 97  
D8N C15  C N N 98  
D8N N04  N N N 99  
D8N N12  N N N 100 
D8N O03  O N N 101 
D8N O14  O N N 102 
D8N H012 H N N 103 
D8N H011 H N N 104 
D8N H021 H N N 105 
D8N H071 H N N 106 
D8N H081 H N N 107 
D8N H101 H N N 108 
D8N H111 H N N 109 
D8N H152 H N N 110 
D8N H151 H N N 111 
D8N H153 H N N 112 
D8N H121 H N N 113 
D8N H1   H N N 114 
GLN N    N N N 115 
GLN CA   C N S 116 
GLN C    C N N 117 
GLN O    O N N 118 
GLN CB   C N N 119 
GLN CG   C N N 120 
GLN CD   C N N 121 
GLN OE1  O N N 122 
GLN NE2  N N N 123 
GLN OXT  O N N 124 
GLN H    H N N 125 
GLN H2   H N N 126 
GLN HA   H N N 127 
GLN HB2  H N N 128 
GLN HB3  H N N 129 
GLN HG2  H N N 130 
GLN HG3  H N N 131 
GLN HE21 H N N 132 
GLN HE22 H N N 133 
GLN HXT  H N N 134 
GLU N    N N N 135 
GLU CA   C N S 136 
GLU C    C N N 137 
GLU O    O N N 138 
GLU CB   C N N 139 
GLU CG   C N N 140 
GLU CD   C N N 141 
GLU OE1  O N N 142 
GLU OE2  O N N 143 
GLU OXT  O N N 144 
GLU H    H N N 145 
GLU H2   H N N 146 
GLU HA   H N N 147 
GLU HB2  H N N 148 
GLU HB3  H N N 149 
GLU HG2  H N N 150 
GLU HG3  H N N 151 
GLU HE2  H N N 152 
GLU HXT  H N N 153 
GLY N    N N N 154 
GLY CA   C N N 155 
GLY C    C N N 156 
GLY O    O N N 157 
GLY OXT  O N N 158 
GLY H    H N N 159 
GLY H2   H N N 160 
GLY HA2  H N N 161 
GLY HA3  H N N 162 
GLY HXT  H N N 163 
HIS N    N N N 164 
HIS CA   C N S 165 
HIS C    C N N 166 
HIS O    O N N 167 
HIS CB   C N N 168 
HIS CG   C Y N 169 
HIS ND1  N Y N 170 
HIS CD2  C Y N 171 
HIS CE1  C Y N 172 
HIS NE2  N Y N 173 
HIS OXT  O N N 174 
HIS H    H N N 175 
HIS H2   H N N 176 
HIS HA   H N N 177 
HIS HB2  H N N 178 
HIS HB3  H N N 179 
HIS HD1  H N N 180 
HIS HD2  H N N 181 
HIS HE1  H N N 182 
HIS HE2  H N N 183 
HIS HXT  H N N 184 
HOH O    O N N 185 
HOH H1   H N N 186 
HOH H2   H N N 187 
ILE N    N N N 188 
ILE CA   C N S 189 
ILE C    C N N 190 
ILE O    O N N 191 
ILE CB   C N S 192 
ILE CG1  C N N 193 
ILE CG2  C N N 194 
ILE CD1  C N N 195 
ILE OXT  O N N 196 
ILE H    H N N 197 
ILE H2   H N N 198 
ILE HA   H N N 199 
ILE HB   H N N 200 
ILE HG12 H N N 201 
ILE HG13 H N N 202 
ILE HG21 H N N 203 
ILE HG22 H N N 204 
ILE HG23 H N N 205 
ILE HD11 H N N 206 
ILE HD12 H N N 207 
ILE HD13 H N N 208 
ILE HXT  H N N 209 
LEU N    N N N 210 
LEU CA   C N S 211 
LEU C    C N N 212 
LEU O    O N N 213 
LEU CB   C N N 214 
LEU CG   C N N 215 
LEU CD1  C N N 216 
LEU CD2  C N N 217 
LEU OXT  O N N 218 
LEU H    H N N 219 
LEU H2   H N N 220 
LEU HA   H N N 221 
LEU HB2  H N N 222 
LEU HB3  H N N 223 
LEU HG   H N N 224 
LEU HD11 H N N 225 
LEU HD12 H N N 226 
LEU HD13 H N N 227 
LEU HD21 H N N 228 
LEU HD22 H N N 229 
LEU HD23 H N N 230 
LEU HXT  H N N 231 
LYS N    N N N 232 
LYS CA   C N S 233 
LYS C    C N N 234 
LYS O    O N N 235 
LYS CB   C N N 236 
LYS CG   C N N 237 
LYS CD   C N N 238 
LYS CE   C N N 239 
LYS NZ   N N N 240 
LYS OXT  O N N 241 
LYS H    H N N 242 
LYS H2   H N N 243 
LYS HA   H N N 244 
LYS HB2  H N N 245 
LYS HB3  H N N 246 
LYS HG2  H N N 247 
LYS HG3  H N N 248 
LYS HD2  H N N 249 
LYS HD3  H N N 250 
LYS HE2  H N N 251 
LYS HE3  H N N 252 
LYS HZ1  H N N 253 
LYS HZ2  H N N 254 
LYS HZ3  H N N 255 
LYS HXT  H N N 256 
MET N    N N N 257 
MET CA   C N S 258 
MET C    C N N 259 
MET O    O N N 260 
MET CB   C N N 261 
MET CG   C N N 262 
MET SD   S N N 263 
MET CE   C N N 264 
MET OXT  O N N 265 
MET H    H N N 266 
MET H2   H N N 267 
MET HA   H N N 268 
MET HB2  H N N 269 
MET HB3  H N N 270 
MET HG2  H N N 271 
MET HG3  H N N 272 
MET HE1  H N N 273 
MET HE2  H N N 274 
MET HE3  H N N 275 
MET HXT  H N N 276 
PHE N    N N N 277 
PHE CA   C N S 278 
PHE C    C N N 279 
PHE O    O N N 280 
PHE CB   C N N 281 
PHE CG   C Y N 282 
PHE CD1  C Y N 283 
PHE CD2  C Y N 284 
PHE CE1  C Y N 285 
PHE CE2  C Y N 286 
PHE CZ   C Y N 287 
PHE OXT  O N N 288 
PHE H    H N N 289 
PHE H2   H N N 290 
PHE HA   H N N 291 
PHE HB2  H N N 292 
PHE HB3  H N N 293 
PHE HD1  H N N 294 
PHE HD2  H N N 295 
PHE HE1  H N N 296 
PHE HE2  H N N 297 
PHE HZ   H N N 298 
PHE HXT  H N N 299 
PRO N    N N N 300 
PRO CA   C N S 301 
PRO C    C N N 302 
PRO O    O N N 303 
PRO CB   C N N 304 
PRO CG   C N N 305 
PRO CD   C N N 306 
PRO OXT  O N N 307 
PRO H    H N N 308 
PRO HA   H N N 309 
PRO HB2  H N N 310 
PRO HB3  H N N 311 
PRO HG2  H N N 312 
PRO HG3  H N N 313 
PRO HD2  H N N 314 
PRO HD3  H N N 315 
PRO HXT  H N N 316 
SER N    N N N 317 
SER CA   C N S 318 
SER C    C N N 319 
SER O    O N N 320 
SER CB   C N N 321 
SER OG   O N N 322 
SER OXT  O N N 323 
SER H    H N N 324 
SER H2   H N N 325 
SER HA   H N N 326 
SER HB2  H N N 327 
SER HB3  H N N 328 
SER HG   H N N 329 
SER HXT  H N N 330 
THR N    N N N 331 
THR CA   C N S 332 
THR C    C N N 333 
THR O    O N N 334 
THR CB   C N R 335 
THR OG1  O N N 336 
THR CG2  C N N 337 
THR OXT  O N N 338 
THR H    H N N 339 
THR H2   H N N 340 
THR HA   H N N 341 
THR HB   H N N 342 
THR HG1  H N N 343 
THR HG21 H N N 344 
THR HG22 H N N 345 
THR HG23 H N N 346 
THR HXT  H N N 347 
TYR N    N N N 348 
TYR CA   C N S 349 
TYR C    C N N 350 
TYR O    O N N 351 
TYR CB   C N N 352 
TYR CG   C Y N 353 
TYR CD1  C Y N 354 
TYR CD2  C Y N 355 
TYR CE1  C Y N 356 
TYR CE2  C Y N 357 
TYR CZ   C Y N 358 
TYR OH   O N N 359 
TYR OXT  O N N 360 
TYR H    H N N 361 
TYR H2   H N N 362 
TYR HA   H N N 363 
TYR HB2  H N N 364 
TYR HB3  H N N 365 
TYR HD1  H N N 366 
TYR HD2  H N N 367 
TYR HE1  H N N 368 
TYR HE2  H N N 369 
TYR HH   H N N 370 
TYR HXT  H N N 371 
VAL N    N N N 372 
VAL CA   C N S 373 
VAL C    C N N 374 
VAL O    O N N 375 
VAL CB   C N N 376 
VAL CG1  C N N 377 
VAL CG2  C N N 378 
VAL OXT  O N N 379 
VAL H    H N N 380 
VAL H2   H N N 381 
VAL HA   H N N 382 
VAL HB   H N N 383 
VAL HG11 H N N 384 
VAL HG12 H N N 385 
VAL HG13 H N N 386 
VAL HG21 H N N 387 
VAL HG22 H N N 388 
VAL HG23 H N N 389 
VAL HXT  H N N 390 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
D8N C01 C05  sing N N 83  
D8N C01 C02  sing N N 84  
D8N C05 N04  doub N N 85  
D8N C11 C10  doub Y N 86  
D8N C11 C06  sing Y N 87  
D8N C02 C06  sing N N 88  
D8N C02 O03  sing N N 89  
D8N C10 C09  sing Y N 90  
D8N C06 C07  doub Y N 91  
D8N N04 O03  sing N N 92  
D8N C09 N12  sing N N 93  
D8N C09 C08  doub Y N 94  
D8N C07 C08  sing Y N 95  
D8N N12 C13  sing N N 96  
D8N C13 O14  doub N N 97  
D8N C13 C15  sing N N 98  
D8N C01 H012 sing N N 99  
D8N C01 H011 sing N N 100 
D8N C02 H021 sing N N 101 
D8N C07 H071 sing N N 102 
D8N C08 H081 sing N N 103 
D8N C10 H101 sing N N 104 
D8N C11 H111 sing N N 105 
D8N C15 H152 sing N N 106 
D8N C15 H151 sing N N 107 
D8N C15 H153 sing N N 108 
D8N N12 H121 sing N N 109 
D8N C05 H1   sing N N 110 
GLN N   CA   sing N N 111 
GLN N   H    sing N N 112 
GLN N   H2   sing N N 113 
GLN CA  C    sing N N 114 
GLN CA  CB   sing N N 115 
GLN CA  HA   sing N N 116 
GLN C   O    doub N N 117 
GLN C   OXT  sing N N 118 
GLN CB  CG   sing N N 119 
GLN CB  HB2  sing N N 120 
GLN CB  HB3  sing N N 121 
GLN CG  CD   sing N N 122 
GLN CG  HG2  sing N N 123 
GLN CG  HG3  sing N N 124 
GLN CD  OE1  doub N N 125 
GLN CD  NE2  sing N N 126 
GLN NE2 HE21 sing N N 127 
GLN NE2 HE22 sing N N 128 
GLN OXT HXT  sing N N 129 
GLU N   CA   sing N N 130 
GLU N   H    sing N N 131 
GLU N   H2   sing N N 132 
GLU CA  C    sing N N 133 
GLU CA  CB   sing N N 134 
GLU CA  HA   sing N N 135 
GLU C   O    doub N N 136 
GLU C   OXT  sing N N 137 
GLU CB  CG   sing N N 138 
GLU CB  HB2  sing N N 139 
GLU CB  HB3  sing N N 140 
GLU CG  CD   sing N N 141 
GLU CG  HG2  sing N N 142 
GLU CG  HG3  sing N N 143 
GLU CD  OE1  doub N N 144 
GLU CD  OE2  sing N N 145 
GLU OE2 HE2  sing N N 146 
GLU OXT HXT  sing N N 147 
GLY N   CA   sing N N 148 
GLY N   H    sing N N 149 
GLY N   H2   sing N N 150 
GLY CA  C    sing N N 151 
GLY CA  HA2  sing N N 152 
GLY CA  HA3  sing N N 153 
GLY C   O    doub N N 154 
GLY C   OXT  sing N N 155 
GLY OXT HXT  sing N N 156 
HIS N   CA   sing N N 157 
HIS N   H    sing N N 158 
HIS N   H2   sing N N 159 
HIS CA  C    sing N N 160 
HIS CA  CB   sing N N 161 
HIS CA  HA   sing N N 162 
HIS C   O    doub N N 163 
HIS C   OXT  sing N N 164 
HIS CB  CG   sing N N 165 
HIS CB  HB2  sing N N 166 
HIS CB  HB3  sing N N 167 
HIS CG  ND1  sing Y N 168 
HIS CG  CD2  doub Y N 169 
HIS ND1 CE1  doub Y N 170 
HIS ND1 HD1  sing N N 171 
HIS CD2 NE2  sing Y N 172 
HIS CD2 HD2  sing N N 173 
HIS CE1 NE2  sing Y N 174 
HIS CE1 HE1  sing N N 175 
HIS NE2 HE2  sing N N 176 
HIS OXT HXT  sing N N 177 
HOH O   H1   sing N N 178 
HOH O   H2   sing N N 179 
ILE N   CA   sing N N 180 
ILE N   H    sing N N 181 
ILE N   H2   sing N N 182 
ILE CA  C    sing N N 183 
ILE CA  CB   sing N N 184 
ILE CA  HA   sing N N 185 
ILE C   O    doub N N 186 
ILE C   OXT  sing N N 187 
ILE CB  CG1  sing N N 188 
ILE CB  CG2  sing N N 189 
ILE CB  HB   sing N N 190 
ILE CG1 CD1  sing N N 191 
ILE CG1 HG12 sing N N 192 
ILE CG1 HG13 sing N N 193 
ILE CG2 HG21 sing N N 194 
ILE CG2 HG22 sing N N 195 
ILE CG2 HG23 sing N N 196 
ILE CD1 HD11 sing N N 197 
ILE CD1 HD12 sing N N 198 
ILE CD1 HD13 sing N N 199 
ILE OXT HXT  sing N N 200 
LEU N   CA   sing N N 201 
LEU N   H    sing N N 202 
LEU N   H2   sing N N 203 
LEU CA  C    sing N N 204 
LEU CA  CB   sing N N 205 
LEU CA  HA   sing N N 206 
LEU C   O    doub N N 207 
LEU C   OXT  sing N N 208 
LEU CB  CG   sing N N 209 
LEU CB  HB2  sing N N 210 
LEU CB  HB3  sing N N 211 
LEU CG  CD1  sing N N 212 
LEU CG  CD2  sing N N 213 
LEU CG  HG   sing N N 214 
LEU CD1 HD11 sing N N 215 
LEU CD1 HD12 sing N N 216 
LEU CD1 HD13 sing N N 217 
LEU CD2 HD21 sing N N 218 
LEU CD2 HD22 sing N N 219 
LEU CD2 HD23 sing N N 220 
LEU OXT HXT  sing N N 221 
LYS N   CA   sing N N 222 
LYS N   H    sing N N 223 
LYS N   H2   sing N N 224 
LYS CA  C    sing N N 225 
LYS CA  CB   sing N N 226 
LYS CA  HA   sing N N 227 
LYS C   O    doub N N 228 
LYS C   OXT  sing N N 229 
LYS CB  CG   sing N N 230 
LYS CB  HB2  sing N N 231 
LYS CB  HB3  sing N N 232 
LYS CG  CD   sing N N 233 
LYS CG  HG2  sing N N 234 
LYS CG  HG3  sing N N 235 
LYS CD  CE   sing N N 236 
LYS CD  HD2  sing N N 237 
LYS CD  HD3  sing N N 238 
LYS CE  NZ   sing N N 239 
LYS CE  HE2  sing N N 240 
LYS CE  HE3  sing N N 241 
LYS NZ  HZ1  sing N N 242 
LYS NZ  HZ2  sing N N 243 
LYS NZ  HZ3  sing N N 244 
LYS OXT HXT  sing N N 245 
MET N   CA   sing N N 246 
MET N   H    sing N N 247 
MET N   H2   sing N N 248 
MET CA  C    sing N N 249 
MET CA  CB   sing N N 250 
MET CA  HA   sing N N 251 
MET C   O    doub N N 252 
MET C   OXT  sing N N 253 
MET CB  CG   sing N N 254 
MET CB  HB2  sing N N 255 
MET CB  HB3  sing N N 256 
MET CG  SD   sing N N 257 
MET CG  HG2  sing N N 258 
MET CG  HG3  sing N N 259 
MET SD  CE   sing N N 260 
MET CE  HE1  sing N N 261 
MET CE  HE2  sing N N 262 
MET CE  HE3  sing N N 263 
MET OXT HXT  sing N N 264 
PHE N   CA   sing N N 265 
PHE N   H    sing N N 266 
PHE N   H2   sing N N 267 
PHE CA  C    sing N N 268 
PHE CA  CB   sing N N 269 
PHE CA  HA   sing N N 270 
PHE C   O    doub N N 271 
PHE C   OXT  sing N N 272 
PHE CB  CG   sing N N 273 
PHE CB  HB2  sing N N 274 
PHE CB  HB3  sing N N 275 
PHE CG  CD1  doub Y N 276 
PHE CG  CD2  sing Y N 277 
PHE CD1 CE1  sing Y N 278 
PHE CD1 HD1  sing N N 279 
PHE CD2 CE2  doub Y N 280 
PHE CD2 HD2  sing N N 281 
PHE CE1 CZ   doub Y N 282 
PHE CE1 HE1  sing N N 283 
PHE CE2 CZ   sing Y N 284 
PHE CE2 HE2  sing N N 285 
PHE CZ  HZ   sing N N 286 
PHE OXT HXT  sing N N 287 
PRO N   CA   sing N N 288 
PRO N   CD   sing N N 289 
PRO N   H    sing N N 290 
PRO CA  C    sing N N 291 
PRO CA  CB   sing N N 292 
PRO CA  HA   sing N N 293 
PRO C   O    doub N N 294 
PRO C   OXT  sing N N 295 
PRO CB  CG   sing N N 296 
PRO CB  HB2  sing N N 297 
PRO CB  HB3  sing N N 298 
PRO CG  CD   sing N N 299 
PRO CG  HG2  sing N N 300 
PRO CG  HG3  sing N N 301 
PRO CD  HD2  sing N N 302 
PRO CD  HD3  sing N N 303 
PRO OXT HXT  sing N N 304 
SER N   CA   sing N N 305 
SER N   H    sing N N 306 
SER N   H2   sing N N 307 
SER CA  C    sing N N 308 
SER CA  CB   sing N N 309 
SER CA  HA   sing N N 310 
SER C   O    doub N N 311 
SER C   OXT  sing N N 312 
SER CB  OG   sing N N 313 
SER CB  HB2  sing N N 314 
SER CB  HB3  sing N N 315 
SER OG  HG   sing N N 316 
SER OXT HXT  sing N N 317 
THR N   CA   sing N N 318 
THR N   H    sing N N 319 
THR N   H2   sing N N 320 
THR CA  C    sing N N 321 
THR CA  CB   sing N N 322 
THR CA  HA   sing N N 323 
THR C   O    doub N N 324 
THR C   OXT  sing N N 325 
THR CB  OG1  sing N N 326 
THR CB  CG2  sing N N 327 
THR CB  HB   sing N N 328 
THR OG1 HG1  sing N N 329 
THR CG2 HG21 sing N N 330 
THR CG2 HG22 sing N N 331 
THR CG2 HG23 sing N N 332 
THR OXT HXT  sing N N 333 
TYR N   CA   sing N N 334 
TYR N   H    sing N N 335 
TYR N   H2   sing N N 336 
TYR CA  C    sing N N 337 
TYR CA  CB   sing N N 338 
TYR CA  HA   sing N N 339 
TYR C   O    doub N N 340 
TYR C   OXT  sing N N 341 
TYR CB  CG   sing N N 342 
TYR CB  HB2  sing N N 343 
TYR CB  HB3  sing N N 344 
TYR CG  CD1  doub Y N 345 
TYR CG  CD2  sing Y N 346 
TYR CD1 CE1  sing Y N 347 
TYR CD1 HD1  sing N N 348 
TYR CD2 CE2  doub Y N 349 
TYR CD2 HD2  sing N N 350 
TYR CE1 CZ   doub Y N 351 
TYR CE1 HE1  sing N N 352 
TYR CE2 CZ   sing Y N 353 
TYR CE2 HE2  sing N N 354 
TYR CZ  OH   sing N N 355 
TYR OH  HH   sing N N 356 
TYR OXT HXT  sing N N 357 
VAL N   CA   sing N N 358 
VAL N   H    sing N N 359 
VAL N   H2   sing N N 360 
VAL CA  C    sing N N 361 
VAL CA  CB   sing N N 362 
VAL CA  HA   sing N N 363 
VAL C   O    doub N N 364 
VAL C   OXT  sing N N 365 
VAL CB  CG1  sing N N 366 
VAL CB  CG2  sing N N 367 
VAL CB  HB   sing N N 368 
VAL CG1 HG11 sing N N 369 
VAL CG1 HG12 sing N N 370 
VAL CG1 HG13 sing N N 371 
VAL CG2 HG21 sing N N 372 
VAL CG2 HG22 sing N N 373 
VAL CG2 HG23 sing N N 374 
VAL OXT HXT  sing N N 375 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4CXI 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6FFM 
_atom_sites.fract_transf_matrix[1][1]   0.023534 
_atom_sites.fract_transf_matrix[1][2]   0.013588 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027175 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003771 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_