data_6FFM # _entry.id 6FFM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FFM pdb_00006ffm 10.2210/pdb6ffm/pdb WWPDB D_1200008240 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-14 2 'Structure model' 1 1 2024-01-17 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FFM _pdbx_database_status.recvd_initial_deposition_date 2018-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Moniot, S.' 1 0000-0002-2890-8075 'Steegborn, C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev ChemistryOpen _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2191-1363 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 858 _citation.page_last 864 _citation.title 'Effects of 3-Bromo-4,5-dihydroisoxazole Derivatives on Nrf2 Activation and Heme Oxygenase-1 Expression.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/open.201800185 _citation.pdbx_database_id_PubMed 30397576 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pinto, A.' 1 ? primary 'El Ali, Z.' 2 ? primary 'Moniot, S.' 3 ? primary 'Tamborini, L.' 4 0000-0002-9755-7846 primary 'Steegborn, C.' 5 ? primary 'Foresti, R.' 6 ? primary 'De Micheli, C.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 15206.571 1 ? S172A ? ? 2 non-polymer syn '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' 204.225 1 ? ? ? ? 3 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVS IEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVS IEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' D8N 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLY n 1 5 ASN n 1 6 ARG n 1 7 THR n 1 8 PHE n 1 9 SER n 1 10 TYR n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 HIS n 1 16 THR n 1 17 LYS n 1 18 GLN n 1 19 ALA n 1 20 PHE n 1 21 GLY n 1 22 ILE n 1 23 MET n 1 24 ASN n 1 25 GLU n 1 26 LEU n 1 27 ARG n 1 28 LEU n 1 29 SER n 1 30 GLN n 1 31 GLN n 1 32 LEU n 1 33 CYS n 1 34 ASP n 1 35 VAL n 1 36 THR n 1 37 LEU n 1 38 GLN n 1 39 VAL n 1 40 LYS n 1 41 TYR n 1 42 GLN n 1 43 ASP n 1 44 ALA n 1 45 PRO n 1 46 ALA n 1 47 ALA n 1 48 GLN n 1 49 PHE n 1 50 MET n 1 51 ALA n 1 52 HIS n 1 53 LYS n 1 54 VAL n 1 55 VAL n 1 56 LEU n 1 57 ALA n 1 58 SER n 1 59 SER n 1 60 SER n 1 61 PRO n 1 62 VAL n 1 63 PHE n 1 64 LYS n 1 65 ALA n 1 66 MET n 1 67 PHE n 1 68 THR n 1 69 ASN n 1 70 GLY n 1 71 LEU n 1 72 ARG n 1 73 GLU n 1 74 GLN n 1 75 GLY n 1 76 MET n 1 77 GLU n 1 78 VAL n 1 79 VAL n 1 80 SER n 1 81 ILE n 1 82 GLU n 1 83 GLY n 1 84 ILE n 1 85 HIS n 1 86 PRO n 1 87 LYS n 1 88 VAL n 1 89 MET n 1 90 GLU n 1 91 ARG n 1 92 LEU n 1 93 ILE n 1 94 GLU n 1 95 PHE n 1 96 ALA n 1 97 TYR n 1 98 THR n 1 99 ALA n 1 100 SER n 1 101 ILE n 1 102 SER n 1 103 MET n 1 104 GLY n 1 105 GLU n 1 106 LYS n 1 107 CYS n 1 108 VAL n 1 109 LEU n 1 110 HIS n 1 111 VAL n 1 112 MET n 1 113 ASN n 1 114 GLY n 1 115 ALA n 1 116 VAL n 1 117 MET n 1 118 TYR n 1 119 GLN n 1 120 ILE n 1 121 ASP n 1 122 SER n 1 123 VAL n 1 124 VAL n 1 125 ARG n 1 126 ALA n 1 127 CYS n 1 128 ALA n 1 129 ASP n 1 130 PHE n 1 131 LEU n 1 132 VAL n 1 133 GLN n 1 134 GLN n 1 135 LEU n 1 136 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 136 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KEAP1, INRF2, KIAA0132, KLHL19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'N-term His-tag cleavable with TEV protease' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET19mod _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D8N non-polymer . '~{N}-[4-[(5~{R})-4,5-dihydro-1,2-oxazol-5-yl]phenyl]ethanamide' ? 'C11 H12 N2 O2' 204.225 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 45 ? ? ? A . n A 1 2 HIS 2 46 ? ? ? A . n A 1 3 MET 3 47 ? ? ? A . n A 1 4 GLY 4 48 ? ? ? A . n A 1 5 ASN 5 49 ? ? ? A . n A 1 6 ARG 6 50 50 ARG ARG A . n A 1 7 THR 7 51 51 THR THR A . n A 1 8 PHE 8 52 52 PHE PHE A . n A 1 9 SER 9 53 53 SER SER A . n A 1 10 TYR 10 54 54 TYR TYR A . n A 1 11 THR 11 55 55 THR THR A . n A 1 12 LEU 12 56 56 LEU LEU A . n A 1 13 GLU 13 57 57 GLU GLU A . n A 1 14 ASP 14 58 58 ASP ASP A . n A 1 15 HIS 15 59 59 HIS HIS A . n A 1 16 THR 16 60 60 THR THR A . n A 1 17 LYS 17 61 61 LYS LYS A . n A 1 18 GLN 18 62 62 GLN GLN A . n A 1 19 ALA 19 63 63 ALA ALA A . n A 1 20 PHE 20 64 64 PHE PHE A . n A 1 21 GLY 21 65 65 GLY GLY A . n A 1 22 ILE 22 66 66 ILE ILE A . n A 1 23 MET 23 67 67 MET MET A . n A 1 24 ASN 24 68 68 ASN ASN A . n A 1 25 GLU 25 69 69 GLU GLU A . n A 1 26 LEU 26 70 70 LEU LEU A . n A 1 27 ARG 27 71 71 ARG ARG A . n A 1 28 LEU 28 72 72 LEU LEU A . n A 1 29 SER 29 73 73 SER SER A . n A 1 30 GLN 30 74 74 GLN GLN A . n A 1 31 GLN 31 75 75 GLN GLN A . n A 1 32 LEU 32 76 76 LEU LEU A . n A 1 33 CYS 33 77 77 CYS CYS A . n A 1 34 ASP 34 78 78 ASP ASP A . n A 1 35 VAL 35 79 79 VAL VAL A . n A 1 36 THR 36 80 80 THR THR A . n A 1 37 LEU 37 81 81 LEU LEU A . n A 1 38 GLN 38 82 82 GLN GLN A . n A 1 39 VAL 39 83 83 VAL VAL A . n A 1 40 LYS 40 84 84 LYS LYS A . n A 1 41 TYR 41 85 85 TYR TYR A . n A 1 42 GLN 42 86 86 GLN GLN A . n A 1 43 ASP 43 87 87 ASP ASP A . n A 1 44 ALA 44 88 88 ALA ALA A . n A 1 45 PRO 45 89 89 PRO PRO A . n A 1 46 ALA 46 90 90 ALA ALA A . n A 1 47 ALA 47 91 91 ALA ALA A . n A 1 48 GLN 48 92 92 GLN GLN A . n A 1 49 PHE 49 93 93 PHE PHE A . n A 1 50 MET 50 94 94 MET MET A . n A 1 51 ALA 51 95 95 ALA ALA A . n A 1 52 HIS 52 96 96 HIS HIS A . n A 1 53 LYS 53 97 97 LYS LYS A . n A 1 54 VAL 54 98 98 VAL VAL A . n A 1 55 VAL 55 99 99 VAL VAL A . n A 1 56 LEU 56 100 100 LEU LEU A . n A 1 57 ALA 57 101 101 ALA ALA A . n A 1 58 SER 58 102 102 SER SER A . n A 1 59 SER 59 103 103 SER SER A . n A 1 60 SER 60 104 104 SER SER A . n A 1 61 PRO 61 105 105 PRO PRO A . n A 1 62 VAL 62 106 106 VAL VAL A . n A 1 63 PHE 63 107 107 PHE PHE A . n A 1 64 LYS 64 108 108 LYS LYS A . n A 1 65 ALA 65 109 109 ALA ALA A . n A 1 66 MET 66 110 110 MET MET A . n A 1 67 PHE 67 111 111 PHE PHE A . n A 1 68 THR 68 112 112 THR THR A . n A 1 69 ASN 69 113 113 ASN ASN A . n A 1 70 GLY 70 114 114 GLY GLY A . n A 1 71 LEU 71 115 115 LEU LEU A . n A 1 72 ARG 72 116 116 ARG ARG A . n A 1 73 GLU 73 117 117 GLU GLU A . n A 1 74 GLN 74 118 118 GLN GLN A . n A 1 75 GLY 75 119 119 GLY GLY A . n A 1 76 MET 76 120 120 MET MET A . n A 1 77 GLU 77 121 121 GLU GLU A . n A 1 78 VAL 78 122 122 VAL VAL A . n A 1 79 VAL 79 123 123 VAL VAL A . n A 1 80 SER 80 124 124 SER SER A . n A 1 81 ILE 81 125 125 ILE ILE A . n A 1 82 GLU 82 126 126 GLU GLU A . n A 1 83 GLY 83 127 127 GLY GLY A . n A 1 84 ILE 84 128 128 ILE ILE A . n A 1 85 HIS 85 129 129 HIS HIS A . n A 1 86 PRO 86 130 130 PRO PRO A . n A 1 87 LYS 87 131 131 LYS LYS A . n A 1 88 VAL 88 132 132 VAL VAL A . n A 1 89 MET 89 133 133 MET MET A . n A 1 90 GLU 90 134 134 GLU GLU A . n A 1 91 ARG 91 135 135 ARG ARG A . n A 1 92 LEU 92 136 136 LEU LEU A . n A 1 93 ILE 93 137 137 ILE ILE A . n A 1 94 GLU 94 138 138 GLU GLU A . n A 1 95 PHE 95 139 139 PHE PHE A . n A 1 96 ALA 96 140 140 ALA ALA A . n A 1 97 TYR 97 141 141 TYR TYR A . n A 1 98 THR 98 142 142 THR THR A . n A 1 99 ALA 99 143 143 ALA ALA A . n A 1 100 SER 100 144 144 SER SER A . n A 1 101 ILE 101 145 145 ILE ILE A . n A 1 102 SER 102 146 146 SER SER A . n A 1 103 MET 103 147 147 MET MET A . n A 1 104 GLY 104 148 148 GLY GLY A . n A 1 105 GLU 105 149 149 GLU GLU A . n A 1 106 LYS 106 150 150 LYS LYS A . n A 1 107 CYS 107 151 151 CYS CYS A . n A 1 108 VAL 108 152 152 VAL VAL A . n A 1 109 LEU 109 153 153 LEU LEU A . n A 1 110 HIS 110 154 154 HIS HIS A . n A 1 111 VAL 111 155 155 VAL VAL A . n A 1 112 MET 112 156 156 MET MET A . n A 1 113 ASN 113 157 157 ASN ASN A . n A 1 114 GLY 114 158 158 GLY GLY A . n A 1 115 ALA 115 159 159 ALA ALA A . n A 1 116 VAL 116 160 160 VAL VAL A . n A 1 117 MET 117 161 161 MET MET A . n A 1 118 TYR 118 162 162 TYR TYR A . n A 1 119 GLN 119 163 163 GLN GLN A . n A 1 120 ILE 120 164 164 ILE ILE A . n A 1 121 ASP 121 165 165 ASP ASP A . n A 1 122 SER 122 166 166 SER SER A . n A 1 123 VAL 123 167 167 VAL VAL A . n A 1 124 VAL 124 168 168 VAL VAL A . n A 1 125 ARG 125 169 169 ARG ARG A . n A 1 126 ALA 126 170 170 ALA ALA A . n A 1 127 CYS 127 171 171 CYS CYS A . n A 1 128 ALA 128 172 172 ALA ALA A . n A 1 129 ASP 129 173 173 ASP ASP A . n A 1 130 PHE 130 174 174 PHE PHE A . n A 1 131 LEU 131 175 175 LEU LEU A . n A 1 132 VAL 132 176 176 VAL VAL A . n A 1 133 GLN 133 177 177 GLN GLN A . n A 1 134 GLN 134 178 178 GLN GLN A . n A 1 135 LEU 135 179 179 LEU LEU A . n A 1 136 ASP 136 180 180 ASP ASP A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id D8N _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id D8N _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D8N 1 500 500 D8N lig A . C 3 HOH 1 601 3 HOH HOH A . C 3 HOH 2 602 14 HOH HOH A . C 3 HOH 3 603 15 HOH HOH A . C 3 HOH 4 604 1 HOH HOH A . C 3 HOH 5 605 16 HOH HOH A . C 3 HOH 6 606 18 HOH HOH A . C 3 HOH 7 607 6 HOH HOH A . C 3 HOH 8 608 13 HOH HOH A . C 3 HOH 9 609 17 HOH HOH A . C 3 HOH 10 610 7 HOH HOH A . C 3 HOH 11 611 8 HOH HOH A . C 3 HOH 12 612 4 HOH HOH A . C 3 HOH 13 613 12 HOH HOH A . C 3 HOH 14 614 10 HOH HOH A . C 3 HOH 15 615 19 HOH HOH A . C 3 HOH 16 616 5 HOH HOH A . C 3 HOH 17 617 2 HOH HOH A . C 3 HOH 18 618 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 116 ? CG ? A ARG 72 CG 2 1 Y 1 A ARG 116 ? CD ? A ARG 72 CD 3 1 Y 1 A ARG 116 ? NE ? A ARG 72 NE 4 1 Y 1 A ARG 116 ? CZ ? A ARG 72 CZ 5 1 Y 1 A ARG 116 ? NH1 ? A ARG 72 NH1 6 1 Y 1 A ARG 116 ? NH2 ? A ARG 72 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FFM _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.491 _cell.length_a_esd ? _cell.length_b 42.491 _cell.length_b_esd ? _cell.length_c 265.213 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FFM _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FFM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25-28 % PEG 4000, 0.1 M Tris-HCl pH 8.0 and 0.2 M lithium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator KMC-1 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91814 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91814 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 50.25 _reflns.entry_id 6FFM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 44.202 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7968 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.73 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1492 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.279 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.57 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 752 _reflns_shell.percent_possible_all 99.08 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.161 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.33 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FFM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 44.202 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7948 _refine.ls_number_reflns_R_free 793 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.76 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2568 _refine.ls_R_factor_R_free 0.2929 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2525 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4cxi _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.61 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.48 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1020 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1053 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 44.202 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1091 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.398 ? 1478 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.583 ? 664 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 168 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 192 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2000 2.3378 . . 127 1148 99.00 . . . 0.4441 . 0.4063 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3378 2.5183 . . 125 1136 98.00 . . . 0.3759 . 0.3726 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5183 2.7717 . . 128 1159 100.00 . . . 0.3573 . 0.3355 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7717 3.1727 . . 131 1178 99.00 . . . 0.3559 . 0.2889 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1727 3.9969 . . 134 1204 99.00 . . . 0.2970 . 0.2337 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9969 44.2111 . . 148 1330 98.00 . . . 0.2394 . 0.2068 . . . . . . . . . . # _struct.entry_id 6FFM _struct.title 'Crystal Structure of Human KEAP1 BTB Domain in Complex with isoxazoline-based inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FFM _struct_keywords.text '3-bromo-4 5-dihydroisoxazole, BTB domain, antioxidant response, Signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KEAP1_HUMAN _struct_ref.pdbx_db_accession Q14145 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEG IHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD ; _struct_ref.pdbx_align_begin 48 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FFM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14145 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 48 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FFM GLY A 1 ? UNP Q14145 ? ? 'expression tag' 45 1 1 6FFM HIS A 2 ? UNP Q14145 ? ? 'expression tag' 46 2 1 6FFM MET A 3 ? UNP Q14145 ? ? 'expression tag' 47 3 1 6FFM ALA A 128 ? UNP Q14145 SER 172 'engineered mutation' 172 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4070 ? 1 MORE -37 ? 1 'SSA (A^2)' 14030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_544 x,x-y-1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 21.2455000000 0.8660254038 -0.5000000000 0.0000000000 -36.7982854322 0.0000000000 0.0000000000 -1.0000000000 -44.2021666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 14 ? SER A 29 ? ASP A 58 SER A 73 1 ? 16 HELX_P HELX_P2 AA2 HIS A 52 ? SER A 60 ? HIS A 96 SER A 104 1 ? 9 HELX_P HELX_P3 AA3 SER A 60 ? THR A 68 ? SER A 104 THR A 112 1 ? 9 HELX_P HELX_P4 AA4 HIS A 85 ? ALA A 99 ? HIS A 129 ALA A 143 1 ? 15 HELX_P HELX_P5 AA5 GLY A 104 ? LYS A 106 ? GLY A 148 LYS A 150 5 ? 3 HELX_P HELX_P6 AA6 CYS A 107 ? TYR A 118 ? CYS A 151 TYR A 162 1 ? 12 HELX_P HELX_P7 AA7 ILE A 120 ? LEU A 135 ? ILE A 164 LEU A 179 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 107 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id A _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id D8N _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C05 _struct_conn.pdbx_ptnr2_label_alt_id A _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 151 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id D8N _struct_conn.ptnr2_auth_seq_id 500 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.813 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id D8N _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id A _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 107 _pdbx_modification_feature.modified_residue_label_alt_id A _pdbx_modification_feature.auth_comp_id D8N _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 500 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 151 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C05 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id D8N _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 44 ? ALA A 51 ? ALA A 88 ALA A 95 AA1 2 VAL A 35 ? TYR A 41 ? VAL A 79 TYR A 85 AA1 3 GLU A 77 ? GLU A 82 ? GLU A 121 GLU A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 49 ? O PHE A 93 N LEU A 37 ? N LEU A 81 AA1 2 3 N GLN A 38 ? N GLN A 82 O ILE A 81 ? O ILE A 125 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id D8N _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue D8N A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LYS A 87 ? LYS A 131 . ? 1_555 ? 2 AC1 2 CYS A 107 ? CYS A 151 . ? 1_555 ? # _pdbx_entry_details.entry_id 6FFM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 58 ? ? -91.39 32.24 2 1 GLN A 86 ? ? 50.02 -110.91 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 18.7508 -16.6090 -27.7593 0.5882 0.6311 0.5789 0.0781 -0.0616 0.0003 3.8410 6.0595 2.4275 -3.0904 0.0214 0.2021 1.0596 0.6748 0.3873 -0.5398 -0.6391 -0.6658 0.1896 0.4715 -0.1915 'X-RAY DIFFRACTION' 2 ? refined -0.3245 -13.0957 -15.7097 0.5183 0.3855 0.5770 0.1067 0.0663 -0.0749 2.7298 1.8474 2.5739 -1.4801 1.5658 -0.0994 0.0083 -0.2215 -0.2156 0.4932 -0.1637 0.4697 0.1517 0.0632 0.1276 'X-RAY DIFFRACTION' 3 ? refined -2.2405 -26.8647 -15.1197 2.0984 0.9079 1.2551 0.1277 -0.2724 0.0806 0.2872 0.0113 0.4056 0.0603 0.3421 0.0710 -0.0186 -0.9723 -0.6905 -0.3516 -0.3347 0.6520 1.7871 -0.4391 0.1167 'X-RAY DIFFRACTION' 4 ? refined 3.6584 -4.1604 -13.2552 0.7744 0.4881 0.5263 0.1956 -0.0275 0.0021 5.9449 3.4036 4.8844 -1.6046 -0.4537 1.5584 -0.4686 -0.5099 0.9854 0.2590 0.3311 0.1073 -1.2095 -0.3755 0.0659 'X-RAY DIFFRACTION' 5 ? refined 12.0560 -1.0122 -4.5131 0.8868 0.4355 0.5056 0.0516 -0.0645 -0.0314 5.3869 6.0889 4.4629 3.0357 0.5627 1.6268 -0.0205 -0.1455 0.0829 -0.8055 -0.0041 -0.2281 -0.2576 0.4503 0.0476 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 50 through 72 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 73 through 111 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 112 through 120 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 121 through 151 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 152 through 180 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 45 ? A GLY 1 2 1 Y 1 A HIS 46 ? A HIS 2 3 1 Y 1 A MET 47 ? A MET 3 4 1 Y 1 A GLY 48 ? A GLY 4 5 1 Y 1 A ASN 49 ? A ASN 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 D8N C01 C N N 88 D8N C02 C N R 89 D8N C05 C N N 90 D8N C06 C Y N 91 D8N C07 C Y N 92 D8N C08 C Y N 93 D8N C09 C Y N 94 D8N C10 C Y N 95 D8N C11 C Y N 96 D8N C13 C N N 97 D8N C15 C N N 98 D8N N04 N N N 99 D8N N12 N N N 100 D8N O03 O N N 101 D8N O14 O N N 102 D8N H012 H N N 103 D8N H011 H N N 104 D8N H021 H N N 105 D8N H071 H N N 106 D8N H081 H N N 107 D8N H101 H N N 108 D8N H111 H N N 109 D8N H152 H N N 110 D8N H151 H N N 111 D8N H153 H N N 112 D8N H121 H N N 113 D8N H1 H N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 HOH O O N N 185 HOH H1 H N N 186 HOH H2 H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 MET N N N N 257 MET CA C N S 258 MET C C N N 259 MET O O N N 260 MET CB C N N 261 MET CG C N N 262 MET SD S N N 263 MET CE C N N 264 MET OXT O N N 265 MET H H N N 266 MET H2 H N N 267 MET HA H N N 268 MET HB2 H N N 269 MET HB3 H N N 270 MET HG2 H N N 271 MET HG3 H N N 272 MET HE1 H N N 273 MET HE2 H N N 274 MET HE3 H N N 275 MET HXT H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 D8N C01 C05 sing N N 83 D8N C01 C02 sing N N 84 D8N C05 N04 doub N N 85 D8N C11 C10 doub Y N 86 D8N C11 C06 sing Y N 87 D8N C02 C06 sing N N 88 D8N C02 O03 sing N N 89 D8N C10 C09 sing Y N 90 D8N C06 C07 doub Y N 91 D8N N04 O03 sing N N 92 D8N C09 N12 sing N N 93 D8N C09 C08 doub Y N 94 D8N C07 C08 sing Y N 95 D8N N12 C13 sing N N 96 D8N C13 O14 doub N N 97 D8N C13 C15 sing N N 98 D8N C01 H012 sing N N 99 D8N C01 H011 sing N N 100 D8N C02 H021 sing N N 101 D8N C07 H071 sing N N 102 D8N C08 H081 sing N N 103 D8N C10 H101 sing N N 104 D8N C11 H111 sing N N 105 D8N C15 H152 sing N N 106 D8N C15 H151 sing N N 107 D8N C15 H153 sing N N 108 D8N N12 H121 sing N N 109 D8N C05 H1 sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 HOH O H1 sing N N 178 HOH O H2 sing N N 179 ILE N CA sing N N 180 ILE N H sing N N 181 ILE N H2 sing N N 182 ILE CA C sing N N 183 ILE CA CB sing N N 184 ILE CA HA sing N N 185 ILE C O doub N N 186 ILE C OXT sing N N 187 ILE CB CG1 sing N N 188 ILE CB CG2 sing N N 189 ILE CB HB sing N N 190 ILE CG1 CD1 sing N N 191 ILE CG1 HG12 sing N N 192 ILE CG1 HG13 sing N N 193 ILE CG2 HG21 sing N N 194 ILE CG2 HG22 sing N N 195 ILE CG2 HG23 sing N N 196 ILE CD1 HD11 sing N N 197 ILE CD1 HD12 sing N N 198 ILE CD1 HD13 sing N N 199 ILE OXT HXT sing N N 200 LEU N CA sing N N 201 LEU N H sing N N 202 LEU N H2 sing N N 203 LEU CA C sing N N 204 LEU CA CB sing N N 205 LEU CA HA sing N N 206 LEU C O doub N N 207 LEU C OXT sing N N 208 LEU CB CG sing N N 209 LEU CB HB2 sing N N 210 LEU CB HB3 sing N N 211 LEU CG CD1 sing N N 212 LEU CG CD2 sing N N 213 LEU CG HG sing N N 214 LEU CD1 HD11 sing N N 215 LEU CD1 HD12 sing N N 216 LEU CD1 HD13 sing N N 217 LEU CD2 HD21 sing N N 218 LEU CD2 HD22 sing N N 219 LEU CD2 HD23 sing N N 220 LEU OXT HXT sing N N 221 LYS N CA sing N N 222 LYS N H sing N N 223 LYS N H2 sing N N 224 LYS CA C sing N N 225 LYS CA CB sing N N 226 LYS CA HA sing N N 227 LYS C O doub N N 228 LYS C OXT sing N N 229 LYS CB CG sing N N 230 LYS CB HB2 sing N N 231 LYS CB HB3 sing N N 232 LYS CG CD sing N N 233 LYS CG HG2 sing N N 234 LYS CG HG3 sing N N 235 LYS CD CE sing N N 236 LYS CD HD2 sing N N 237 LYS CD HD3 sing N N 238 LYS CE NZ sing N N 239 LYS CE HE2 sing N N 240 LYS CE HE3 sing N N 241 LYS NZ HZ1 sing N N 242 LYS NZ HZ2 sing N N 243 LYS NZ HZ3 sing N N 244 LYS OXT HXT sing N N 245 MET N CA sing N N 246 MET N H sing N N 247 MET N H2 sing N N 248 MET CA C sing N N 249 MET CA CB sing N N 250 MET CA HA sing N N 251 MET C O doub N N 252 MET C OXT sing N N 253 MET CB CG sing N N 254 MET CB HB2 sing N N 255 MET CB HB3 sing N N 256 MET CG SD sing N N 257 MET CG HG2 sing N N 258 MET CG HG3 sing N N 259 MET SD CE sing N N 260 MET CE HE1 sing N N 261 MET CE HE2 sing N N 262 MET CE HE3 sing N N 263 MET OXT HXT sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CXI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6FFM _atom_sites.fract_transf_matrix[1][1] 0.023534 _atom_sites.fract_transf_matrix[1][2] 0.013588 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027175 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003771 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_