data_6FGL # _entry.id 6FGL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FGL pdb_00006fgl 10.2210/pdb6fgl/pdb WWPDB D_1200008269 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-30 2 'Structure model' 1 1 2018-08-29 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 12 3 'Structure model' '_pdbx_struct_conn_angle.value' 13 3 'Structure model' '_struct_conn.pdbx_dist_value' 14 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FGL _pdbx_database_status.recvd_initial_deposition_date 2018-01-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5E73 contains the same small molecule complexed with the paralog bromodomain BAZ2B' _pdbx_database_related.db_id 5E73 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dalle Vedove, A.' 1 ? 'Unzue, A.' 2 ? 'Nevado, C.' 3 ? 'Lolli, G.' 4 ? 'Caflisch, A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev ChemMedChem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1479 _citation.page_last 1487 _citation.title 'Structural Analysis of Small-Molecule Binding to the BAZ2A and BAZ2B Bromodomains.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.201800234 _citation.pdbx_database_id_PubMed 29770599 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dalle Vedove, A.' 1 ? primary 'Spiliotopoulos, D.' 2 ? primary ;D'Agostino, V.G. ; 3 ? primary 'Marchand, J.R.' 4 ? primary 'Unzue, A.' 5 ? primary 'Nevado, C.' 6 ? primary 'Lolli, G.' 7 0000-0002-8536-5599 primary 'Caflisch, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain adjacent to zinc finger domain protein 2A' 12380.919 1 ? ? 'Bromodomain (residues 1796-1899)' 'First two residues SM derive from the expression tag' 2 non-polymer syn 'N-(1-acetyl-1H-indol-3-yl)-N-(5-hydroxy-2-methylphenyl)acetamide' 322.358 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 111 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transcription termination factor I-interacting protein 5,Tip5,hWALp3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFY ; _entity_poly.pdbx_seq_one_letter_code_can ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(1-acetyl-1H-indol-3-yl)-N-(5-hydroxy-2-methylphenyl)acetamide' UO1 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 HIS n 1 4 SER n 1 5 ASP n 1 6 LEU n 1 7 THR n 1 8 PHE n 1 9 CYS n 1 10 GLU n 1 11 ILE n 1 12 ILE n 1 13 LEU n 1 14 MET n 1 15 GLU n 1 16 MET n 1 17 GLU n 1 18 SER n 1 19 HIS n 1 20 ASP n 1 21 ALA n 1 22 ALA n 1 23 TRP n 1 24 PRO n 1 25 PHE n 1 26 LEU n 1 27 GLU n 1 28 PRO n 1 29 VAL n 1 30 ASN n 1 31 PRO n 1 32 ARG n 1 33 LEU n 1 34 VAL n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 ARG n 1 39 ARG n 1 40 ILE n 1 41 ILE n 1 42 LYS n 1 43 ASN n 1 44 PRO n 1 45 MET n 1 46 ASP n 1 47 PHE n 1 48 SER n 1 49 THR n 1 50 MET n 1 51 ARG n 1 52 GLU n 1 53 ARG n 1 54 LEU n 1 55 LEU n 1 56 ARG n 1 57 GLY n 1 58 GLY n 1 59 TYR n 1 60 THR n 1 61 SER n 1 62 SER n 1 63 GLU n 1 64 GLU n 1 65 PHE n 1 66 ALA n 1 67 ALA n 1 68 ASP n 1 69 ALA n 1 70 LEU n 1 71 LEU n 1 72 VAL n 1 73 PHE n 1 74 ASP n 1 75 ASN n 1 76 CYS n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 ASN n 1 81 GLU n 1 82 ASP n 1 83 ASP n 1 84 SER n 1 85 GLU n 1 86 VAL n 1 87 GLY n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 HIS n 1 92 ILE n 1 93 MET n 1 94 ARG n 1 95 ARG n 1 96 PHE n 1 97 PHE n 1 98 GLU n 1 99 SER n 1 100 ARG n 1 101 TRP n 1 102 GLU n 1 103 GLU n 1 104 PHE n 1 105 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 105 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAZ2A, KIAA0314, TIP5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UO1 non-polymer . 'N-(1-acetyl-1H-indol-3-yl)-N-(5-hydroxy-2-methylphenyl)acetamide' ? 'C19 H18 N2 O3' 322.358 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1794 ? ? ? A . n A 1 2 MET 2 1795 ? ? ? A . n A 1 3 HIS 3 1796 1796 HIS HIS A . n A 1 4 SER 4 1797 1797 SER SER A . n A 1 5 ASP 5 1798 1798 ASP ASP A . n A 1 6 LEU 6 1799 1799 LEU LEU A . n A 1 7 THR 7 1800 1800 THR THR A . n A 1 8 PHE 8 1801 1801 PHE PHE A . n A 1 9 CYS 9 1802 1802 CYS CYS A . n A 1 10 GLU 10 1803 1803 GLU GLU A . n A 1 11 ILE 11 1804 1804 ILE ILE A . n A 1 12 ILE 12 1805 1805 ILE ILE A . n A 1 13 LEU 13 1806 1806 LEU LEU A . n A 1 14 MET 14 1807 1807 MET MET A . n A 1 15 GLU 15 1808 1808 GLU GLU A . n A 1 16 MET 16 1809 1809 MET MET A . n A 1 17 GLU 17 1810 1810 GLU GLU A . n A 1 18 SER 18 1811 1811 SER SER A . n A 1 19 HIS 19 1812 1812 HIS HIS A . n A 1 20 ASP 20 1813 1813 ASP ASP A . n A 1 21 ALA 21 1814 1814 ALA ALA A . n A 1 22 ALA 22 1815 1815 ALA ALA A . n A 1 23 TRP 23 1816 1816 TRP TRP A . n A 1 24 PRO 24 1817 1817 PRO PRO A . n A 1 25 PHE 25 1818 1818 PHE PHE A . n A 1 26 LEU 26 1819 1819 LEU LEU A . n A 1 27 GLU 27 1820 1820 GLU GLU A . n A 1 28 PRO 28 1821 1821 PRO PRO A . n A 1 29 VAL 29 1822 1822 VAL VAL A . n A 1 30 ASN 30 1823 1823 ASN ASN A . n A 1 31 PRO 31 1824 1824 PRO PRO A . n A 1 32 ARG 32 1825 1825 ARG ARG A . n A 1 33 LEU 33 1826 1826 LEU LEU A . n A 1 34 VAL 34 1827 1827 VAL VAL A . n A 1 35 SER 35 1828 1828 SER SER A . n A 1 36 GLY 36 1829 1829 GLY GLY A . n A 1 37 TYR 37 1830 1830 TYR TYR A . n A 1 38 ARG 38 1831 1831 ARG ARG A . n A 1 39 ARG 39 1832 1832 ARG ARG A . n A 1 40 ILE 40 1833 1833 ILE ILE A . n A 1 41 ILE 41 1834 1834 ILE ILE A . n A 1 42 LYS 42 1835 1835 LYS LYS A . n A 1 43 ASN 43 1836 1836 ASN ASN A . n A 1 44 PRO 44 1837 1837 PRO PRO A . n A 1 45 MET 45 1838 1838 MET MET A . n A 1 46 ASP 46 1839 1839 ASP ASP A . n A 1 47 PHE 47 1840 1840 PHE PHE A . n A 1 48 SER 48 1841 1841 SER SER A . n A 1 49 THR 49 1842 1842 THR THR A . n A 1 50 MET 50 1843 1843 MET MET A . n A 1 51 ARG 51 1844 1844 ARG ARG A . n A 1 52 GLU 52 1845 1845 GLU GLU A . n A 1 53 ARG 53 1846 1846 ARG ARG A . n A 1 54 LEU 54 1847 1847 LEU LEU A . n A 1 55 LEU 55 1848 1848 LEU LEU A . n A 1 56 ARG 56 1849 1849 ARG ARG A . n A 1 57 GLY 57 1850 1850 GLY GLY A . n A 1 58 GLY 58 1851 1851 GLY GLY A . n A 1 59 TYR 59 1852 1852 TYR TYR A . n A 1 60 THR 60 1853 1853 THR THR A . n A 1 61 SER 61 1854 1854 SER SER A . n A 1 62 SER 62 1855 1855 SER SER A . n A 1 63 GLU 63 1856 1856 GLU GLU A . n A 1 64 GLU 64 1857 1857 GLU GLU A . n A 1 65 PHE 65 1858 1858 PHE PHE A . n A 1 66 ALA 66 1859 1859 ALA ALA A . n A 1 67 ALA 67 1860 1860 ALA ALA A . n A 1 68 ASP 68 1861 1861 ASP ASP A . n A 1 69 ALA 69 1862 1862 ALA ALA A . n A 1 70 LEU 70 1863 1863 LEU LEU A . n A 1 71 LEU 71 1864 1864 LEU LEU A . n A 1 72 VAL 72 1865 1865 VAL VAL A . n A 1 73 PHE 73 1866 1866 PHE PHE A . n A 1 74 ASP 74 1867 1867 ASP ASP A . n A 1 75 ASN 75 1868 1868 ASN ASN A . n A 1 76 CYS 76 1869 1869 CYS CYS A . n A 1 77 GLN 77 1870 1870 GLN GLN A . n A 1 78 THR 78 1871 1871 THR THR A . n A 1 79 PHE 79 1872 1872 PHE PHE A . n A 1 80 ASN 80 1873 1873 ASN ASN A . n A 1 81 GLU 81 1874 1874 GLU GLU A . n A 1 82 ASP 82 1875 1875 ASP ASP A . n A 1 83 ASP 83 1876 1876 ASP ASP A . n A 1 84 SER 84 1877 1877 SER SER A . n A 1 85 GLU 85 1878 1878 GLU GLU A . n A 1 86 VAL 86 1879 1879 VAL VAL A . n A 1 87 GLY 87 1880 1880 GLY GLY A . n A 1 88 LYS 88 1881 1881 LYS LYS A . n A 1 89 ALA 89 1882 1882 ALA ALA A . n A 1 90 GLY 90 1883 1883 GLY GLY A . n A 1 91 HIS 91 1884 1884 HIS HIS A . n A 1 92 ILE 92 1885 1885 ILE ILE A . n A 1 93 MET 93 1886 1886 MET MET A . n A 1 94 ARG 94 1887 1887 ARG ARG A . n A 1 95 ARG 95 1888 1888 ARG ARG A . n A 1 96 PHE 96 1889 1889 PHE PHE A . n A 1 97 PHE 97 1890 1890 PHE PHE A . n A 1 98 GLU 98 1891 1891 GLU GLU A . n A 1 99 SER 99 1892 1892 SER SER A . n A 1 100 ARG 100 1893 1893 ARG ARG A . n A 1 101 TRP 101 1894 1894 TRP TRP A . n A 1 102 GLU 102 1895 1895 GLU GLU A . n A 1 103 GLU 103 1896 1896 GLU GLU A . n A 1 104 PHE 104 1897 1897 PHE PHE A . n A 1 105 TYR 105 1898 1898 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UO1 1 1901 1 UO1 UO1 A . C 3 MG 1 1902 1 MG MG A . D 4 HOH 1 2001 88 HOH HOH A . D 4 HOH 2 2002 26 HOH HOH A . D 4 HOH 3 2003 108 HOH HOH A . D 4 HOH 4 2004 42 HOH HOH A . D 4 HOH 5 2005 98 HOH HOH A . D 4 HOH 6 2006 43 HOH HOH A . D 4 HOH 7 2007 61 HOH HOH A . D 4 HOH 8 2008 81 HOH HOH A . D 4 HOH 9 2009 99 HOH HOH A . D 4 HOH 10 2010 31 HOH HOH A . D 4 HOH 11 2011 2 HOH HOH A . D 4 HOH 12 2012 25 HOH HOH A . D 4 HOH 13 2013 17 HOH HOH A . D 4 HOH 14 2014 20 HOH HOH A . D 4 HOH 15 2015 79 HOH HOH A . D 4 HOH 16 2016 30 HOH HOH A . D 4 HOH 17 2017 15 HOH HOH A . D 4 HOH 18 2018 86 HOH HOH A . D 4 HOH 19 2019 77 HOH HOH A . D 4 HOH 20 2020 14 HOH HOH A . D 4 HOH 21 2021 27 HOH HOH A . D 4 HOH 22 2022 48 HOH HOH A . D 4 HOH 23 2023 75 HOH HOH A . D 4 HOH 24 2024 9 HOH HOH A . D 4 HOH 25 2025 24 HOH HOH A . D 4 HOH 26 2026 96 HOH HOH A . D 4 HOH 27 2027 76 HOH HOH A . D 4 HOH 28 2028 34 HOH HOH A . D 4 HOH 29 2029 29 HOH HOH A . D 4 HOH 30 2030 22 HOH HOH A . D 4 HOH 31 2031 84 HOH HOH A . D 4 HOH 32 2032 33 HOH HOH A . D 4 HOH 33 2033 11 HOH HOH A . D 4 HOH 34 2034 49 HOH HOH A . D 4 HOH 35 2035 91 HOH HOH A . D 4 HOH 36 2036 53 HOH HOH A . D 4 HOH 37 2037 8 HOH HOH A . D 4 HOH 38 2038 92 HOH HOH A . D 4 HOH 39 2039 56 HOH HOH A . D 4 HOH 40 2040 5 HOH HOH A . D 4 HOH 41 2041 90 HOH HOH A . D 4 HOH 42 2042 47 HOH HOH A . D 4 HOH 43 2043 16 HOH HOH A . D 4 HOH 44 2044 1 HOH HOH A . D 4 HOH 45 2045 44 HOH HOH A . D 4 HOH 46 2046 60 HOH HOH A . D 4 HOH 47 2047 71 HOH HOH A . D 4 HOH 48 2048 80 HOH HOH A . D 4 HOH 49 2049 73 HOH HOH A . D 4 HOH 50 2050 38 HOH HOH A . D 4 HOH 51 2051 12 HOH HOH A . D 4 HOH 52 2052 69 HOH HOH A . D 4 HOH 53 2053 55 HOH HOH A . D 4 HOH 54 2054 74 HOH HOH A . D 4 HOH 55 2055 66 HOH HOH A . D 4 HOH 56 2056 58 HOH HOH A . D 4 HOH 57 2057 6 HOH HOH A . D 4 HOH 58 2058 52 HOH HOH A . D 4 HOH 59 2059 7 HOH HOH A . D 4 HOH 60 2060 4 HOH HOH A . D 4 HOH 61 2061 94 HOH HOH A . D 4 HOH 62 2062 112 HOH HOH A . D 4 HOH 63 2063 23 HOH HOH A . D 4 HOH 64 2064 3 HOH HOH A . D 4 HOH 65 2065 18 HOH HOH A . D 4 HOH 66 2066 28 HOH HOH A . D 4 HOH 67 2067 21 HOH HOH A . D 4 HOH 68 2068 65 HOH HOH A . D 4 HOH 69 2069 68 HOH HOH A . D 4 HOH 70 2070 19 HOH HOH A . D 4 HOH 71 2071 13 HOH HOH A . D 4 HOH 72 2072 36 HOH HOH A . D 4 HOH 73 2073 37 HOH HOH A . D 4 HOH 74 2074 35 HOH HOH A . D 4 HOH 75 2075 97 HOH HOH A . D 4 HOH 76 2076 82 HOH HOH A . D 4 HOH 77 2077 10 HOH HOH A . D 4 HOH 78 2078 110 HOH HOH A . D 4 HOH 79 2079 32 HOH HOH A . D 4 HOH 80 2080 87 HOH HOH A . D 4 HOH 81 2081 54 HOH HOH A . D 4 HOH 82 2082 64 HOH HOH A . D 4 HOH 83 2083 57 HOH HOH A . D 4 HOH 84 2084 85 HOH HOH A . D 4 HOH 85 2085 103 HOH HOH A . D 4 HOH 86 2086 50 HOH HOH A . D 4 HOH 87 2087 114 HOH HOH A . D 4 HOH 88 2088 78 HOH HOH A . D 4 HOH 89 2089 105 HOH HOH A . D 4 HOH 90 2090 109 HOH HOH A . D 4 HOH 91 2091 83 HOH HOH A . D 4 HOH 92 2092 40 HOH HOH A . D 4 HOH 93 2093 72 HOH HOH A . D 4 HOH 94 2094 62 HOH HOH A . D 4 HOH 95 2095 113 HOH HOH A . D 4 HOH 96 2096 67 HOH HOH A . D 4 HOH 97 2097 111 HOH HOH A . D 4 HOH 98 2098 106 HOH HOH A . D 4 HOH 99 2099 46 HOH HOH A . D 4 HOH 100 2100 45 HOH HOH A . D 4 HOH 101 2101 101 HOH HOH A . D 4 HOH 102 2102 39 HOH HOH A . D 4 HOH 103 2103 102 HOH HOH A . D 4 HOH 104 2104 59 HOH HOH A . D 4 HOH 105 2105 51 HOH HOH A . D 4 HOH 106 2106 100 HOH HOH A . D 4 HOH 107 2107 93 HOH HOH A . D 4 HOH 108 2108 63 HOH HOH A . D 4 HOH 109 2109 70 HOH HOH A . D 4 HOH 110 2110 41 HOH HOH A . D 4 HOH 111 2111 89 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 2 ? 'data scaling' ? ? 'Phil Evans' ? 19/08/14 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.3.11 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6FGL _cell.details ? _cell.formula_units_Z ? _cell.length_a 95.184 _cell.length_a_esd ? _cell.length_b 95.184 _cell.length_b_esd ? _cell.length_c 33.127 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FGL _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FGL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.290 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG3350, 0.2 M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate 25.600 _reflns.entry_id 6FGL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 47.590 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10271 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.900 _reflns.pdbx_Rmerge_I_obs 0.179 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.188 _reflns.pdbx_Rpim_I_all 0.057 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 112162 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.160 ? ? ? ? ? ? 812 100.000 ? ? ? ? 1.060 ? ? ? ? ? ? ? ? 11.400 ? ? ? ? 1.109 0.325 ? 1 1 0.769 ? 8.910 47.590 ? ? ? ? ? ? 157 99.500 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 10.500 ? ? ? ? 0.050 0.016 ? 2 1 0.996 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 77.890 _refine.B_iso_mean 31.7915 _refine.B_iso_min 14.190 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FGL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 41.2160 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10255 _refine.ls_number_reflns_R_free 559 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7700 _refine.ls_percent_reflns_R_free 5.4500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1933 _refine.ls_R_factor_R_free 0.2239 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1914 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5MGJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.1300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 41.2160 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 989 _refine_hist.pdbx_number_residues_total 103 _refine_hist.pdbx_B_iso_mean_ligand 30.23 _refine_hist.pdbx_B_iso_mean_solvent 33.83 _refine_hist.pdbx_number_atoms_protein 853 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 908 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.806 ? 1228 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 120 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 161 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 2.368 ? 742 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1001 2.3115 2513 . 124 2389 100.0000 . . . 0.3023 0.0000 0.2514 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.3115 2.6459 2546 . 135 2411 100.0000 . . . 0.2655 0.0000 0.2301 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.6459 3.3333 2565 . 136 2429 100.0000 . . . 0.2341 0.0000 0.1954 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.3333 41.2238 2631 . 164 2467 100.0000 . . . 0.1910 0.0000 0.1605 . . . . . . 4 . . . # _struct.entry_id 6FGL _struct.title 'Crystal Structure of BAZ2A bromodomain in complex with acetylindole compound UZH47' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FGL _struct_keywords.text 'four helical bundle, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ2A_HUMAN _struct_ref.pdbx_db_accession Q9UIF9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNED DSEVGKAGHIMRRFFESRWEEFY ; _struct_ref.pdbx_align_begin 1796 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FGL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIF9 _struct_ref_seq.db_align_beg 1796 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1898 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1796 _struct_ref_seq.pdbx_auth_seq_align_end 1898 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FGL SER A 1 ? UNP Q9UIF9 ? ? 'expression tag' 1794 1 1 6FGL MET A 2 ? UNP Q9UIF9 ? ? 'expression tag' 1795 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 50 ? 1 MORE -2 ? 1 'SSA (A^2)' 6240 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 3 ? SER A 18 ? HIS A 1796 SER A 1811 1 ? 16 HELX_P HELX_P2 AA2 HIS A 19 ? TRP A 23 ? HIS A 1812 TRP A 1816 5 ? 5 HELX_P HELX_P3 AA3 GLY A 36 ? ILE A 41 ? GLY A 1829 ILE A 1834 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? ARG A 56 ? ASP A 1839 ARG A 1849 1 ? 11 HELX_P HELX_P5 AA5 SER A 61 ? ASN A 80 ? SER A 1854 ASN A 1873 1 ? 20 HELX_P HELX_P6 AA6 SER A 84 ? GLU A 103 ? SER A 1877 GLU A 1896 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2005 6_554 ? ? ? ? ? ? ? 2.382 ? ? metalc2 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2008 1_555 ? ? ? ? ? ? ? 2.391 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2046 6_554 ? ? ? ? ? ? ? 2.315 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2062 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2095 6_554 ? ? ? ? ? ? ? 2.380 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2097 1_555 ? ? ? ? ? ? ? 2.454 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 2005 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2008 ? 1_555 164.3 ? 2 O ? D HOH . ? A HOH 2005 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2046 ? 6_554 88.9 ? 3 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2046 ? 6_554 82.0 ? 4 O ? D HOH . ? A HOH 2005 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2062 ? 1_555 76.3 ? 5 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2062 ? 1_555 91.9 ? 6 O ? D HOH . ? A HOH 2046 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2062 ? 1_555 96.2 ? 7 O ? D HOH . ? A HOH 2005 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2095 ? 6_554 98.4 ? 8 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2095 ? 6_554 93.7 ? 9 O ? D HOH . ? A HOH 2046 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2095 ? 6_554 85.4 ? 10 O ? D HOH . ? A HOH 2062 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2095 ? 6_554 174.4 ? 11 O ? D HOH . ? A HOH 2005 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2097 ? 1_555 94.8 ? 12 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2097 ? 1_555 92.3 ? 13 O ? D HOH . ? A HOH 2046 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2097 ? 1_555 170.4 ? 14 O ? D HOH . ? A HOH 2062 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2097 ? 1_555 76.1 ? 15 O ? D HOH . ? A HOH 2095 ? 6_554 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2097 ? 1_555 102.8 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A UO1 1901 ? 10 'binding site for residue UO1 A 1901' AC2 Software A MG 1902 ? 6 'binding site for residue MG A 1902' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 TRP A 23 ? TRP A 1816 . ? 1_555 ? 2 AC1 10 PRO A 24 ? PRO A 1817 . ? 1_555 ? 3 AC1 10 GLU A 27 ? GLU A 1820 . ? 1_555 ? 4 AC1 10 PRO A 28 ? PRO A 1821 . ? 1_555 ? 5 AC1 10 VAL A 29 ? VAL A 1822 . ? 1_555 ? 6 AC1 10 ASN A 30 ? ASN A 1823 . ? 1_555 ? 7 AC1 10 LEU A 33 ? LEU A 1826 . ? 1_555 ? 8 AC1 10 ASN A 80 ? ASN A 1873 . ? 1_555 ? 9 AC1 10 HOH D . ? HOH A 2024 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 2035 . ? 1_555 ? 11 AC2 6 HOH D . ? HOH A 2005 . ? 6_554 ? 12 AC2 6 HOH D . ? HOH A 2008 . ? 1_555 ? 13 AC2 6 HOH D . ? HOH A 2046 . ? 6_554 ? 14 AC2 6 HOH D . ? HOH A 2062 . ? 1_555 ? 15 AC2 6 HOH D . ? HOH A 2095 . ? 6_554 ? 16 AC2 6 HOH D . ? HOH A 2097 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 1896 ? ? -62.67 0.37 2 1 PHE A 1897 ? ? -124.34 -51.06 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2058 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1794 ? A SER 1 2 1 Y 1 A MET 1795 ? A MET 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 UO1 C01 C N N 373 UO1 C02 C N N 374 UO1 O03 O N N 375 UO1 N04 N Y N 376 UO1 C05 C Y N 377 UO1 C06 C Y N 378 UO1 N07 N N N 379 UO1 C08 C N N 380 UO1 C09 C N N 381 UO1 O10 O N N 382 UO1 C11 C Y N 383 UO1 C12 C Y N 384 UO1 C13 C N N 385 UO1 C14 C Y N 386 UO1 C15 C Y N 387 UO1 C16 C Y N 388 UO1 C17 C Y N 389 UO1 O18 O N N 390 UO1 C19 C Y N 391 UO1 C20 C Y N 392 UO1 C21 C Y N 393 UO1 C22 C Y N 394 UO1 C23 C Y N 395 UO1 C24 C Y N 396 UO1 H1 H N N 397 UO1 H2 H N N 398 UO1 H3 H N N 399 UO1 H4 H N N 400 UO1 H5 H N N 401 UO1 H6 H N N 402 UO1 H7 H N N 403 UO1 H8 H N N 404 UO1 H9 H N N 405 UO1 H10 H N N 406 UO1 H11 H N N 407 UO1 H12 H N N 408 UO1 H13 H N N 409 UO1 H14 H N N 410 UO1 H15 H N N 411 UO1 H16 H N N 412 UO1 H17 H N N 413 UO1 H18 H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 UO1 C09 C08 sing N N 358 UO1 O10 C08 doub N N 359 UO1 C08 N07 sing N N 360 UO1 C13 C12 sing N N 361 UO1 N07 C11 sing N N 362 UO1 N07 C06 sing N N 363 UO1 C12 C14 doub Y N 364 UO1 C12 C11 sing Y N 365 UO1 C14 C15 sing Y N 366 UO1 C11 C17 doub Y N 367 UO1 C06 C05 doub Y N 368 UO1 C06 C19 sing Y N 369 UO1 C05 N04 sing Y N 370 UO1 C19 C24 doub Y N 371 UO1 C19 C20 sing Y N 372 UO1 C24 C23 sing Y N 373 UO1 N04 C20 sing Y N 374 UO1 N04 C02 sing N N 375 UO1 C15 C16 doub Y N 376 UO1 C17 C16 sing Y N 377 UO1 C01 C02 sing N N 378 UO1 C20 C21 doub Y N 379 UO1 C23 C22 doub Y N 380 UO1 C02 O03 doub N N 381 UO1 C16 O18 sing N N 382 UO1 C21 C22 sing Y N 383 UO1 C01 H1 sing N N 384 UO1 C01 H2 sing N N 385 UO1 C01 H3 sing N N 386 UO1 C05 H4 sing N N 387 UO1 C09 H5 sing N N 388 UO1 C09 H6 sing N N 389 UO1 C09 H7 sing N N 390 UO1 C13 H8 sing N N 391 UO1 C13 H9 sing N N 392 UO1 C13 H10 sing N N 393 UO1 C14 H11 sing N N 394 UO1 C15 H12 sing N N 395 UO1 C17 H13 sing N N 396 UO1 O18 H14 sing N N 397 UO1 C21 H15 sing N N 398 UO1 C22 H16 sing N N 399 UO1 C23 H17 sing N N 400 UO1 C24 H18 sing N N 401 VAL N CA sing N N 402 VAL N H sing N N 403 VAL N H2 sing N N 404 VAL CA C sing N N 405 VAL CA CB sing N N 406 VAL CA HA sing N N 407 VAL C O doub N N 408 VAL C OXT sing N N 409 VAL CB CG1 sing N N 410 VAL CB CG2 sing N N 411 VAL CB HB sing N N 412 VAL CG1 HG11 sing N N 413 VAL CG1 HG12 sing N N 414 VAL CG1 HG13 sing N N 415 VAL CG2 HG21 sing N N 416 VAL CG2 HG22 sing N N 417 VAL CG2 HG23 sing N N 418 VAL OXT HXT sing N N 419 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 31003A_169007 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5MGJ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6FGL _atom_sites.fract_transf_matrix[1][1] 0.010506 _atom_sites.fract_transf_matrix[1][2] 0.006066 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012131 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030187 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N O S # loop_ #