data_6FK6 # _entry.id 6FK6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6FK6 WWPDB D_1200008386 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FK6 _pdbx_database_status.recvd_initial_deposition_date 2018-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mattle, D.' 1 ? 'Standfuss, J.' 2 ? 'Dawson, R.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first 3640 _citation.page_last 3645 _citation.title 'Ligand channel in pharmacologically stabilized rhodopsin.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1718084115 _citation.pdbx_database_id_PubMed 29555765 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mattle, D.' 1 ? primary 'Kuhn, B.' 2 ? primary 'Aebi, J.' 3 ? primary 'Bedoucha, M.' 4 ? primary 'Kekilli, D.' 5 ? primary 'Grozinger, N.' 6 ? primary 'Alker, A.' 7 ? primary 'Rudolph, M.G.' 8 ? primary 'Schmid, G.' 9 ? primary 'Schertler, G.F.X.' 10 ? primary 'Hennig, M.' 11 ? primary 'Standfuss, J.' 12 ? primary 'Dawson, R.J.P.' 13 ? # _cell.entry_id 6FK6 _cell.length_a 244.209 _cell.length_b 244.209 _cell.length_c 111.752 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FK6 _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Rhodopsin 36847.301 1 ? ? ? ? 2 branched man ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; 910.823 1 ? ? ? ? 3 non-polymer syn 'PALMITIC ACID' 256.424 1 ? ? ? ? 4 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 4 ? ? ? ? 5 non-polymer syn "(2~{S})-2-(4-chlorophenyl)-3-methyl-1-spiro[1,3-benzodioxole-2,4'-piperidine]-1'-yl-butan-1-one" 385.884 1 ? ? ? ? 6 water nat water 18.015 79 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)MCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYI LLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIM GVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAA QQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRN CMVTTLCCGKN ; _entity_poly.pdbx_seq_one_letter_code_can ;XMCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNL AVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAF TWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQE SATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVT TLCCGKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 MET n 1 3 CYS n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 GLY n 1 8 PRO n 1 9 ASN n 1 10 PHE n 1 11 TYR n 1 12 VAL n 1 13 PRO n 1 14 PHE n 1 15 SER n 1 16 ASN n 1 17 LYS n 1 18 THR n 1 19 GLY n 1 20 VAL n 1 21 VAL n 1 22 ARG n 1 23 SER n 1 24 PRO n 1 25 PHE n 1 26 GLU n 1 27 ALA n 1 28 PRO n 1 29 GLN n 1 30 TYR n 1 31 TYR n 1 32 LEU n 1 33 ALA n 1 34 GLU n 1 35 PRO n 1 36 TRP n 1 37 GLN n 1 38 PHE n 1 39 SER n 1 40 MET n 1 41 LEU n 1 42 ALA n 1 43 ALA n 1 44 TYR n 1 45 MET n 1 46 PHE n 1 47 LEU n 1 48 LEU n 1 49 ILE n 1 50 MET n 1 51 LEU n 1 52 GLY n 1 53 PHE n 1 54 PRO n 1 55 ILE n 1 56 ASN n 1 57 PHE n 1 58 LEU n 1 59 THR n 1 60 LEU n 1 61 TYR n 1 62 VAL n 1 63 THR n 1 64 VAL n 1 65 GLN n 1 66 HIS n 1 67 LYS n 1 68 LYS n 1 69 LEU n 1 70 ARG n 1 71 THR n 1 72 PRO n 1 73 LEU n 1 74 ASN n 1 75 TYR n 1 76 ILE n 1 77 LEU n 1 78 LEU n 1 79 ASN n 1 80 LEU n 1 81 ALA n 1 82 VAL n 1 83 ALA n 1 84 ASP n 1 85 LEU n 1 86 PHE n 1 87 MET n 1 88 VAL n 1 89 PHE n 1 90 GLY n 1 91 GLY n 1 92 PHE n 1 93 THR n 1 94 THR n 1 95 THR n 1 96 LEU n 1 97 TYR n 1 98 THR n 1 99 SER n 1 100 LEU n 1 101 HIS n 1 102 GLY n 1 103 TYR n 1 104 PHE n 1 105 VAL n 1 106 PHE n 1 107 GLY n 1 108 PRO n 1 109 THR n 1 110 GLY n 1 111 CYS n 1 112 ASN n 1 113 LEU n 1 114 GLU n 1 115 GLY n 1 116 PHE n 1 117 PHE n 1 118 ALA n 1 119 THR n 1 120 LEU n 1 121 GLY n 1 122 GLY n 1 123 GLU n 1 124 ILE n 1 125 ALA n 1 126 LEU n 1 127 TRP n 1 128 SER n 1 129 LEU n 1 130 VAL n 1 131 VAL n 1 132 LEU n 1 133 ALA n 1 134 ILE n 1 135 GLU n 1 136 ARG n 1 137 TYR n 1 138 VAL n 1 139 VAL n 1 140 VAL n 1 141 CYS n 1 142 LYS n 1 143 PRO n 1 144 MET n 1 145 SER n 1 146 ASN n 1 147 PHE n 1 148 ARG n 1 149 PHE n 1 150 GLY n 1 151 GLU n 1 152 ASN n 1 153 HIS n 1 154 ALA n 1 155 ILE n 1 156 MET n 1 157 GLY n 1 158 VAL n 1 159 ALA n 1 160 PHE n 1 161 THR n 1 162 TRP n 1 163 VAL n 1 164 MET n 1 165 ALA n 1 166 LEU n 1 167 ALA n 1 168 CYS n 1 169 ALA n 1 170 ALA n 1 171 PRO n 1 172 PRO n 1 173 LEU n 1 174 VAL n 1 175 GLY n 1 176 TRP n 1 177 SER n 1 178 ARG n 1 179 TYR n 1 180 ILE n 1 181 PRO n 1 182 GLU n 1 183 GLY n 1 184 MET n 1 185 GLN n 1 186 CYS n 1 187 SER n 1 188 CYS n 1 189 GLY n 1 190 ILE n 1 191 ASP n 1 192 TYR n 1 193 TYR n 1 194 THR n 1 195 PRO n 1 196 HIS n 1 197 GLU n 1 198 GLU n 1 199 THR n 1 200 ASN n 1 201 ASN n 1 202 GLU n 1 203 SER n 1 204 PHE n 1 205 VAL n 1 206 ILE n 1 207 TYR n 1 208 MET n 1 209 PHE n 1 210 VAL n 1 211 VAL n 1 212 HIS n 1 213 PHE n 1 214 ILE n 1 215 ILE n 1 216 PRO n 1 217 LEU n 1 218 ILE n 1 219 VAL n 1 220 ILE n 1 221 PHE n 1 222 PHE n 1 223 CYS n 1 224 TYR n 1 225 GLY n 1 226 GLN n 1 227 LEU n 1 228 VAL n 1 229 PHE n 1 230 THR n 1 231 VAL n 1 232 LYS n 1 233 GLU n 1 234 ALA n 1 235 ALA n 1 236 ALA n 1 237 GLN n 1 238 GLN n 1 239 GLN n 1 240 GLU n 1 241 SER n 1 242 ALA n 1 243 THR n 1 244 THR n 1 245 GLN n 1 246 LYS n 1 247 ALA n 1 248 GLU n 1 249 LYS n 1 250 GLU n 1 251 VAL n 1 252 THR n 1 253 ARG n 1 254 MET n 1 255 VAL n 1 256 ILE n 1 257 ILE n 1 258 MET n 1 259 VAL n 1 260 ILE n 1 261 ALA n 1 262 PHE n 1 263 LEU n 1 264 ILE n 1 265 CYS n 1 266 TRP n 1 267 LEU n 1 268 PRO n 1 269 TYR n 1 270 ALA n 1 271 GLY n 1 272 VAL n 1 273 ALA n 1 274 PHE n 1 275 TYR n 1 276 ILE n 1 277 PHE n 1 278 THR n 1 279 HIS n 1 280 GLN n 1 281 GLY n 1 282 SER n 1 283 CYS n 1 284 PHE n 1 285 GLY n 1 286 PRO n 1 287 ILE n 1 288 PHE n 1 289 MET n 1 290 THR n 1 291 ILE n 1 292 PRO n 1 293 ALA n 1 294 PHE n 1 295 PHE n 1 296 ALA n 1 297 LYS n 1 298 THR n 1 299 SER n 1 300 ALA n 1 301 VAL n 1 302 TYR n 1 303 ASN n 1 304 PRO n 1 305 VAL n 1 306 ILE n 1 307 TYR n 1 308 ILE n 1 309 MET n 1 310 MET n 1 311 ASN n 1 312 LYS n 1 313 GLN n 1 314 PHE n 1 315 ARG n 1 316 ASN n 1 317 CYS n 1 318 MET n 1 319 VAL n 1 320 THR n 1 321 THR n 1 322 LEU n 1 323 CYS n 1 324 CYS n 1 325 GLY n 1 326 LYS n 1 327 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 327 _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RHO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'HEK293S GNTI-' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OPSD_BOVIN _struct_ref.pdbx_db_accession P02699 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLA VADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFT WVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTT LCCGKN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FK6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02699 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 326 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 326 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FK6 ACE A 1 ? UNP P02699 ? ? acetylation 0 1 1 6FK6 CYS A 3 ? UNP P02699 ASN 2 conflict 2 2 1 6FK6 CYS A 283 ? UNP P02699 ASP 282 conflict 282 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose ? 'C6 H12 O6' 180.156 BOG D-saccharide n 'octyl beta-D-glucopyranoside' ? 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOK non-polymer . "(2~{S})-2-(4-chlorophenyl)-3-methyl-1-spiro[1,3-benzodioxole-2,4'-piperidine]-1'-yl-butan-1-one" ? 'C22 H24 Cl N O3' 385.884 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FK6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'AMMONIUM SULPHATE, SODIUM ACETATE, D(+)-TREHALOSE, PH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000020 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000020 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 6FK6 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 47.790 _reflns.d_resolution_high 2.360 _reflns.number_obs 52217 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.11400 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.3900 _reflns.B_iso_Wilson_estimate 64.38 _reflns.pdbx_redundancy 11.43 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.36 _reflns_shell.d_res_low 2.42 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 5.37000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 0.550 _reflns_shell.pdbx_redundancy ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 6FK6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 52046 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.79 _refine.ls_d_res_high 2.36 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.216 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.216 _refine.ls_R_factor_R_free 0.226 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.120 _refine.ls_number_reflns_R_free 2664 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 86.27 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'INHOUSE MODEL' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.340 _refine.pdbx_overall_phase_error 30.410 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2591 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 185 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 2855 _refine_hist.d_res_high 2.36 _refine_hist.d_res_low 47.79 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 2882 'X-RAY DIFFRACTION' ? f_angle_d 0.772 ? ? 3927 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.055 ? ? 1686 'X-RAY DIFFRACTION' ? f_chiral_restr 0.042 ? ? 454 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 461 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.3600 2.4030 2552 0.4100 98.00 0.4190 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.4030 2.4492 2553 0.4026 99.00 0.4458 . . 148 . . . . 'X-RAY DIFFRACTION' . 2.4492 2.4992 2562 0.3734 99.00 0.3792 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.4992 2.5535 2583 0.3336 99.00 0.3853 . . 132 . . . . 'X-RAY DIFFRACTION' . 2.5535 2.6129 2574 0.3228 100.00 0.3138 . . 150 . . . . 'X-RAY DIFFRACTION' . 2.6129 2.6782 2606 0.2980 100.00 0.3144 . . 124 . . . . 'X-RAY DIFFRACTION' . 2.6782 2.7506 2591 0.2990 100.00 0.3168 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.7506 2.8316 2551 0.2667 100.00 0.3361 . . 150 . . . . 'X-RAY DIFFRACTION' . 2.8316 2.9230 2599 0.2464 100.00 0.2607 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.9230 3.0274 2609 0.2336 100.00 0.2508 . . 135 . . . . 'X-RAY DIFFRACTION' . 3.0274 3.1486 2611 0.2264 100.00 0.2245 . . 114 . . . . 'X-RAY DIFFRACTION' . 3.1486 3.2919 2622 0.2181 100.00 0.2156 . . 134 . . . . 'X-RAY DIFFRACTION' . 3.2919 3.4654 2611 0.2070 100.00 0.2206 . . 140 . . . . 'X-RAY DIFFRACTION' . 3.4654 3.6824 2583 0.1919 100.00 0.2101 . . 147 . . . . 'X-RAY DIFFRACTION' . 3.6824 3.9666 2607 0.1901 100.00 0.1908 . . 147 . . . . 'X-RAY DIFFRACTION' . 3.9666 4.3655 2625 0.1783 100.00 0.2142 . . 141 . . . . 'X-RAY DIFFRACTION' . 4.3655 4.9967 2628 0.1789 100.00 0.1823 . . 146 . . . . 'X-RAY DIFFRACTION' . 4.9967 6.2930 2637 0.2011 100.00 0.2352 . . 137 . . . . 'X-RAY DIFFRACTION' . 6.2930 47.8032 2678 0.2154 100.00 0.2011 . . 170 . . . . # _struct.entry_id 6FK6 _struct.title 'Crystal structure of N2C/D282C stabilized opsin bound to RS01' _struct.pdbx_descriptor Rhodopsin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FK6 _struct_keywords.text ;RHODOPSIN, G PROTEIN-COUPLED RECEPTORS, RETINITIS PIGMENTOSA, SIGNALING PROTEIN, SENSORY TRANSDUCTION, PHOTORECEPTOR PROTEIN, KINTEGRAL MEMBRANE PROTEIN, VISION, MEMBRANE, RECEPTOR, TRANSDUCER PHOTORECEPTOR, SMALL MOLECULE COMPLEX, MEMBRANE PROTEIN ; _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? I N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 34 ? HIS A 66 ? GLU A 33 HIS A 65 1 ? 33 HELX_P HELX_P2 AA2 LYS A 67 ? ARG A 70 ? LYS A 66 ARG A 69 5 ? 4 HELX_P HELX_P3 AA3 THR A 71 ? LEU A 73 ? THR A 70 LEU A 72 5 ? 3 HELX_P HELX_P4 AA4 ASN A 74 ? GLY A 91 ? ASN A 73 GLY A 90 1 ? 18 HELX_P HELX_P5 AA5 GLY A 91 ? LEU A 100 ? GLY A 90 LEU A 99 1 ? 10 HELX_P HELX_P6 AA6 PHE A 106 ? LYS A 142 ? PHE A 105 LYS A 141 1 ? 37 HELX_P HELX_P7 AA7 GLY A 150 ? ALA A 170 ? GLY A 149 ALA A 169 1 ? 21 HELX_P HELX_P8 AA8 PRO A 171 ? VAL A 174 ? PRO A 170 VAL A 173 5 ? 4 HELX_P HELX_P9 AA9 HIS A 196 ? THR A 199 ? HIS A 195 THR A 198 5 ? 4 HELX_P HELX_P10 AB1 ASN A 200 ? HIS A 212 ? ASN A 199 HIS A 211 1 ? 13 HELX_P HELX_P11 AB2 PHE A 213 ? GLN A 237 ? PHE A 212 GLN A 236 1 ? 25 HELX_P HELX_P12 AB3 SER A 241 ? HIS A 279 ? SER A 240 HIS A 278 1 ? 39 HELX_P HELX_P13 AB4 ILE A 287 ? MET A 289 ? ILE A 286 MET A 288 5 ? 3 HELX_P HELX_P14 AB5 THR A 290 ? LYS A 297 ? THR A 289 LYS A 296 1 ? 8 HELX_P HELX_P15 AB6 THR A 298 ? ILE A 308 ? THR A 297 ILE A 307 1 ? 11 HELX_P HELX_P16 AB7 ASN A 311 ? CYS A 323 ? ASN A 310 CYS A 322 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 283 SG ? ? A CYS 2 A CYS 282 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 110 A CYS 187 1_555 ? ? ? ? ? ? ? 2.050 ? ? covale1 covale both ? A ACE 1 C ? ? ? 1_555 A MET 2 N ? ? A ACE 0 A MET 1 1_555 ? ? ? ? ? ? ? 1.347 ? ? covale2 covale one ? A ASN 16 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 15 B NAG 1 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation covale3 covale one ? A CYS 323 SG ? ? ? 1_555 C PLM . C1 ? ? A CYS 322 A PLM 401 1_555 ? ? ? ? ? ? ? 1.738 ? ? covale4 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.438 ? ? covale5 covale both ? B NAG . O4 ? ? ? 1_555 B BMA . C1 ? ? B NAG 2 B BMA 3 1_555 ? ? ? ? ? ? ? 1.452 ? ? covale6 covale one ? B BMA . O3 ? ? ? 1_555 B MAN . C1 ? ? B BMA 3 B MAN 4 1_555 ? ? ? ? ? ? ? 1.468 ? ? covale7 covale one ? B BMA . O6 ? ? ? 1_555 B MAN . C1 ? ? B BMA 3 B MAN 5 1_555 ? ? ? ? ? ? ? 1.438 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? GLY A 7 ? THR A 4 GLY A 6 AA1 2 PHE A 10 ? VAL A 12 ? PHE A 9 VAL A 11 AA2 1 TYR A 179 ? GLU A 182 ? TYR A 178 GLU A 181 AA2 2 SER A 187 ? ILE A 190 ? SER A 186 ILE A 189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 5 ? N THR A 4 O VAL A 12 ? O VAL A 11 AA2 1 2 N GLU A 182 ? N GLU A 181 O SER A 187 ? O SER A 186 # _atom_sites.entry_id 6FK6 _atom_sites.fract_transf_matrix[1][1] 0.004095 _atom_sites.fract_transf_matrix[1][2] 0.002364 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004728 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008948 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 CYS 3 2 2 CYS CYS A . n A 1 4 GLY 4 3 3 GLY GLY A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 PRO 8 7 7 PRO PRO A . n A 1 9 ASN 9 8 8 ASN ASN A . n A 1 10 PHE 10 9 9 PHE PHE A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 PHE 14 13 13 PHE PHE A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 ASN 16 15 15 ASN ASN A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 THR 18 17 17 THR THR A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 ARG 22 21 21 ARG ARG A . n A 1 23 SER 23 22 22 SER SER A . n A 1 24 PRO 24 23 23 PRO PRO A . n A 1 25 PHE 25 24 24 PHE PHE A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 TYR 31 30 30 TYR TYR A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 TRP 36 35 35 TRP TRP A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 MET 40 39 39 MET MET A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 ALA 43 42 42 ALA ALA A . n A 1 44 TYR 44 43 43 TYR TYR A . n A 1 45 MET 45 44 44 MET MET A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 ILE 49 48 48 ILE ILE A . n A 1 50 MET 50 49 49 MET MET A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 PRO 54 53 53 PRO PRO A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 ASN 56 55 55 ASN ASN A . n A 1 57 PHE 57 56 56 PHE PHE A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 TYR 61 60 60 TYR TYR A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 GLN 65 64 64 GLN GLN A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 LYS 67 66 66 LYS LYS A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 ASN 74 73 73 ASN ASN A . n A 1 75 TYR 75 74 74 TYR TYR A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 ASN 79 78 78 ASN ASN A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 ALA 83 82 82 ALA ALA A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 PHE 86 85 85 PHE PHE A . n A 1 87 MET 87 86 86 MET MET A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLY 90 89 89 GLY GLY A . n A 1 91 GLY 91 90 90 GLY GLY A . n A 1 92 PHE 92 91 91 PHE PHE A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 THR 95 94 94 THR THR A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 TYR 97 96 96 TYR TYR A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 HIS 101 100 100 HIS HIS A . n A 1 102 GLY 102 101 101 GLY GLY A . n A 1 103 TYR 103 102 102 TYR TYR A . n A 1 104 PHE 104 103 103 PHE PHE A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 GLY 107 106 106 GLY GLY A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 THR 109 108 108 THR THR A . n A 1 110 GLY 110 109 109 GLY GLY A . n A 1 111 CYS 111 110 110 CYS CYS A . n A 1 112 ASN 112 111 111 ASN ASN A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 GLY 115 114 114 GLY GLY A . n A 1 116 PHE 116 115 115 PHE PHE A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 ALA 118 117 117 ALA ALA A . n A 1 119 THR 119 118 118 THR THR A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 GLY 121 120 120 GLY GLY A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 GLU 123 122 122 GLU GLU A . n A 1 124 ILE 124 123 123 ILE ILE A . n A 1 125 ALA 125 124 124 ALA ALA A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 TRP 127 126 126 TRP TRP A . n A 1 128 SER 128 127 127 SER SER A . n A 1 129 LEU 129 128 128 LEU LEU A . n A 1 130 VAL 130 129 129 VAL VAL A . n A 1 131 VAL 131 130 130 VAL VAL A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 TYR 137 136 136 TYR TYR A . n A 1 138 VAL 138 137 137 VAL VAL A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 VAL 140 139 139 VAL VAL A . n A 1 141 CYS 141 140 140 CYS CYS A . n A 1 142 LYS 142 141 141 LYS LYS A . n A 1 143 PRO 143 142 142 PRO PRO A . n A 1 144 MET 144 143 143 MET MET A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 ASN 146 145 145 ASN ASN A . n A 1 147 PHE 147 146 146 PHE PHE A . n A 1 148 ARG 148 147 147 ARG ARG A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 GLU 151 150 150 GLU GLU A . n A 1 152 ASN 152 151 151 ASN ASN A . n A 1 153 HIS 153 152 152 HIS HIS A . n A 1 154 ALA 154 153 153 ALA ALA A . n A 1 155 ILE 155 154 154 ILE ILE A . n A 1 156 MET 156 155 155 MET MET A . n A 1 157 GLY 157 156 156 GLY GLY A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 ALA 159 158 158 ALA ALA A . n A 1 160 PHE 160 159 159 PHE PHE A . n A 1 161 THR 161 160 160 THR THR A . n A 1 162 TRP 162 161 161 TRP TRP A . n A 1 163 VAL 163 162 162 VAL VAL A . n A 1 164 MET 164 163 163 MET MET A . n A 1 165 ALA 165 164 164 ALA ALA A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 CYS 168 167 167 CYS CYS A . n A 1 169 ALA 169 168 168 ALA ALA A . n A 1 170 ALA 170 169 169 ALA ALA A . n A 1 171 PRO 171 170 170 PRO PRO A . n A 1 172 PRO 172 171 171 PRO PRO A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 VAL 174 173 173 VAL VAL A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 TRP 176 175 175 TRP TRP A . n A 1 177 SER 177 176 176 SER SER A . n A 1 178 ARG 178 177 177 ARG ARG A . n A 1 179 TYR 179 178 178 TYR TYR A . n A 1 180 ILE 180 179 179 ILE ILE A . n A 1 181 PRO 181 180 180 PRO PRO A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 MET 184 183 183 MET MET A . n A 1 185 GLN 185 184 184 GLN GLN A . n A 1 186 CYS 186 185 185 CYS CYS A . n A 1 187 SER 187 186 186 SER SER A . n A 1 188 CYS 188 187 187 CYS CYS A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 ILE 190 189 189 ILE ILE A . n A 1 191 ASP 191 190 190 ASP ASP A . n A 1 192 TYR 192 191 191 TYR TYR A . n A 1 193 TYR 193 192 192 TYR TYR A . n A 1 194 THR 194 193 193 THR THR A . n A 1 195 PRO 195 194 194 PRO PRO A . n A 1 196 HIS 196 195 195 HIS HIS A . n A 1 197 GLU 197 196 196 GLU GLU A . n A 1 198 GLU 198 197 197 GLU GLU A . n A 1 199 THR 199 198 198 THR THR A . n A 1 200 ASN 200 199 199 ASN ASN A . n A 1 201 ASN 201 200 200 ASN ASN A . n A 1 202 GLU 202 201 201 GLU GLU A . n A 1 203 SER 203 202 202 SER SER A . n A 1 204 PHE 204 203 203 PHE PHE A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 ILE 206 205 205 ILE ILE A . n A 1 207 TYR 207 206 206 TYR TYR A . n A 1 208 MET 208 207 207 MET MET A . n A 1 209 PHE 209 208 208 PHE PHE A . n A 1 210 VAL 210 209 209 VAL VAL A . n A 1 211 VAL 211 210 210 VAL VAL A . n A 1 212 HIS 212 211 211 HIS HIS A . n A 1 213 PHE 213 212 212 PHE PHE A . n A 1 214 ILE 214 213 213 ILE ILE A . n A 1 215 ILE 215 214 214 ILE ILE A . n A 1 216 PRO 216 215 215 PRO PRO A . n A 1 217 LEU 217 216 216 LEU LEU A . n A 1 218 ILE 218 217 217 ILE ILE A . n A 1 219 VAL 219 218 218 VAL VAL A . n A 1 220 ILE 220 219 219 ILE ILE A . n A 1 221 PHE 221 220 220 PHE PHE A . n A 1 222 PHE 222 221 221 PHE PHE A . n A 1 223 CYS 223 222 222 CYS CYS A . n A 1 224 TYR 224 223 223 TYR TYR A . n A 1 225 GLY 225 224 224 GLY GLY A . n A 1 226 GLN 226 225 225 GLN GLN A . n A 1 227 LEU 227 226 226 LEU LEU A . n A 1 228 VAL 228 227 227 VAL VAL A . n A 1 229 PHE 229 228 228 PHE PHE A . n A 1 230 THR 230 229 229 THR THR A . n A 1 231 VAL 231 230 230 VAL VAL A . n A 1 232 LYS 232 231 231 LYS LYS A . n A 1 233 GLU 233 232 232 GLU GLU A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 ALA 235 234 234 ALA ALA A . n A 1 236 ALA 236 235 235 ALA ALA A . n A 1 237 GLN 237 236 236 GLN GLN A . n A 1 238 GLN 238 237 237 GLN GLN A . n A 1 239 GLN 239 238 238 GLN GLN A . n A 1 240 GLU 240 239 239 GLU GLU A . n A 1 241 SER 241 240 240 SER SER A . n A 1 242 ALA 242 241 241 ALA ALA A . n A 1 243 THR 243 242 242 THR THR A . n A 1 244 THR 244 243 243 THR THR A . n A 1 245 GLN 245 244 244 GLN GLN A . n A 1 246 LYS 246 245 245 LYS LYS A . n A 1 247 ALA 247 246 246 ALA ALA A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 LYS 249 248 248 LYS LYS A . n A 1 250 GLU 250 249 249 GLU GLU A . n A 1 251 VAL 251 250 250 VAL VAL A . n A 1 252 THR 252 251 251 THR THR A . n A 1 253 ARG 253 252 252 ARG ARG A . n A 1 254 MET 254 253 253 MET MET A . n A 1 255 VAL 255 254 254 VAL VAL A . n A 1 256 ILE 256 255 255 ILE ILE A . n A 1 257 ILE 257 256 256 ILE ILE A . n A 1 258 MET 258 257 257 MET MET A . n A 1 259 VAL 259 258 258 VAL VAL A . n A 1 260 ILE 260 259 259 ILE ILE A . n A 1 261 ALA 261 260 260 ALA ALA A . n A 1 262 PHE 262 261 261 PHE PHE A . n A 1 263 LEU 263 262 262 LEU LEU A . n A 1 264 ILE 264 263 263 ILE ILE A . n A 1 265 CYS 265 264 264 CYS CYS A . n A 1 266 TRP 266 265 265 TRP TRP A . n A 1 267 LEU 267 266 266 LEU LEU A . n A 1 268 PRO 268 267 267 PRO PRO A . n A 1 269 TYR 269 268 268 TYR TYR A . n A 1 270 ALA 270 269 269 ALA ALA A . n A 1 271 GLY 271 270 270 GLY GLY A . n A 1 272 VAL 272 271 271 VAL VAL A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 PHE 274 273 273 PHE PHE A . n A 1 275 TYR 275 274 274 TYR TYR A . n A 1 276 ILE 276 275 275 ILE ILE A . n A 1 277 PHE 277 276 276 PHE PHE A . n A 1 278 THR 278 277 277 THR THR A . n A 1 279 HIS 279 278 278 HIS HIS A . n A 1 280 GLN 280 279 279 GLN GLN A . n A 1 281 GLY 281 280 280 GLY GLY A . n A 1 282 SER 282 281 281 SER SER A . n A 1 283 CYS 283 282 282 CYS CYS A . n A 1 284 PHE 284 283 283 PHE PHE A . n A 1 285 GLY 285 284 284 GLY GLY A . n A 1 286 PRO 286 285 285 PRO PRO A . n A 1 287 ILE 287 286 286 ILE ILE A . n A 1 288 PHE 288 287 287 PHE PHE A . n A 1 289 MET 289 288 288 MET MET A . n A 1 290 THR 290 289 289 THR THR A . n A 1 291 ILE 291 290 290 ILE ILE A . n A 1 292 PRO 292 291 291 PRO PRO A . n A 1 293 ALA 293 292 292 ALA ALA A . n A 1 294 PHE 294 293 293 PHE PHE A . n A 1 295 PHE 295 294 294 PHE PHE A . n A 1 296 ALA 296 295 295 ALA ALA A . n A 1 297 LYS 297 296 296 LYS LYS A . n A 1 298 THR 298 297 297 THR THR A . n A 1 299 SER 299 298 298 SER SER A . n A 1 300 ALA 300 299 299 ALA ALA A . n A 1 301 VAL 301 300 300 VAL VAL A . n A 1 302 TYR 302 301 301 TYR TYR A . n A 1 303 ASN 303 302 302 ASN ASN A . n A 1 304 PRO 304 303 303 PRO PRO A . n A 1 305 VAL 305 304 304 VAL VAL A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 TYR 307 306 306 TYR TYR A . n A 1 308 ILE 308 307 307 ILE ILE A . n A 1 309 MET 309 308 308 MET MET A . n A 1 310 MET 310 309 309 MET MET A . n A 1 311 ASN 311 310 310 ASN ASN A . n A 1 312 LYS 312 311 311 LYS LYS A . n A 1 313 GLN 313 312 312 GLN GLN A . n A 1 314 PHE 314 313 313 PHE PHE A . n A 1 315 ARG 315 314 314 ARG ARG A . n A 1 316 ASN 316 315 315 ASN ASN A . n A 1 317 CYS 317 316 316 CYS CYS A . n A 1 318 MET 318 317 317 MET MET A . n A 1 319 VAL 319 318 318 VAL VAL A . n A 1 320 THR 320 319 319 THR THR A . n A 1 321 THR 321 320 320 THR THR A . n A 1 322 LEU 322 321 321 LEU LEU A . n A 1 323 CYS 323 322 322 CYS CYS A . n A 1 324 CYS 324 323 323 CYS CYS A . n A 1 325 GLY 325 324 324 GLY GLY A . n A 1 326 LYS 326 325 325 LYS LYS A . n A 1 327 ASN 327 326 326 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PLM 1 401 1322 PLM P1L A . D 4 BOG 1 407 500 BOG BOG A . E 4 BOG 1 408 501 BOG BOG A . F 4 BOG 1 409 502 BOG BOG A . G 4 BOG 1 410 503 BOG BOG A . H 5 DOK 1 411 600 DOK L0R A . I 6 HOH 1 501 1071 HOH HOH A . I 6 HOH 2 502 1072 HOH HOH A . I 6 HOH 3 503 1070 HOH HOH A . I 6 HOH 4 504 1050 HOH HOH A . I 6 HOH 5 505 1004 HOH HOH A . I 6 HOH 6 506 1058 HOH HOH A . I 6 HOH 7 507 1033 HOH HOH A . I 6 HOH 8 508 1048 HOH HOH A . I 6 HOH 9 509 1038 HOH HOH A . I 6 HOH 10 510 1068 HOH HOH A . I 6 HOH 11 511 1003 HOH HOH A . I 6 HOH 12 512 1001 HOH HOH A . I 6 HOH 13 513 1022 HOH HOH A . I 6 HOH 14 514 1015 HOH HOH A . I 6 HOH 15 515 1073 HOH HOH A . I 6 HOH 16 516 1049 HOH HOH A . I 6 HOH 17 517 1051 HOH HOH A . I 6 HOH 18 518 1024 HOH HOH A . I 6 HOH 19 519 1076 HOH HOH A . I 6 HOH 20 520 1075 HOH HOH A . I 6 HOH 21 521 1080 HOH HOH A . I 6 HOH 22 522 1005 HOH HOH A . I 6 HOH 23 523 1030 HOH HOH A . I 6 HOH 24 524 1059 HOH HOH A . I 6 HOH 25 525 1008 HOH HOH A . I 6 HOH 26 526 1078 HOH HOH A . I 6 HOH 27 527 1000 HOH HOH A . I 6 HOH 28 528 1034 HOH HOH A . I 6 HOH 29 529 1007 HOH HOH A . I 6 HOH 30 530 1025 HOH HOH A . I 6 HOH 31 531 1041 HOH HOH A . I 6 HOH 32 532 1064 HOH HOH A . I 6 HOH 33 533 1052 HOH HOH A . I 6 HOH 34 534 1043 HOH HOH A . I 6 HOH 35 535 1062 HOH HOH A . I 6 HOH 36 536 1054 HOH HOH A . I 6 HOH 37 537 1045 HOH HOH A . I 6 HOH 38 538 1040 HOH HOH A . I 6 HOH 39 539 1009 HOH HOH A . I 6 HOH 40 540 1029 HOH HOH A . I 6 HOH 41 541 1018 HOH HOH A . I 6 HOH 42 542 1042 HOH HOH A . I 6 HOH 43 543 1021 HOH HOH A . I 6 HOH 44 544 1047 HOH HOH A . I 6 HOH 45 545 1023 HOH HOH A . I 6 HOH 46 546 1039 HOH HOH A . I 6 HOH 47 547 1013 HOH HOH A . I 6 HOH 48 548 1060 HOH HOH A . I 6 HOH 49 549 1065 HOH HOH A . I 6 HOH 50 550 1019 HOH HOH A . I 6 HOH 51 551 1028 HOH HOH A . I 6 HOH 52 552 1006 HOH HOH A . I 6 HOH 53 553 1066 HOH HOH A . I 6 HOH 54 554 1026 HOH HOH A . I 6 HOH 55 555 1014 HOH HOH A . I 6 HOH 56 556 1032 HOH HOH A . I 6 HOH 57 557 1027 HOH HOH A . I 6 HOH 58 558 1011 HOH HOH A . I 6 HOH 59 559 1046 HOH HOH A . I 6 HOH 60 560 1012 HOH HOH A . I 6 HOH 61 561 1061 HOH HOH A . I 6 HOH 62 562 1079 HOH HOH A . I 6 HOH 63 563 1017 HOH HOH A . I 6 HOH 64 564 1055 HOH HOH A . I 6 HOH 65 565 1037 HOH HOH A . I 6 HOH 66 566 1020 HOH HOH A . I 6 HOH 67 567 1036 HOH HOH A . I 6 HOH 68 568 1069 HOH HOH A . I 6 HOH 69 569 1082 HOH HOH A . I 6 HOH 70 570 1067 HOH HOH A . I 6 HOH 71 571 1081 HOH HOH A . I 6 HOH 72 572 1077 HOH HOH A . I 6 HOH 73 573 1053 HOH HOH A . I 6 HOH 74 574 1063 HOH HOH A . I 6 HOH 75 575 1056 HOH HOH A . I 6 HOH 76 576 1074 HOH HOH A . I 6 HOH 77 577 1044 HOH HOH A . I 6 HOH 78 578 1016 HOH HOH A . I 6 HOH 79 579 1057 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3370 ? 1 MORE 33 ? 1 'SSA (A^2)' 17670 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 517 ? I HOH . 2 1 A HOH 579 ? I HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-04 2 'Structure model' 1 1 2018-04-11 3 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' atom_site_anisotrop 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' pdbx_branch_scheme 7 3 'Structure model' pdbx_chem_comp_identifier 8 3 'Structure model' pdbx_entity_branch 9 3 'Structure model' pdbx_entity_branch_descriptor 10 3 'Structure model' pdbx_entity_branch_link 11 3 'Structure model' pdbx_entity_branch_list 12 3 'Structure model' pdbx_entity_nonpoly 13 3 'Structure model' pdbx_nonpoly_scheme 14 3 'Structure model' pdbx_struct_assembly_gen 15 3 'Structure model' pdbx_struct_special_symmetry 16 3 'Structure model' struct_asym 17 3 'Structure model' struct_conn 18 3 'Structure model' struct_site 19 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_atom_site.B_iso_or_equiv' 5 3 'Structure model' '_atom_site.Cartn_x' 6 3 'Structure model' '_atom_site.Cartn_y' 7 3 'Structure model' '_atom_site.Cartn_z' 8 3 'Structure model' '_atom_site.auth_asym_id' 9 3 'Structure model' '_atom_site.auth_atom_id' 10 3 'Structure model' '_atom_site.auth_comp_id' 11 3 'Structure model' '_atom_site.auth_seq_id' 12 3 'Structure model' '_atom_site.label_asym_id' 13 3 'Structure model' '_atom_site.label_atom_id' 14 3 'Structure model' '_atom_site.label_comp_id' 15 3 'Structure model' '_atom_site.label_entity_id' 16 3 'Structure model' '_atom_site.type_symbol' 17 3 'Structure model' '_atom_site_anisotrop.id' 18 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 19 3 'Structure model' '_chem_comp.mon_nstd_flag' 20 3 'Structure model' '_chem_comp.name' 21 3 'Structure model' '_chem_comp.type' 22 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 23 3 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 24 3 'Structure model' '_struct_conn.pdbx_role' 25 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 26 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -108.2461 -171.1727 148.6078 0.5077 0.4183 0.5142 0.0225 -0.0617 0.0682 2.2997 4.2627 1.4077 1.4596 0.1496 0.0507 -0.1483 0.2565 0.0934 -0.4819 0.1850 -0.0735 -0.0291 -0.0506 -0.0425 'X-RAY DIFFRACTION' 2 ? refined -115.2970 -176.8455 158.1323 0.5501 0.4490 0.6909 -0.0209 -0.1027 -0.0088 4.4633 1.5139 3.2224 0.0908 -0.0650 0.5636 -0.0254 0.2129 0.4229 -0.0068 -0.0308 0.3480 -0.2584 -0.1557 0.0320 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;CHAIN 'A' AND (RESID 1 THROUGH 240 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;CHAIN 'A' AND (RESID 241 THROUGH 326 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 1 ? 'data scaling' ? ? 'Wolfgang Kabsch' ? ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE ? ? package . 2 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'July. 13, 2016' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 88 ? ? O A HOH 501 ? ? 2.08 2 1 O A MET 163 ? ? O A HOH 502 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 28 ? ? -92.98 49.61 2 1 ASN A 145 ? ? -107.73 43.77 3 1 SER A 176 ? ? 60.77 -162.08 4 1 PRO A 194 ? ? -94.58 51.51 5 1 HIS A 195 ? ? -51.40 102.38 6 1 PHE A 212 ? ? -142.87 -52.44 7 1 GLN A 237 ? ? -140.75 52.62 8 1 PHE A 287 ? ? -57.49 -70.12 9 1 ILE A 307 ? ? -124.12 -59.52 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 400 n B 2 NAG 2 B NAG 2 A NAG 401 n B 2 BMA 3 B BMA 3 A BMA 402 n B 2 MAN 4 B MAN 4 A MAN 403 n B 2 MAN 5 B MAN 5 A MAN 404 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man BOG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-octylglucoside MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DManpa1-3[DManpa1-6]DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/3,5,4/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-3-3/a4-b1_b4-c1_c3-d1_c6-e1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(3+1)][a-D-Manp]{}[(6+1)][a-D-Manp]{}}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 3 2 4 MAN C1 O1 3 BMA O3 HO3 sing ? 4 2 5 MAN C1 O1 3 BMA O6 HO6 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 BMA 3 n 2 MAN 4 n 2 MAN 5 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'PALMITIC ACID' PLM 4 'octyl beta-D-glucopyranoside' BOG 5 "(2~{S})-2-(4-chlorophenyl)-3-methyl-1-spiro[1,3-benzodioxole-2,4'-piperidine]-1'-yl-butan-1-one" DOK 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #